current user: public

If you have questions about the server, please let us know.

Query: [O] KOG0006 E3 ubiquitin-protein ligase (Parkin protein), from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .
# Score Template Links and tools%idFirst MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQEFFFKCGAHPTSDKETPVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDVLast
1 -154.000[O] KOG0006 E3 ubiquitin-protein ligase (Parkin protein)  ali  100  1MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQEFFFKCGAHPTSDKETPVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGFAFCRECKEAYHEGECSAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV 437
2 -71.200[O] KOG1814 Predicted E3 ubiquitin ligase  ali follow..  14  1...........................................MLEVEVESDNKHLVADELIALQSIYPEIHLDGNNYGRLNIPVNTESDYFLSFKSPDESTLTDTIVVRHFPDLVMEFFLPEAYPFNSPPTFFLKSSWLPLKQKRVLTSSLIKLWNEIHDCVLF-IATIAFHLPTEMVFPGGFDDLKKEILAFDKNAKLLEFQIRKFQCNVCFDEFNGTDCFQLRCGHVSCQSCLRDYYTMCIQEGMFS-------QIKCIDLDCGKDAPVKELESIVGVQLTNRYKELEEKRRYENDNIIFCPRSFCQGPSKRDPGQKL-----AICQKCDFAFCSFCQATWHGDLSPCKLEGDSKKLVEMYLNDRLVEQVKNDEEAEKWVLLNGQRCPTCDRVVERIDGCCHMNC---LCGTHFCFLCGAYLMEQNPYKHFND. 411
3 -49.900[O] KOG1815 Predicted E3 ubiquitin ligase  ali follow..  15  2.........................................................................DSEEDMLDAHDMESGEDDFYSGGTDDCNDSDDGEPDYGFVEEDADDSAMIASHRSQKNFCVLREEDIRRHQMDNIERVSVVLSITEVEASILLRHFHWSVGRVHDEWFADEERVRKTVG-ILESHVVPPSDDSELTCGICFDSYPPEKIASVSCGHPFCTTCWTGYISTTINDGPGCLM------LRCPDPSCLAAVGHDMVDKLA--------------------------------------------------SEDEKEKYNRYFLRSYIEDNRKGLE-------------IMMFPACARLAFAGMILANSKPCPRCKRPIEKNQGCMHMTC-TPPCKYEFCWLCLGAWMDHGERT..... 289
4 -23.500[J] KOG0004 Ubiquitin/40S ribosomal protein S27a fusion  ali follow..  21  1MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGAKKRKKKSYTTPKKNKHKRKKVKLAVLKYYKVDEN...................................................................................................................................................................................................................................................................................................................................... 111
5 -22.900[L] KOG0011 Nucleotide excision repair factor NEF2, RAD23 component  ali follow..  18  3VTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGFPVAGQKLIYAGKILSDDVPIRDYRIDEKNFVVVMVTKTKAGQGTSAPPEASPTAAPESSTSFPPAPTSGMSHPPPAAREDKSPS............................................................................................................................................................................................................................................................................................................................. 125
6 -22.400[OR] KOG0010 Ubiquitin-like protein  ali follow..  25  37MKVTVK-TPKEKEEFAVPENSSVQQFKEEISKRFKSHTDQLVLIFAGKILKDQDTLSQHGIHDGLTVHLVIKTQNRPQDHSAQQTNTAGSNVTTSSTPNSNST.............................................................................................................................................................................................................................................................................................................................................. 138
7 -22.000[J] KOG0003 Ubiquitin/60s ribosomal protein L40 fusion  ali follow..  33  1MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR............................................................................................................................................................................................................................................................................................................................................................................. 72
8 -21.000[DO] KOG0005 Ubiquitin-like protein  ali follow..  22  1MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGGSVLHLVLA............................................................................................................................................................................................................................................................................................................................................................................. 72
9 -20.700[O] COG5272 Ubiquitin  ali follow..  33  1MQIFVKTLTGKTITLEVEPSDSIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR............................................................................................................................................................................................................................................................................................................................................................................. 72
