current user: public

If you have questions about the server, please let us know.

Query: [R] KOG0393 Ras-related small GTPase, Rho type, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .
# Score Template Links and tools%idFirst MQAIKCVVVGDGAVGKTCLLLSYTTNAFPGEYILTVFDTYSTNVMVDGRPINLSLWDTAGQDDYDQFRHLSFPQTDVFLVCFALNNPASFENVRAKWYPEVSHHCPNTPIILVGTKADLREDRDTIERLRESRLQPVSHTQGYVMAKEIKAVKYLECSALTQIGLKQVFDEAIRTGLTPPQTPQTRAKKSNCTVLLast
1 -109.000[R] KOG0393 Ras-related small GTPase, Rho type  ali  100  1MQAIKCVVVGDGAVGKTCLLLSYTTNAFPGEYILTVFDTYSTNVMVDGRPINLSLWDTAGQDDYDQFRHLSFPQTDVFLVCFALNNPASFENVRAKWYPEVSHHCPNTPIILVGTKADLREDRDTIERLRESRLQPVSHTQGYVMAKEIKAVKYLECSALTQIGLKQVFDEAIRTGLTPPQTPQTRAKKSNCTVL 195
2 -52.200[R] KOG0395 Ras-related GTPase  ali follow..  21  18.NSYRMVVLGASRVGKSSIVSRFLNGRFEDQYTPTIEDFHRKVYNIRGDMYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRESFDEV-KRLQKQILEVKAELPMVICGNKNDHGEL-----------CRQVPTTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMSPALHRKIS.... 205
3 -49.400[R] KOG0394 Ras-related GTPase  ali follow..  24  9...LKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIADFLTKEVQFEDRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFENL-NNWREEFLIQAENFPFVLIGNKVDVDDG----------NSRVVSEKKAKAWCASKGNIPYFETSAKVGTNVEEAFQCIAKDALKSGEEEELYLPDT..... 190
4 -49.300[U] KOG0096 GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily  ali follow..  25  13...FKLVLVGDGGTGKTTFVKRHLTGEFEKKYIATIVEVHPLSFYTNFGEIKFDVWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNV-PNWHRDLVRVCENIPIVLCGNKVDVKERKVK--------------AKTITFHRKKN-LQYYDISAKSNYNFEKPFLWLARKLAGNPQLE............ 177
5 -48.300[R] KOG0079 GTP-binding protein H-ray, small G protein superfamily  ali follow..  27  11...FKLLIIGDSGVGKSSLLLRFADNTFSENYITTIVDFKIRTMDINGQRVKLQIWDTAGQERFRTITSTYYRGTHGVVVVYDVTNGESFGNV-KRWLQEIENNCDSVQKVLVGNKCEENE------------RRVVLESDARNYAQSMN-ISFFETSAKEDKNVEPMFTCITSLVLTAKLANPQSASKD..... 184
6 -47.400[R] KOG0088 GTPase Rab21, small G protein superfamily  ali follow..  28  13...FKIVLLGEGCVGKSSLVLRFVENKFSCKHLSTIQASFQNTVNVEDCQADLHIWDTAGQEKYHALGPIYYRGSNGVLLVFDITDRKSFEKV-KNWVLEIKTCLNTAEILIVGNKIDLEEERQ------------VTRQDAEAYAESEGAL-YMETSAQDNVGISDAFESLTAKMIEHSRTRSTEPPSTN.... 188
7 -47.100[T] KOG4252 GTP-binding protein  ali follow..  26  10...IKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRGSFEAV-SSWREKVVAEVGDIPTVLVQNKIDLLDD------------SCIKNEEAEALAKRLR-LRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPEL..... 183
8 -47.000[U] KOG0092 GTPase Rab5/YPT51 and related small G protein superfamily GTPases  ali follow..  25  21...FKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARA-KNWVKELQRQAPNIVIALSGNKADLANKRA------------VDFQEAQSYADDNSLL-FMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGV. 199
