current user: public

If you have questions about the server, please let us know.

Query: [C] KOG0069 Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily), from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .
# Score Template Links and tools%idFirst MCRKSRGAKSPVNNDVVDLAVGSSRRFHKAFKVLISHPNVPAPALELLRSRGAETIICQSVPPSRDEILQKVPGLRCVSTMSSGIDFVDIPEFQKRGIPLGHTPGVVKNAVADLAIGLMIAAGRHFHAGRTEIERSQWKIEQINWMMGQEIRDSVIGFFGFGGISQAIAKRLQCWDVAKIIYHTRTRKENDGDFKAEHVSFEQLLQESDFLVVAAPLTNETREKFNGKAFNLMKRSSVFVNVARGGLDVTTPEPLPANSPLLNVPNCEGLKMSTTKPFKVLIAHTDVPPEGIEILKEQCEILQVINEPPKNRPEILEKIRGAHAVIWGGRDILNAEILDAAGPQLKAVSTMSSGINNVDVPELKKRGIPLGSTPAMLTVAVADLTVGLLIAAARRFQEGRRKIDSDKWDKDHLNWMLGQDIRDSTVGFYGFGGIGQAVAKRLMGFDIKRMLYTTRNRVSQDIEERFNAKKVDFETLLAESDFLIIASPLTKETLGLFNATVFNKMKETAVLVNVGRGKIVNQDDLYEALKSNRIFAAGLDVMDPEPLPSNDKLLTLDNVVVTPHVGYATRRTRVDAANLASRNVLKGLAGEPMLSPAYLast
1 -174.000[C] KOG0069 Glyoxylate/hydroxypyruvate reductase (D-isomer-specific 2-hydroxy acid dehydrogenase superfamily)  ali  100  1MCRKSRGAKSPVNNDVVDLAVGSSRRFHKAFKVLISHPNVPAPALELLRSRGAETIICQSVPPSRDEILQKVPGLRCVSTMSSGIDFVDIPEFQKRGIPLGHTPGVVKNAVADLAIGLMIAAGRHFHAGRTEIERSQWKIEQINWMMGQEIRDSVIGFFGFGGISQAIAKRLQCWDVAKIIYHTRTRKENDGDFKAEHVSFEQLLQESDFLVVAAPLTNETREKFNGKAFNLMKRSSVFVNVARGGLDVTTPEPLPANSPLLNVPNCEGLKMSTTKPFKVLIAHTDVPPEGIEILKEQCEILQVINEPPKNRPEILEKIRGAHAVIWGGRDILNAEILDAAGPQLKAVSTMSSGINNVDVPELKKRGIPLGSTPAMLTVAVADLTVGLLIAAARRFQEGRRKIDSDKWDKDHLNWMLGQDIRDSTVGFYGFGGIGQAVAKRLMGFDIKRMLYTTRNRVSQDIEERFNAKKVDFETLLAESDFLIIASPLTKETLGLFNATVFNKMKETAVLVNVGRGKIVNQDDLYEALKSNRIFAAGLDVMDPEPLPSNDKLLTLDNVVVTPHVGYATRRTRVDAANLASRNVLKGLAGEPMLSPAY 598
2 -72.500[HE] COG0111 Phosphoglycerate dehydrogenase and related dehydrogenases  ali follow..  18  24.FRSFTMAKVLVSDSIDQ---VGIDILKQVAQVDVKTG--LSEAEIIDIVPEYDAIMLRSATKVTEKIIQAGSQLKIIGRAGVGVDNIDVPAATRQGIVVVNSPEGNTIAAAEHALAMMMALARHIPDANKSVKESKWERKQ---FIGTEVYKKTLGVVGLGKIGSHVAGVAKAMGMKLLAYDPFISQERADQIGCTLVDLDLLFSEADFITLHIPKTPETANLINAETLAKMKPTARIINCSRGGLDVFAQEP-LGESRLREFSNVILTPHLGASTEEAQVNVAVDVAEQIRDVLLGLPARSAVNIPGLTPDVMEKLRPYLK--LAETLGTLVGQLAGGRIDRLTVCQALRERVNYVNAAIAKERGIRVIETKDASVRDYSGLHLKATGTMGEHSATGALLSNGEIRITDVDEFPINVPPNNYMLFTLHIGKIGSLLGSF............................................................................................................................................................. 504
3 -68.700[CHR] COG1052 Lactate dehydrogenase and related dehydrogenases  ali follow..  23  36.......................................................................................................................................................................................................................................................................................................................TAKNKELLKGYEGLVVMQFLAMEDEVYDYGACKLKVLSTRTAGFDMYNATLLKKHGIRLTNVPSYSPNAIGEYALAAALQLTRHAREIETFVRKRDFRWQKP--ILSKELRCSRVGILGTGRIGQAAARLFKGVGAQVVGFDPY----PNDAAKEWLTYVSMDELLSTSDVISLHMPATKDSHHLINAKTIAQMKDGVYLVNTARGAVIDSQALLDSLDKGKIAGAALDAYEFEGDTVYARLVAHERIIYTPHIAFYTETAIENMVFNSLDACTTVLRGEPCAAEI. 329