10 -18.900[R] COG5222 Uncharacterized conserved protein, contains RING Zn-finger  ali follow..  11  3STIFYRFKSQRNTRILFDGTGTVFDLKREIIQENKLDGTDFQLKIYNPDTEEEYDDDAFVIPRSTSVIVKRSPAIKSFSVHSRLKGNVGAAALGNATRYVTGRPRVLQKRQHTATTTANVSGTT---------------------------------EEERIASMFATQENQWEQTQEEMSAATPVFFKSQTNKNSAQENEGPPPPGYMCYRCGGR-----------DH-WIKNC-RIRRTTGIPKKFLKSIEIDPETMTPEEMAQRKIMITDEGKFVVQVEDKQSWEDYQRKRENRQIDDLKCP---TGGLLR----------PVKTSKCCNIDFSKEA---------------------------------------ENALVESDFVCPNCETR......................................... 333
11 -18.700[O] KOG3493 Ubiquitin-like protein  ali follow..  2IEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTKHEKIVLKKWYTIFKDPIRLSDYEIHDGMNLELYYQ............................................................................................................................................................................................................................................................................................................................................................................. 73
12 -17.700[L] KOG0012 DNA damage inducible protein  ali follow..  12  1MKITVTTSDDKVFCLDVAQDLELENLKALCAMEIGAEVSQIAVIFNGRELSDKQTLQQCGVGDGDFIMLERRRSANRPVGGNPAISTLDFSNIAVPGTSSGGSPPSRRVQQQGVQQPQFNNLTDIPTTDEFNVNFDPETVRQMFLSSPETLSLLRQYNPSLAEAIDSGDKEKFARLLREHITERKRRNEHRMRMLNADPFDEETQRLIAEEIKQKNIQDNMAAAIEYNPEIFGTVTMLYINCKVNGIPVKAFVDSGAQTTIMSKDCATVLGQQPMDMLLGLDMLKRHQ..................................................................................................................................................... 336
13 -16.900[OR] KOG0001 Ubiquitin and ubiquitin-like proteins  ali follow..  24  1MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL.............................................................................................................................................................................................................................................................................................................................. 119
14 -16.600[O] KOG2231 Predicted E3 ubiquitin ligase  ali follow..  10  23........................................................................................................................................................................................ANTTTDNAAVKPEALESYTGNDDNACVVCFKNVEIFSI---DCDHPVCYEC-----STRMR---------LCQQNECPI--CRHVLSKVLFTLLYSKKYRIGFCTAEIRQQFFKLLDHPCP---CDAPPYRTFEGLRNHVRSE-----KLLYCDLCVETLN-------------TFERRCYTQAELQLHNTKGDPDNRSHRGHPLCEYCNKRVDRDELFRHLR------EHYFCHFC-ADLAEHFRAEHF... 260
15 -16.300[O] KOG0978 E3 ubiquitin ligase involved in syntaxin degradation  ali follow..  637...............EVLELKEGIKVKEQEAEASIAEMETIGQAYEDMQTQNQHLLQQVAERDDYNIKLVSESVKTKHAYNTHLSEKQVMEKQLHQVNASVENFKARIAHNEEQMKGCFSEAYKLIQEDRHLVISLETTKWEVADKEYEQISRRTDDIKLELDDEREKKKLEEELMELNKELEELGSESVEAAIVRLQEEVKNCKNILKCGVCFDRPKEVVI--VKCYHLFCQQCIQRSLEIRHRK--------------CPG--CGTAFGQNDVRLV............................................................................................................................................................... 897
16 -16.000[S] KOG4367 Predicted Zn-finger protein  ali follow..  10  1........................................................................................................................................................................................................MEEMEEELKCPVCGSFYREPII--LPCSHNLCQACARNILVQTPESE----------SPQSHRAAGSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQK--SPNGVRVFP----------PAMPPPATHLSPALAPVPRNSCCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEAT----VMC--EQCDVFYCDPCRLRCHPPRGPLAKHRL 209
17 -15.700[T] KOG4361 BCL2-associated athanogene-like proteins and related BAG family chaperone regulators  ali follow..  51IRVRIKYG-AVYHEINISPQASFGELKKMLTGPTGIHHQDQKLMYKDKERDSKAFLDVSGVKDKSKMVLIEDPLSQEKRFLEMRKIAKTEKASKAISDISLEVDRLGGRVSAFEMVTKKGGKIAEKDLVTVIELL---------------MNELIKLDAIVAEGDVKLQRKMQVKRVQNYVETLDALKVKNSMANGQQKQSSTAQRL...................................................................................................................................................................................................................................... 241
18 -15.700[O] KOG0823 Predicted E3 ubiquitin ligase  ali follow..  13  84.................................................................................................................................................................................ERLVENGENKTYLIAKALNMEKTSSVPGGFFDCNICLEKAEDPILTC--CGHLFCWGCFYQLPLIYLNIKE------------CPV--CDGEVTDAEVIPIYGNGDDCD-----TKPKLEDCGISLPPRPNAKRV............................................................................................................................. 198
19 -15.400[K] KOG4495 RNA polymerase II transcription elongation factor Elongin/SIII, subunit elongin B  ali follow..  16  1MDVFLVIRRHKTIFTDAKESSTVFELKRVVEGILKRPPDEQRLYKDYQLLDDGKTLGECGFTSQATVGLAFRAHDAFEALCIEPFSSPPELLDVMKPQESGSSANE........................................................................................................................................................................................................................................................................................................................................... 114