9 -46.800[TU] KOG0084 GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins  ali follow..  28  9...FKLLLIGDSGVGKSCLLLRFADDSYLDSYISTIVDFKIRTVEQDGKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVTYDVTDLESFNNV-KQWLNEIDRYAENVNKLLVGNKCDLTS------------QKVVSTETAKAFADELG-IPFLETSAKNATNVEEAFMAMTAAIKTRMASQPAGGSKP..... 183
10 -46.500[TU] KOG0078 GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins  ali follow..  30  10...IKLLLIGDSGVGKSCLLLRFSEDSFTPSFITTIIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGILLLYDVTDKKSFDNV-RTWFSNVEQHAENVYKILIGNKCDCED------------QRQVSFEQGQALADELG-VKFLEASAKTNVNVDEAFFTLAREIKKQKIDAENEFSNQANNV. 188
11 -46.400[U] KOG0094 GTPase Rab6/YPT6/Ryh1, small G protein superfamily  ali follow..  28  10...YKLVFLGDQSVGKTSIITRFMYDKFDTTYQATIIDFLSKTMYLEDRTVRLQLWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRLSFLNT-SKWIEEVRNERGDVIIVLVGNKTDLVE------------KRQVSIEEGDSKGREYGVM-FIETSAKAGFNIKPLFRKIAAALPGMESYSNTKNEDM..... 184
12 -46.300[R] KOG0080 GTPase Rab18, small G protein superfamily  ali follow..  24  9...LKILIIGESGVGKSSLLLRFTDDTFDPELAATIVDFKVKTISVDGNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKL-DNWLNELETYCTDIVNMLVGNKIDKEN-------------REVDRNEGLKFARKHS-MLFIEASAKTCDGVQCAFEELVEKIIQTPGLWESENQNKGVKL. 187
13 -46.200[U] KOG0095 GTPase Rab30, small G protein superfamily  ali follow..  24  10...FKIVLIGNAGVGKTCLVRRFTQGLFPPGQGATIVGFMIKTVEINGEKVKLQIWDTAGQERFRSITQSYYRSANALILTYDITCEESFRCL-PEWLREIEQYANKVITVLVGNKIDLAE------------RREVSQQRAEEFSEAQD-MYYLETSAKESDNVEKLFLDLACRLISEARQNTLVNNVS..... 184
14 -45.500[U] KOG0093 GTPase Rab3, small G protein superfamily  ali follow..  25  23...FKILIIGNSSVGKTSFLFRYADDSFTPAFVSTVIDFKVKTIYRNDKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAV-QDWSTQIKTYSDNAQVLLVGNKCDMED------------ERVVSSERGRQLADHLG-FEFFEASAKDNINVKQTFERLVDVICEKMSESLDTADPA..... 197
15 -45.300[U] KOG0086 GTPase Rab4, small G protein superfamily  ali follow..  26  9...FKFLVIGSAGTGKSCLLHQFIENKFKQDSNHTIVEFGSRVVNVGGKTVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNSL-AAWLTDARTLAPNIVVILCGNKKDLDPERE------------VTFLEASRFAQENE-LMFLETSALTGENVEEAFLKCARTILNKIDSGELDPERM..... 183
16 -45.200[U] KOG0097 GTPase Rab14, small G protein superfamily  ali follow..  26  12...FKYIIIGDMGVGKSCLLHQFTEKKFMADCPHTIVEFGTRIIEVSGQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHL-SSWLTDARNLTPNTVIILIGNKADLEA------------QRDVTYEEAKQFAEENG-LLFLEASAKTGENVEDAFLEAAKKIYQNIQDGSLDLNAA..... 186
17 -45.200[R] KOG0091 GTPase Rab39, small G protein superfamily  ali follow..  25  10...FRLILIGDSTVGKSSLLKFFTDGKFAELSDPTVGVDFFARLI-DGTQIKLQLWDTAGQERFRSITKSYYRNSVGVLLVYDISNHASFEHI-PLWMMEAQRHIERPVFALVGCKLDLINAGG---------HREVTTEEAQKFAKQHG-LHFVETSARSGANVEEAFRMVTQEVYARIRSGEYKAEDG..... 189