4 -66.600[E] KOG0068 D-3-phosphoglycerate dehydrogenase, D-isomer-specific 2-hydroxy acid dehydrogenase superfamily  ali follow..  15  77.NPTLPKPRILVTEKLGE---AGVNLLREFGDVDCSYD--LSPEDLKKKVAESDALIVRSGTKVTREVFEAAKRLKVVGRAGVGIDNVDLQAATEHGCLVVNAPTANTVAAAEHGIALLASMARNVAQADASIKAGKWERSK---YVGVSLVGKTLAVMGFGKVGTEVARRAKGLGMTVISHDPYAPADRARALGVDLVSFDQAISTADFVSLHMPLTPATKKVFNDETFSKMKKGVRLINVARGGLDVFCEEPPSKDSRLIQHENVTVTPHLGASTKEAQEGVAIEIAEAVAGALKGELSATAVNAPMVAPEVLSELTPYI-------------VLAEKLGRLAVQLASGGKGVQSIR--------VVYRSARDRDDLDTRLLRAMITKGIIEPISDS------------------------------YVNLVNADFIAKQKGLRISEERMVVDSSPEY-IQVQILNVESNFAGAVSDAGDISIEGKVKYGVPHLTCVGSFGVVSLEGNLIQVDQPGMIGQ--VGNILGEQNVNVNFMSVGRTVLRKQAIMAIGVDEEP...................................... 602
5 -63.300[K] KOG0067 Transcription factor CtBP  ali follow..  16  25IMNGPLHPRPLVALLDGRDCTVEMPILKDLATVAFCDAQS-TQEIHEKVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDIKAAGELGIAVCNIPSAAVEETADSTICHILNLYRRNTWLYQALREGTRVQSREVASGAARIRGETLGLIGFGRTGQAVAVRAKAFGFSVIFYDPYLQDGIERSLGVQRVTLQDLLYQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGALDVHESEPFSAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAITGRIPESLRNC--VNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGV-GGIPVTHNLPTVAHSQAPSPNQPTKHGDNRE........................................................................................................................................................................................................................... 440
6 -19.000[E] KOG2380 Prephenate dehydrogenase (NADP+)  ali follow..  5.........................................................................................................LITKPPLSLSFTSLSSMLPSLSLSTANRHLSVTDTIPLPNSNSNATPPLRIAIIGFGNYGQFLAETLISQGHILFAHSRSDHSSAARRLGVSYFT-DLCERHPDVVLLCTSI-LSIENILKTLPFQRLRRNTLFVDVLS-----VKEFAKTLLLQYLPEDFDILCTHFGPQSVSSNHGWRVSRCESFLEIFVR---CEMVEMSVTDHDKFAAESQFITHTLGRLLGMLKLISTPINTKGYEALLDLAENICGDSFDLYYG--LFVYN----------NNSLEVLERIDLAFEALRKELFSRLHGVVRKQSFEGEAKKVHKIGIVGFGNFGQFLGKTMVKQGHTVLAYSRSDYTDEAAKLGVSYFSDLDDLFEEHPEVIILCTSIL-STEKVLESLPFQRLKRSTLFVDVLSVKEFPRNLFLQTLPQD------FDILCTHPM-NNLAFVFDKVRIGMDDRRKSRCNSFLDIFAREGCRMV............. 528