20 -15.400[O] KOG4583 Membrane-associated ER protein involved in stress response (contains ubiquitin-like domain)  ali follow..  11  29VRLLIKSSNQQDLNVDSDLCWTVQRLKKHLSLIY--LIQDQKLIYSGKLLDDSQKISEVVYQQHHIFHLVCASKQVIRPAAKAPTVPQKDAVPAGPEVTGNANELRQRHAPHQQQA................................................................................................................................................................................................................................................................................................................................. 154
21 -15.200[O] KOG0824 Predicted E3 ubiquitin ligase  ali follow..  13  3............................................................................................................................................................................................ASTSSPSQQLQQAINSTIDKECAVCYSEMILPTTIP-SCGHKFCFICLKGVSVSN--------------NGDCPI--CRGPIDSQIFKK................................................................................................................................................................ 74
22 -15.100[K] KOG1244 Predicted transcription factor Requiem/NEURO-D4  ali follow..  14  260...........................................................................................................................................................................................................................................................................................................................KKGPDGLALPNNYCDFCELVSCSDCGRSGHP--SCLQFTP----------------VMMAAVKTYRWQCIECKCCNICGTSENDDDDCDHMYCLTPSMSE---WSC................ 371
23 -14.700[R] KOG4684 Uncharacterized conserved protein, contains C4-type Zn-finger  ali follow..  19  42.................................................................................................................................................................................................YTAIASPDASGIPVINCRVC---QSLINLDGKLHQHVVCTVC---------NEATPIKNPPTGKKVRCP---CNCLL-----------------------ICKDTSRRIGCPRPNCRRIINLGPVEQPAQPALPIQPEGTRVVCGHCGNTF---------------------------------LWMELRFNTLAKCPHCKKICSSSVGSALPRRRCCAY........................ 197
24 -14.600[R] KOG4377 Zn-finger protein  ali follow..  17  307...............................................................................................................................................................................................................................................................................................................CGFERCGY----RNHQSHFHCNRR---DCHYSFCDKTRFVQHT-MQCGVASCGYATASGAATETNHLSRIDPTEAVTASSRKTSHHCRKCDYVCTDSN--AHRRCDSPGCSYHYCVTCDGGVLSRAQ-AH.... 478
25 -14.400[O] KOG0320 Predicted E3 ubiquitin ligase  ali follow..  18  241........................................................................................................................................................................................DLDVASPPKRVNRDIDESQKEELYKCPICMDSVSKREPVSTKCGHVFCRECIETAIRAT----------------KCPI--CNKKLTARQFFRI............................................................................................................................................................... 317
26 -14.200[O] KOG0317 Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein  ali follow..  14  261........................................................................................................................................................................................KESQLTHINLSDKNQLPFIPEASRKCILCLMNMSDPSC--APCGHLFCWSCLMSWCKER----------------ECPL--CRQHCQPQEILVLRQ............................................................................................................................................................. 337
27 -14.100[O] KOG0826 Predicted E3 ubiquitin ligase involved in peroxisome organization  ali follow..  12  212.................................................................................................................................................................................RRKVGGTLINPEAMPRKQLPKEVQQSLPQRGECPVCLLSIQTPTACS-VSGYVFCWKCIVSHMKEH----------------TCPV--THYPISLDDLVRIYET............................................................................................................................................................ 297
28 -13.900[R] KOG3002 Zn finger protein  ali follow..  19  29.....................................................................................................................................................................................EANSKPTKSGSGSIGKFHSSNGVYELLECPVCTNLMYP--IHQCPNGHTLCSSC-----KLRVQN-------------TCPT--CRYELGNIRCLAL---------------EKVAESLEVPCRYQGCQDIFPYYSKLKHEQ-------HCRFRSY---------------------------------------------------SCPECSVTGDIPTLVDHLK.............................. 166