18 -44.900[U] KOG0087 GTPase Rab11/YPT3, small G protein superfamily  ali follow..  28  11...FKTVLIGDSGVGKSNLLMRFTRNEFNIESKSTIVEFATRNIVLDNKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDITKQSSFDNV-GRWLKELREHASNIVIMLVGNKTDLLH------------LRAVSTEEAQAFAAENN-LSFIETSAMDASNVEEAFQTVLTEIFRIVSNRSLEAGDD..... 185
19 -44.900[R] KOG1673 Ras GTPases  ali follow..  21  101..SLKISLLGDCQTGKTTFVVKYVGDENQSFLEMTGLNLMDKTFYVQGVTISFSIWDVGGDEKSKDHIPIACKDAVAILFMFDLTSRSTLNSV-FGWYSQARKWNKTAIPILIGTKFDDFVR-------LPPNLQWTIVTQARAYAKVMNA-SLFFSSATHNINVNKIFKFILARLFNLPWKIDRNLTLGEPII. 284
20 -44.900[U] KOG0081 GTPase Rab27, small G protein superfamily  ali follow..  28  10...IKFLALGDSGVGKTSVLYQYTDGKFNSKFITTVIDFREKRVVYRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNV-RNWISQLQMHAENPDIVLCGNKSDLED------------QRVVKEEEAIALAEKYG-IPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIP..... 195
21 -44.800[U] KOG0098 GTPase Rab2, small G protein superfamily  ali follow..  26  7...FKYIIIGDTGVGKSCLLLQFTDKRFQPVHDLTIVEFGARMVTIDGKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHL-TSWLEDARQHSSNMVIMLIGNKSDLEARRE------------VKREEGEAFAREHG-LVFMETSAKTAANVEEAFIDTAKEIYRKIQEGVFDINNE..... 181
22 -44.600[V] KOG1707 Predicted Ras related/Rac-GTP binding protein  ali follow..  18  13.KPIRIVVVGEKGSGKSSLIMAAARNTFH-PNIPSLLPYTNLPSEFFPDRIPATVIDTSSRPEDKGKVVKEVRQADAIVLTFAFDRPETLDRLSKYWLPLFRQLEVRVPIIVAGYEVDNKEAYN---------HFSIEQITSALMKQYREVETSIQWSAQRLDQAKDVLYYAQKAVIDPVGPVFDQENNV..... 191
23 -39.400[R] KOG0083 GTPase Rab26/Rab37, small G protein superfamily  ali follow..  25  469...GKVIMLGDSGVGKTSLLIRFRDGRYPSYFLSTVIDFRNKVVVVDGTRVKLQIWDTAGQERFRSVTHAYYRDAHALLLLYDVTNKTTYDNIR-AWLGEIREYAEDVVIVLIGNKADCSGS-----------ERQVKREDGERLGREHNVP-FMETSAKTGLNVELSFTAVARQLKSRGYERDNTKARSVCA.. 661
24 -33.700[R] COG2229 Predicted GTPase  ali follow..  15  1MRENKIIFTGPVGVGKTTAIAAISDEALVQTDASAS-RKRNTTVAMDDEDTKVHLYGTPGQERFNFMWEILSQGSMGLVLLLDNARTNPLKDL-EFFLHSFRGLLEKAPVVVGITKMDIRSQPGI-------------DVYHKYLAKHNLNVPVFEIDARKEDDVKQLVSAMLFSI................... 172
25 -25.000[R] KOG0075 GTP-binding ADP-ribosylation factor-like protein  ali follow..  14  19.EEMELTLVGLQFSGKTTFVNVIASGQFAEDMIPTVGFNMR---KITRGNVTIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLLDKQLAGIPVLVLGNKRDLPGALDETGLIERMNLSSIQDRE----------ICCYSISCKEKDNIDITLQWLIQHSKSQSR.............. 186
26 -24.000[T] KOG3886 GTP-binding protein  ali follow..  14  42....KVLLMGKSGSGKTSMRSIIFANYIARDLGATI--DVEHSHVRFLGNLVLNLWDCGGQDTFTSQRDNIFRNVEVLIYVFDVESRELEKDMHQSCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLEC--------SCFRTSIWDETLYKAWSSIVYQLIPNVQQLEM.......... 250