7 -10.100[H] COG0499 S-adenosylhomocysteine hydrolase  ali follow..  10.........................................................................................................................................................ADLSLAEAGRHQIRLAEY----EMPGLMQLRKEFADEQPLKGARIAGSIHMTVQTAVLIETLTALGAEVRWASCNIFSTQDEAAAAIVEEPAGVPVFAWKGESLEEYWWCINQIFSWGDELPNMILDDGGDATMAVIRGREYEQAGLVPPAEANDSDEYIAFLGMLREVLAAEPGKWGKIAEAVKG-------VTEETTTGVHRLHFAEEGVLPFPAMNVNDAVTKSKFDNKYGTRHSLIDGINR-----------------ATDMLMGGKNVLVCGYGDVGKGCAEAFDGQGARVKVTE-ADPINALQALMDGYSVVTVDEAIEDADIVITATG----NKDIISFEQMLKMKDHALLGNIGHFDNIDMHSLLHRDDVTRTTIKPQVDEFTFSTGRSIIVLS--NLGNATGHPSFVMSNSFADQTIAQIELFQ............ 420
8 -9.990[H] KOG1370 S-adenosylhomocysteine hydrolase  ali follow..  15  37.SKPLNGARIPGCLHRTVETAVLMSLITLGTEVQWSSCNIFSTQDHAAAAIAKAGISASTGIPVLPLPRLACLEGRNRRGVPVTGDLTNLIHSEYSGISKETTIGVHNLYKMMVNGILKVPAI-DVNDSATKSKFDNLYGCGIKQATDVMIAGKVAVVAGYGDKGKSCAQALRGFRASVIITKTDPIKALQAAMGYEVTTMDEACQEGDVFVTTT----GCVDIILGQHFEQTKDDTIVCNTGYFDVEM............................................................................................................................................................................................................................................................................................................................................................. 287
9 -9.800[EH] COG0059 Ketol-acid reductoisomerase  ali follow..  10  35......................................................................................................................................................LKGKKIVIVGCGAQGLNQGLNMRDSGLDISYAEKRASFQRATENGFKVGTYEELIPTADLVVNLTP--DKQHSKVVADVMPLMKKDSAFGYSHRKDITVVMVAPKCPGTEVREE-PTLIAVHPENDPKGEGMAIAKAWAAATESSFVAEVKSDLMGEQTILCGMLQAGSIVCYDKLVADGAYAGKLIQYGWETITEALKQGGITLMMDRLSNSAKLRAFEL------AEQIKESLGFLYYKHMDDIISGSATMMADWANGDKDLFAWREATGKTAFENAPK--IAMVKAGVELAFDAMV----ASGIYEESAYYESLHELPLIANTIARKRLMNVVISDTAEYGNYLFSNVATPILAKEIIPNLQKGDLGEPRDVNDAIRNHPVELIGQELRGYMTDMKRIAVAG........................................... 492
10 -8.620[I] COG2084 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases  ali follow..  13  2.......................................................................................................................................................................................................................................................................................................................................................................................................................................ETIGFIGLGIMGAPMAGHLLDAGYKVIASDHRSKPLADLVAKGLKTVSGHAAVAKAADIIITMVPDTPQVADVLDNGVASGLTRGKLVIDMSSISPIETKVFAGKINELGCDYLDAPVSEEKAFERAKPVFEKMGKNIT-LVGPNGVGQTTKVANQIVVALTIEAVAEALV.... 190

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 5 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.