29 -13.900[O] COG5227 Ubiquitin-like protein (sentrin)  ali follow..  19  36INLKVVGQDNNEVFFKIKKTTEFSKLMKIYCARQGKSMNSLRFLVDGERIRPDQTPAELDMEDGDQIEAVLEQ............................................................................................................................................................................................................................................................................................................................................................................ 108
30 -13.800[TZ] KOG1044 Actin-binding LIM Zn-finger protein Limatin involved in axon guidance  ali follow..  14  6.................................................................................................................................................................................................................CHGCGEFVEGEVVTALG--HPNCFAC----------------------------TICKRPFPPGDRVTFNGRDCLCQLAQPMSSSPKETTFSSNC--AGCGRDIKNGQALLALDKQ--------HLGCFKCKS-------CGK-----------VLTGEYISKDGAPYCEKDYQGLFGVKCEACHQFITGK----HPSCAR-------CSRCNQMFTE.......... 168
31 -13.600[T] COG5432 RING-finger-containing E3 ubiquitin ligase  ali follow..  12  13..................................................................................................................................................................................................TTSIPSLYQLDTLLRCHICKDFLKVPVL--TPCGHTFCSLCIRTHLNNQ----------------NCPL--CLFEFRESLLRS---SEIIQSYTSL................................................................................................................................................... 90
32 -13.600[L] KOG0287 Postreplication repair protein RAD18  ali follow..  12  13..................................................................................................................................................................................................TTSIPSLYQLDTLLRCHICKDFLKVPVL--TPCGHTFCSLCIRTHLNNQ----------------NCPL--CLFEFRESLLRS---SEIIQSYTSL................................................................................................................................................... 90
33 -13.600[OU] COG5082 Arginine methyltransferase-interacting protein, contains RING Zn-finger  ali follow..  15  44............................................................................................................................................................................................................................................................................................RYFGVSDDDKDAIKEAAPKC---NCS-----QRGHLKKDCPHIICSYCGAT-CSKCDEVGHYRSQCPH-------------------------------KWKKVQCTLCKSKKHSKERCPSIKPKVLPFHTIYCYNCGGK-------GHFGD. 175
34 -13.600[O] KOG1769 Ubiquitin-like proteins  ali follow..  17  17INLKVAGQDGSVVQFKIKRHTSLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLRMEDEDTIDVFQQQ............................................................................................................................................................................................................................................................................................................................................................................ 89
35 -13.500[T] KOG1701 Focal adhesion adaptor protein Paxillin and related LIM proteins  ali follow..  16  438...........................................................................................................................................................................................................HVDCFTCIICNNKLRGQPFYAVE-KKAYCEPCYINTLE------------------QC--NVCSKPIMERILRAT---------KAYHPHCFT-------C--VMCHRSL----DGIPFTVDAGGLIHCIEDFCSVCKEP---------------------------APGQEETVRIVALDRDFHVCEDCGGLLSEGDN-GHILCK--TCNSA-TAKASTD............. 611
36 -13.300[K] KOG2482 Predicted C2H2-type Zn-finger protein  ali follow..  13  41..........................................................................................................................................................................................................EGSPSVPCIFCEEHFPVAEQDKL--KHMYILYWRKRFTEQPITDFCSVIRINSTAPFEEQENLCDVLPEDRILREELQKQRLREILEQQQQERNDTNFHGVC----CNEEFLGNRSV-QKKLDNLQCLYCEKTFRDKNTLKDHMRKK-NYLELGKSWEEVQLEDDRELLDHQEDDWSDWEEHPASAVCLFCEKQAETIEKLVHME-IKSELGLNFCYGCHVKFKS.......... 356
37 -13.000[R] COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers  ali follow..  48.......DSGGSSESSNEDMRDNIPIVSGRKKTVRLNRLQ-----RESEQFENSALKDINVEYQSNLSATGESVNTTTVSAINEDTREVILGRPSPKLANQSTLPTDYSRFLPKRKDFEKKSQVGPVLSSNASTVRMNTIIDYQPDVCKDYKLTGYCGYGDTCKFLHMRE-AGWQLDREWDSVQEKYKKGAKLEEGMVKNEKKEDIPFVCLICKKDYRSPIA--TTCGHHFCEQCAITRYRKT----------------TCIQ--CGADTKGLFSVDKNFDRLLKNRKSKNDEA............................................................................................................................................... 319
38 -12.900[R] COG5236 Uncharacterized conserved protein, contains RING Zn-finger  ali follow..  11  32.................................................................................................................................................................................KNFRRKQKKNNLSAEPNLTTSSADDTDEENELCVICARKLTYVSL--TPCHHKTCHICGFRQ--RALYNKKSCLICRTENEEVMFTDRIDGDISDKYNFCEKNEKYGINFTSEEVATETLNLLKFFCPLSKDEKKYNEHLKSEHNRMICLICATHKHAFCAFCSG----------------------------KRFYSDDELYIHMRNQHEKCHICDKMLFDHFKHSHYVCTVQTCLDN-VFKDELELQAHILQEH.... 307