27 -23.800[U] KOG0077 Vesicle coat complex COPII, GTPase subunit SAR1  ali follow..  16  19.KEAKILFLGLDNAGKTTLLHMLKDERL-VQHQPTQHPTSE---ELSIGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAYDKERFAESKRELDALLSDALATVPFLILGNKIDIPYAASEDELRYHLGLTNFTTGKGKVTLGDSGVRPLFMCSIVRKMGYGEGFK......................... 186
28 -22.600[R] KOG0074 GTP-binding ADP-ribosylation factor-like protein ARL3  ali follow..  18  16.QEVRILLLGLDNAGKTTLLKQLASEDI-SHITPTQGFNIK---SVQSQGFKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEKLSCVPVLIFANKQDLLTAAPASEIAEGLNLHTIRDRV-----------QIQSCSALTGEGVQDGMNWVCKNVNAKKK.............. 182
29 -22.000[U] KOG0072 GTP-binding ADP-ribosylation factor-like protein ARL1  ali follow..  15  16.REMRILILGLDGAGKTTILYRLQVGEV-VTTIPTIGFNVE---QVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAIIYVVDSADRDRIGISKDELLYMLREELAGAILVVLANKQDMDGCMTVAEVHHALGLENLKNRT-----------QIFKTSATKGEGLDQAMDWLSNTLQSRK............... 181
30 -21.800[U] KOG0071 GTP-binding ADP-ribosylation factor Arf6 (dArf3)  ali follow..  19  20.KEMRILMLGLDAAGKTTILYKLKLNQSVVT-IPTVGFNVE---TVTYKNIKFNVWDVGGQDKIRPLWRHYFTGTKGLIFVVDSADSNRISEARQELHRIISDEMRDCLLLVLANKQDLPGALSPAQITDVLQLDKLKDRL-----------NVQPTCALTGDGLLEGLA......................... 175
31 -21.700[U] KOG0070 GTP-binding ADP-ribosylation factor Arf1  ali follow..  17  16.KEMRILMVGLDAAGKTTILYKLKLGEIVTT-IPTIGFNVE---TVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMLNEELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRQRH-----------YIQSTCATSGEGLYEGLDWLSNNIASKA............... 181
32 -21.600[R] COG1100 GTPase SAR1 and related small G proteins  ali follow..  13  17.KELRILILGLDGAGKTTILYRLQIGEV-VTTKPTIGFNVE---TLSYKNLKLNVWDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMLQEELQDAALLVFANKQDQPGALSASEVSKELNLVELKDRS-----------SIVASSAIKGEGITEGLDWLIDVIKEEQ............... 182
33 -21.600[UZ] KOG0073 GTP-binding ADP-ribosylation factor-like protein ARL2  ali follow..  15  15.RELRLLMLGLDNAGKTTILKKFNGEDI-DTISPTLGFNIK---TLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVERLAGATLLIFANKQDLPGALSSNAIREALELDSIRSHH-----------CIQGCSAVTGENLLPGIDWLLDDI................... 176
34 -21.200[S] KOG4273 Uncharacterized conserved protein  ali follow..  14  6....GVLVVGSSGVGKRTLLSRLLSVEFEDSSESSSTEVHGWTINTKYYTADVSVCISHICDEYSLPNLPNSHPLVALVMVFDLSELSTLVALQ-DWVSHTDINSFDI-LLCIGNKVDRVPHHLAHDEYRRRLLK--ASDPSRDLYSDIDDFGISETEGSSLLGSEDASLDIRGACLE................. 176
35 -21.100[U] KOG0076 GTP-binding ADP-ribosylation factor-like protein yARL3  ali follow..  14  16.EQYSILILGLDNAGKTTFLETLKKEYSLAKIQPTV--GQNVATIPVDSKQILKFWDVGGQESLRSMWSEYYSLCHGIIFIVDSSDRERLDECSTTLQSVVMDEIEGVPILMLANKQDRQDRMEVQDIKEVFNKIAEHISA--------RDSRVLPISALTGEGVKDAIEWMIVRLERNKKSRPPIYK....... 198