39 -12.900[R] KOG3608 Zn finger proteins  ali follow..  12  17...........................................................................................................................................................RKKPAELELTCGWRDCQEICTGEWSLNGHIGDHLEHYAKAQDDRGAHAEHTEHQCT-CFRTENQVEFERHSYYHGYCDLHPEIP-ACTAPARLMEKLPALGQNFRCGWTDCEREFVSIVEF-QDHIVKHALFEYDIQKTPEDERPKTMCNWAMCHKHMGNKYRSTHSNKKQVACFHCGELFCAQCFKFFATKKLLKSHVVRHVNCYKCTMCDMTCSSASSLTTHIRYRHLKDKPCSECDTRCVRESDLAHVQCEHPDCHYSVCHCCERFFKSGKS....... 364
40 -12.800[S] KOG0013 Uncharacterized conserved protein  ali follow..  11  171ETVLIRYSDDKDYSIQINPNLPFSHAKSQLEE--VGLENVQRFFFLGRVLQFKKSLSQQGWTSGMIIQAM............................................................................................................................................................................................................................................................................................................................................................................... 239
41 -12.700[K] KOG2907 RNA polymerase I transcription factor TFIIS, subunit A12.2/RPA12  ali follow..  14  5..........................................................................................................................................................................................................................................................................................................GSLIFCL--DCGDLLENPNAVLGSNVE-----------CSQCKAIYPKSQFSNLKVVTTTADDAFPSSKKSVVKTSLKKNELKDGATIKEKCPQCGNEEMNYHTLQLRSADEGATVFYTCTSCGYKFRTNN........ 125
42 -12.500[O] KOG1571 Predicted E3 ubiquitin ligase  ali follow..  17LGLCAREYVHYKRTAKVLKAAPQYNIDGDLKSVVERQRDKK-AVIRGTVTPIGVPLRSSLVPSVSGVLQIVKLHEHRVTRGFAGSGVRQRGLQTTEEVLREGSFLTAIGELELDGDTLRMQPSNEGPLFLTTATKSTLIKRFEDAKTTTILKLVVCSTISAILVAFIAKKLYRKRKQEREEAKIRERLDTERRERRARSRPHTLSQDQLCVVCST--NPKEIILLPCGHVLCEDC-----AQKISV-------------TCPV--CRGSIVSKA................................................................................................................................................................... 333
43 -12.500[O] KOG1645 RING-finger-containing E3 ubiquitin ligase  ali follow..  3..........................................................................PRRSYPFSGHGGTIARFIEFGEAFGHYGEEEDEEEEDEEEAYVDYGEVQEEDEEEEEEEDSERQTREYIDVL----------------------------------SPVRVSQNESEGIENQNRRMSNGNKVTLRDCLVLSVWKFGAVANTKSGILDSIVFPVDTCMDIPASTS-----------GFSS--DEVEGSLRDVRKIVDDEAHKRILFLEAKLRSIEQKTA....................................................................................................................................... 192
44 -12.400[L] COG0551 Zn-finger domain associated with topoisomerase type I  ali follow..  10  7.......................................................................................................................................................................................................................................CPTCGRNMAIRTASTGVF---------LGCTGYALPPKERCKTTINLIPEAELLNVLDESSETKALMDRKR-CTKPNCDGYEEGSFKIKGYDGPVVECDKCGADMHLK-LGRFGKYMGCTNCDN-----------RKILKNGEVAPPKEEPVHFPELKCEKSDAYFVLRDG-VFMSAHNPKSRE...................... 196
45 -12.400[O] COG5574 RING-finger-containing E3 ubiquitin ligase  ali follow..  153.......SEVQSMEISLNCDHEFEKLTSELQSVEGLQREQRKILFN-DILSHSLIASPNSKKKYKSLYCWRKIFEIYMDSDIFISCKEADQSHERTPELAERHLKWFDDQVRLAKCLPSSSKHRDRILYAKFLELNESLLKVASFQQMNKLAVTKIMKKFDKRTSLTAQPLFFQVIESDPLLLVDNASKACFSLSSKLFSIIPQLRDFECAICSN-----KPVRLGCSHVFCLHCLIILQKQKVDF--------------CPL--CRAKEVMNFMKTYFPREIKEKFEENENDTFTPSSISVVSGQNNC................................................................................................................................ 453
46 -12.300[R] KOG3183 Predicted Zn-finger protein  ali follow..  15  13...............................................................................................................................................................................................................................................................................................................CSVDYCK----------QIDFLPFTCDRCLQVYCHDCPKGNRGDVTCAKGVRLNPDEDPNITWEKHVNTDCDPSNYEKAVKKKKCPVPRCR---ELLTFSNTIKC--RDCSIDHC................... 126
47 -12.300[O] KOG3800 Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor  ali follow..  19  3...............................................................................................................................................................................................................................................................................................................CK---CKSNEYTNKQLV------MMINECGHPLCKNC---------------------------------------DNIFALNSGNCHVCNRVLRKNN.................................... 54
48 -12.200[T] KOG4825 Component of synaptic membrane glycine-, glutamate- and thienylcyclohexylpiperidine-binding glycoprotein (43kDa)  ali follow..  15  754....................................................................................................................................................................................................................................................................................................................CIFCGERSESFTEEGLDLHYWKHCLML-CDHCKQTEHLLTECDK-------------------------------KDGFGKCYRCSEAVFKEELPRHIDCNPAK-LANRCPLCHENWKAH......... 862
49 -12.200[O] COG5540 RING-finger-containing ubiquitin ligase  ali follow..  11  144........................................FLLVQRG----------KCTYFDK-ALEAQRLGFKGVIVGDNRSPSSFRLHYMVAPDKVDESKVHIPSLFVSTSSYNLLWSDLLHSYRQPLKLYAKPEELGDMFWPFLLCFSPSIIMTKSKTRRFIEDLPSRTISREGFYSEEEEIENSTQNGELVPLMDESTRTFGVECVICLESTKGDKVVALPCKHEFHRPCIAKWIVDY--------------RHACPT--CNTEVPPP.................................................................................................................................................................... 369
50 -12.000[K] KOG2691 RNA polymerase II subunit 9  ali follow..  14  2..........................................................................................................................................................................................................................................................................................................STMKFCR--ECNNILYPKEDKEQKILLYA---------CRNCDHQEVADNSCVYRNEVHHSVSERTQILTDVASDPTLPRTKA------VRCSKCQATARGEEGMTFFVCCNPNCGHRW.................... 112
51 -12.000[A] KOG0007 Splicing factor 3a, subunit 1  ali follow..  15  697VTIQVLVPNGQMIAVTMALSEPIANLKTKLQDETGMPPAKQKIFYEGMFFKDSNTMAFYNLVNGTTVHLQVKERGGRKK...................................................................................................................................................................................................................................................................................................................................................................... 784
52 -11.600[TZ] KOG2272 Focal adhesion protein PINCH-1, contains LIM domains  ali follow..  12  8.................................................................................................................................................................................................................CTRCADGFEPTEKIVNSNGELWCAQCFRPFQDGIFFEGRKYCERDFHVLFAPCCNKCGEFVIGRVIKAMSASWHPQCFKELADCGFIKNQNRALCHEQKCHGLIDLRFRGEVYHGYHFSCTACGTELCGACRRPWHVEHVCAKCEKPFLGHRHYEKRGLAY--------ETHYHQLFGNLCFVCNQVINKAWCVHHFAC--SVCDTKVCKKCYDR............. 314
53 -11.600[DKL] COG5220 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3  ali follow..  1.....................................................................................................................................................................................................MDDEGARKVDEKCPLCQADR--KLLINPECYHKMCESCVDRIFTTG--------------PAQCPTPGCNKILRKAKFREQTFEDAQIEREVDVRKRISRIFNKG----------------QQEFDSLQAYNDYLEEVEILTFNLI-IDVEETEEKVKQYEKQNRDSIAANSARAAAEARILAQNEILLKRQKQEAREAAIRE..................................... 178
54 -11.500[O] KOG1813 Predicted E3 ubiquitin ligase  ali follow..  12  271...........................................................................................................................................................................................................NALPFACFICREPFVDPVV--TKCKHYFCEHCALKHHTKN----------------KCFV--CNQPTMGIFNAAHEIKKRMAEERSKAEQG............................................................................................................................................... 342
55 -11.500[R] KOG4299 PHD Zn-finger protein  ali follow..  70.....NSDDGSKDDLDYSPSVKRKHVNGEGAEKGDHD--------TSNNGPSITKLRRKVRRTYDTKDGFVAWNTLDDDFRPIVPDQERSRKINPQKGNNNNLLKENKSLKTTAKDLSDISSSSMKKANNSSKPLFSGKLTFKANIPVPTSEVVTENNVTRNVTVYSNQKHLGNESENFNDMEGRAEDISSNELLPTPEEYPYRYNNDYCSACHGP-------NFLC----CETCPNSF------------------HFTC--------IDPPIEEKNLPDDAW------------------YCN--ECKHHSLYNELDEQEELESNVKEE-QFHLPHSISSFFRGVGSGVMGEYIETDVLKHLKSSRRSNGEERDPLLLKSKSGTPILCFRCHKSALVSQ----LAC--DYCNSYWCWKC................ 453
56 -11.400[O] KOG4265 Predicted E3 ubiquitin ligase  ali follow..  75.......PAPHEPVKTLRSLVNIRKDSLRLVRYKDDADSPTEDGDKPRVLYSLEFTFDADARVAITIYCQASEEFLNGRAVYSPKSPSLQSETVHYKRGVSQQFSLPSFKIDFSEWKDDELNFDLDRGVFPVVIQAVVDEGDVVEVTGHAHVLLAAFEKHM-SFSVKPLKQKQIVDRVSYLLQEIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLI--LPCRHLLCTSC-----ADTLRYQA-----------NCPI--CRLFPGP-----PADPGGAEEARSPVPRVLQPRPG----PEPGA................................................................................................................................ 350