36 -19.200[R] COG3596 Predicted GTPase  ali follow..  13  37.YEPVIGIMGKTGAGKSSLCNALFAGSPVSDVAACTRDPLRFRLQIGE--HFMTIVDLPGDTEYAALYREQLPRLDLIL--WLIKADDRALATDEHFYRQVIGEAYRHKMLFVISQSDKAEPTSGGNILSTEQKQNISRKICLLHELFQPVHPVCAVSVRLQWGLRVMAERMIKCL................... 216
37 -17.000[U] KOG0090 Signal recognition particle receptor, beta subunit (small G protein superfamily)  ali follow..  19  54.KSNTVLLSGLSGSGKTVLFYQLRDGSSHQGAVTSMEPNEGTNNTKKGKVKPVHLIDVPGHSRLISKLEEYLPRAAAVV--FVVDALEFLPNIRAA-LTNASVIKNKTPVLLCCNKTDKVTAHTKIDKLRVSRSAISTADIANSFSHCHNKVTVAEASGLTGE................................ 246
38 -16.700[E] COG4917 Ethanolamine utilization protein  ali follow..  15  3....RIAFVGSVGAGKTTLFNALQGNYTLARKTQAV------------EFNDKGDIDTPGHPRWYHALITTLQDVDMLIYVHGANDPES------RLPAGLLDIGVSKRQIAVISKTDMPDADVAATR--------------KLLLETGFEEPMFELNSHDPQSVQQLVDYLASLTKQEEAGEKTHHSE...... 159
39 -16.400[R] COG1084 Predicted GTPase  ali follow..  16  164....TVVIAGFPNVGKSTLLRTLTGAE--ADYPFTTKGIQIGHLERKWKRIQVI--DTPGNIELQAMVALEN-IADVIMFIFDASETCGYTLESQYSLYLGIRSVFDIPVVTVFNKMDLAENVKYLEEYINMVEDPLK------------------VSAFEGRGVSKIIKKLEGLYEKETREAHDN......... 335
40 -15.800[U] KOG3887 Predicted small GTPase involved in nuclear protein import  ali follow..  14  61.VKPRILLMGLRRSGKSSIQKVVFHKMSPNETLSTN--KICREDVSNSSFVNFQIWDFPGQIDFFDPTEMIFRGTGALIFVIDSQDDYMEALARHLTVTRAYKVNTDINFEVFIHKVDGLSDDHKIETQRDIHQR-ANDDLADAGLEKIHLSFYL--TSIYDHSIFEAFSKVVQKLIPQLPTLEN.......... 246
41 -15.600[R] KOG1490 GTP-binding protein CRFG/NOG1 (ODN superfamily)  ali follow..  17  171.....VLICGYPNVGKSSFMNKVTRAD--QPYAFTTKSLFVGHTDYKYLRYQVI--DTPGFEDRNIIEMCSIRAAVLFFLDISGSCGYTIAQQAAL-FHSIKSLFMNKPLVIVCNKTDLMPMENISEEDRKLIEE-MKSEAMKTAMGASEEQVLLKMSTLTDEGVMSVKNAACERLLDQRVEAKMKSKK...... 362
42 -13.100[J] KOG1145 Mitochondrial translation initiation factor 2 (IF-2; GTPase)  ali follow..  16  183.....VTIMGHVDHGKTTLLDKFRKTQVAAVETGGITQHIGAFLVSLPSGEKITFLDTPGHAAFSAMRARGAQVTDIVVLVVAAD-----DGVMKQTVESIQHKDAQVPIILAVNKCDKAEADPEKVKKELLAYDVVCEDYG-------GDVQAVPVSALTGDNLMALAEATVALAEMLELKADPNGPVEGTVI. 360
43 -12.100[R] KOG2486 Predicted GTPase  ali follow..  15  137....EFALVGRSNVGKSSLLNSLVRRKRLALTSKKPGKTQCINHFRINDKWYL---DLPGKQDWNKFKDYFLNRSTLVSVFLLVDASIPVKPIDLEYASWLGQN--QVPMTLIFTKCDKRKKKKNGGKKPEANIKEFQDL-----GFFETTPPWIMTSSVTNQGRDEILLHMAQLR................... 312
44 -11.300[R] COG1160 Predicted GTPases  ali follow..  15  1MATPVVALVGRPNVGKSTLFLTRTRDALVADFPGLTRDRKYGHAHIAGYDFIV---DTGGEEKMAEQSLLAIDEADIVL--FLVDARAGLTAADIGIANYLRQRQ-NKITVVVANKTDGIDADSHCAEFY-----------------QLGLGEIEQIAASQGRGVTQLMEQVLAPFAEKMENADENDRTS..... 178