57 -11.300[O] KOG4400 E3 ubiquitin ligase interacting with arginine methyltransferase  ali follow..  11  67...................................................................................................................................................................................................................................................................................................LRRINQRNRDKFC---ACRQQGHIVQDCPEAKDNVSICFRCGSK-CFICHENGHLSGQCE--------------------------QNPKGLYPKGGCCKFCSSVHHLAKDCDQ----VNKDDVSFGHVVGVA............. 183
58 -11.200[S] KOG4638 Uncharacterized conserved protein  ali follow..  10.....SFRGSPRRNSILSASNIIQAPISTLLEYSGLFRAR-----SPSHEAETLVSDDSSGLSNGEVAIRIIGNTEQDAETDTNALREPGHSELLGSSATQVDPMGGASEGASQAAPGDPAAGDAASRDSPYQRYDIQQAARWIEQIL----------PFSLLLLVVFIRQHLQGFFVAIWIAAVMFKSNDILKKQTALKGERHISALIGISVAFTAHVVGVYWWFRKDDL-PPFWHAIFIIVYPVGSFGAY---------------SLVPIFLRYTCPAGLNDFQGQLLTLVEYFMLLYRSLLPTPVWYRFFLNKDYGSLFSSLMTG------LYLTFKLTSVVEKLREIGNEIQVQSFFTALKALSRKEVHYGSYATTEQATCVPSARRRCTPQFFFAANTCFAKIA--QSGEVFLHIAIIFV-------EYLD. 409
59 -11.200[KL] COG5151 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1  ali follow..  89MVLVLDLSNSMEERFDLQIKYASEFVLEFFEQN---PISQLSIIGVMD--GIAHRITDLHGNPQSHIQKLKSLRDCSGNFSLQNALEMARASLSHIASHGTREVLIIFGSILSSDPGDIFKT-----------------IDALVHDSIRVRIVGLAAEVAICKEICNKTNSSTKNAYGVVISEQHFRELLLESTIPPATDSAKTTDASLVMMGFPSKVVEQLPSLCACHFHCPRCKAKVCTLPIE---------------CPSCSLVLILSTHLARSYHHLFPLKNWSEIPWSA---NPKSTHC---ACQLPFPKPPVSPFDESTSSACPSCKNHFCLDCDVFAHE---------------------------------------QLHECYGCQCSGN....................................... 421
60 -11.200[KL] KOG2807 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1  ali follow..  89MVLVLDLSNSMEERFDLQIKYASEFVLEFFEQN---PISQLSIIGVMD--GIAHRITDLHGNPQSHIQKLKSLRDCSGNFSLQNALEMARASLSHIASHGTREVLIIFGSILSSDPGDIFKT-----------------IDALVHDSIRVRIVGLAAEVAICKEICNKTNSSTKNAYGVVISEQHFRELLLESTIPPATDSAKTTDASLVMMGFPSKVVEQLPSLCACHFHCPRCKAKVCTLPIE---------------CPSCSLVLILSTHLARSYHHLFPLKNWSEIPWSA---NPKSTHC---ACQLPFPKPPVSPFDESTSSACPSCKNHFCLDCDVFAHE---------------------------------------QLHECYGCQCSGN....................................... 421
61 -11.100[S] COG4306 Uncharacterized protein conserved in bacteria  ali follow..  14  5..........................................................................................................................................................................................................................................................................................................RAAQICTN-------------------HVATTAADQAFCSHSG------------------------------------------EATILQYPKCSASIRGDD-EGVLGFGGDYEPPTFCNNCGSRFP........... 79
62 -11.100[K] KOG2461 Transcription factor BLIMP-1/PRDI-BF1, contains C2H2-type Zn-finger and SET domains  ali follow..  10  499......................................................................................................................................................................................................QQQENGKTRYACKDCNKTFGQLSNLKVHVRHT-CEICTKEFTLAHLQKHHLVHTGERPHRCDCDKRFSSTSNLKTHLRLHNGQAKFTQYVHLRLHKRLHANERPYC--GTCGKKYI-SPSGLRTHWKTTTCKEEDMKDIDEGSMSGSGYGNLGIFENTLNSELKRPLMPTIYSKYNLPNASLLGQGPSGMQEQQAPPPTQGSHLQG-PQH--FQMDHSGGSGQQQHPQHNGIHRLP... 801
63 -11.100[O] KOG3970 Predicted E3 ubiquitin ligase  ali follow..  16  41.....................................................................................................................................................................................................LTWLTDQDYDPNCSLCKTTLAEGDTIRLNCLHLLHWKCFDEWAANFPATT--------------------------------------------------APAGYRCPC--CSQEVFPPINEVSPLIEKLR............................................................................................................. 119
64 -11.000[K] KOG2906 RNA polymerase III subunit C11  ali follow..  20  1............................................................................................................................................................................................................................................................................................................MEFCP--TCGNLLRYEGGGNS------------RFFCSTCPYVAYIQRQVEIKKKQLLVKKS--------IEAVVTKDDIPTAAETEAPCPRCGHDKAYFKSMQIRSADEPESRFYRCLKCEFTWREE......... 106
65 -10.900[TZR] KOG1704 FOG: LIM domain  ali follow..  14  106.................................................................................................................................................................................................................................DSDVRYCEDLNAEEADTCLGSGVVQYAPFDTKCEKMLQGSPDIKFQLPKLKRPPIKMQYDS-QVIFGDECLEAEGRSWC--AQCNDVL-----ADQKYMQRANKPVCLKCFCTTCRLSWHASAEC---------------------------------------CCVCSKNLLGVK--ESLFCGYQTCG....................... 296
66 -10.800[R] KOG0490 Transcription factor, contains HOX domain  ali follow..  17  5.......................................................................................................................................................................................................................................CAGC-----ERPILDRFLLNVLDRAWHIKC------------------------------------------C--CECKTNLSEKCFSRE-----------GKLYC-----------------------------------------KNDFFRRFGTKCAGCAQGISPSD---HLNCFT-------CMVCNKQLST---GEELY.. 106
67 -10.800[R] KOG4323 Polycomb-like PHD Zn-finger protein  ali follow..  20  165...................................................................................................................................................................................................................................................................................RKIQRPVAYNPNATALKRKSRKVDMVTLC----CQRGHSPLSNR--------------IVFCDGCNSPYHQ---C-------------------IDDATVQDVDAEWF------CMKCQYRRAKQPLET................................. 254
68 -10.700[K] KOG2857 Predicted MYND Zn-finger protein/hormone receptor interactor  ali follow..  23  3...............................................................................................................................................................................................................................................................................................................................................................................................PRATQTCEICEKVVSK------YKC--PSCLVPYCSLCFKIHKVCNLINNAET. 48
69 -10.700[DR] KOG4739 Uncharacterized protein involved in synaptonemal complex formation  ali follow..  15  4...............................................................................................................................................................................................................IQCNHCGIKPNQTKLYLTACGHVFCQNCTKAAFNSQ-----------------CY--LCKKPLKVDEINKNLRPDLMELFKD.................................................................................................................................................... 66
70 -10.600[S] KOG4623 Uncharacterized conserved protein  ali follow..  13  40..............................................................................................................................................................................................................RVNCWFC----GNVRVPYQDRNSWTCPSCYNGF-----KDGD------------------------------YNRDITSQRDCSLGSQKNSSKGSS-----------SICANSYYSDVLTAQPPAPKNGLCDQCNE--AQRLKVEKLSQFEPKNESRFDQE---------KVYRERLEKQFRLCSSCERHVNK...................................... 176
71 -10.300[S] COG5417 Uncharacterized small protein  ali follow..  12  9VTVDFTNWGADKYDLRIPVHQPIKALIINLAETLKIEYKDIKTTNKAILLSDDDKLTNFQIADGDILEIL............................................................................................................................................................................................................................................................................................................................................................................... 83
72 -10.200[O] COG5243 HRD ubiquitin ligase complex, ER membrane component  ali follow..  10  144TLIFSRFSFNLVLLAVVDYQIITRCISSIYTNQKSDIESTSLYLIQVMEF---LLIDLLNLFLQTCLNFWEFYRSQQSLSNENNHIVHGDPTDENTVESDQSQPVLNDDDDDDDDDRQFTGLEGKFMYEKAIDVFTRFLKTALHLSMLIPFRMPMMLLKDVVWDILALYQSGTSLWK---IWRNNKQLDDTLVTVTVEQLQNSANDDNICIICMDELKNKKPKRLPCGHILHLSCLKNWMERSQT----------------------------------------------------------CPI--CRLPVFDEKGNVVQTTFTSN............................................................................................................. 418
73 -10.100[S] KOG3899 Uncharacterized conserved protein  ali follow..  12  264...........................................................................................................................................................................................................................................................................AIPSNIQLHRNVIDRFVDVFKAQVAQNFPDDATTEKC---ACHKQCADFDRNGAPLANGACCCYCRPMWCVEC--------------------------ARWFAARQSDVDREVWLEQKC-TCPMCRAK--------------------FC................... 379
74 -10.100[S] KOG2660 Locus-specific chromosome binding proteins  ali follow..  6.......................................................................................................................................................................................................KKETMRACLSCSICDNILRDA--------TTISEKCIYEKITEDEIE-------------TCPV--CNIDLGSTPLEKLRPDHNLQDLRAKIFALKRRKVK......................................................................................................................................... 83
75 -10.100[W] KOG3658 Tumor necrosis factor-alpha-converting enzyme (TACE/ADAM17) and related metalloproteases  ali follow..  243.TCSLYMQADHKLYEHIRMKEGNNDPIRTREEIVSLFYNHIKAV--------NEIYEGTNFNGIKGLHFVIQRTSIYTPDSCDRGRAKTDSDNPFCEENVDVSNFLNLNSQRNHSAFCLAYALTFRDFVGG----------------TLGLAWVASPQFNTAGGICQVHQ----------RYNEGSRGWVYRSLNTGIVTLVNYGNRVPARVSQLTLAHEIGHNFGSPHDFPAEC-NFIMFASATSGDKPNNGKFS---PCSVKNISAVLAVVLKSMPVDPTRNASPVGIGKRNCFQERTSAFCPGEECDCGFSQAGNGGPGPCKRKPGAQCSPS-C--CNPD-----TCSLHGK----------NEEKICRQESECSNLQTCDGRNAQCPV---SPPKHDGCQD-VCSSGQCNGSVC-DCFLTEGKADELCF.... 656

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 5 8 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24