45 -10.700[J] COG0532 Translation initiation factor 2 (IF-2; GTPase)  ali follow..  14  448.....VTIMGHVDHGKTTLLDRFRESRVTEGEAGGITQHIGA-YQIKANGKKITFLDTPGHEAFTSMRARGASVTDITILVVAAD-----DGVMPQTIEAINH-AAGVPIIVAINKIDKPGANPQRVTQELTEHGVFPVAWDPE-----NGSEFVEISAKFNQNLDELLDTVLLVAEVQELKADPTVRAIGTVV. 626
46 -10.500[R] COG0486 Predicted GTPase  ali follow..  18  226.EGMKVVIAGRPNAGKSSLLNALAGRAIVTDIAGTTRDVLREHIHIDG--MPLHIIDTAGREATDEVERIEIEQADRILLMLDSTEADN-QDLEKVRSEFLTKLPSNIPVTIVRNKADLSGENEGIVEQNGYTVITLSAKTQEHLKQSMGYQTNMEGGFLARRRHLEALEQAATHL................... 414
47 -10.400[R] KOG1489 Predicted GTP-binding protein (ODN superfamily)  ali follow..  15  335..ELKSILIGLPNAGKSTILNKISNAK--GHWQFTTLSPTIGTVSLGFGQDVFTVADIPGIIQLEFLRHIERSNGWVFVLDLSNKNPNDLQLLIE----EVGTLEKTKNILIVCNKVDIDAEKSESFAKYLQVEK----------FSKSQEWDCVPISALREKT............................... 499
48 -10.400[O] KOG0448 Mitofusin 1 GTPase, involved in mitochondrila biogenesis  ali follow..  14  74.RHMKVAFFGRTSSGKSSVINAMLWDKLPSGIGHIT-DGDKAYLMTEGSDEKLVLVDSPGTDVTTELDSWIDLDADVFV--LVANSESTLMNTEKHFFHKVNEWLSKPNIFILNNRWDAASEPEYMEDVRRQHMERCLHFLVEELKV-----------ANALEAQNRIFFVSAKEVLSARKQKAQGMPES..... 302
49 -10.400[J] KOG1191 Mitochondrial GTPase  ali follow..  21  352.SGLQIAIVGRPNVGKSSLLNAWSKSAIVTEVAGTTRDVVEANVTVRG--VPITLLDTAGRETNDIVEKIAAKVADVIIMAVSAVEGWTEEDTESFYDLFGGLLYLKQPMILVMNKIDCAPPGS-------------CDQLEDQRKKEEVFHKSVFTSAVTGQGIEELEDAILEIL................... 533
50 -9.600[R] COG1159 GTPase  ali follow..  13  11.....IAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRHRIVGIHTEGPYQAIYVDTPGNRLMNKAASSSIGDVELVIFVVEGTRWTPDDEMVLNKLRDG-----KAPVILAVNKVDNVQEKVDLLPHLQ------------FLASQMNFLDIVPISAETGMNVDTIAGIVRK..................... 171
51 -9.270[DZ] COG5019 Septin family protein  ali follow..  14  95..NFNVLVLGESGSGKSTLVNTLLNRDVYPP--TVMINSSAVEIVENGISLQLNVIDTPGEGRYDHNPRSTIQDPRVHACIFFIQTGHAISAMELRVMLALHEKVNIIPII--------KADTLTDDELNFTKEMILRDIQYHNI.................................................. 269
52 -9.250[P] COG0370 Fe2+ transport system protein B  ali follow..  16  1MSQNTYCILGNPNTGKTSLFNALTSYEYVGNWSGVTVEKKVGTL----RSKTGKLIDLPGRDETVVTRFLLEEKFDCMLNIVDSS------QIERNLNLTVQLLEYGAPVVMGLNMIDVAAGRGIHLNIQN-------------LAKKLR-IPILPVVARSGKGTEDILSTLSEKH................... 161
53 -9.230[R] COG0218 Predicted GTPase  ali follow..  10  27....EIALAGRSNVGKSSFINTMLNRK-----------NLARTSGKPGKTQLLNFFNIDDKMRFVDVPGYGYARVSVVSLVDLRHDPSADDVQMYEFLKYY-----EIPVIIVATKADKIPRGKWNKHESAIKKK----------LNFDPSDDFILFSSVSKAGMDEAWDAILEKL................... 195

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 5 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Jaroszewski L, Bierzynski A, Godzik A. Multiple model approach--dealing with alignment ambiguities in protein modeling. Pac Symp Biocomput. 1997;:328-39.