current user: public

If you have questions about the server, please let us know.

Query: [J] KOG0460 Mitochondrial translation elongation factor Tu, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .
# Score Template Links and tools%idFirst MNSAKATSLLFQGFRKNCLRLNRISFASGLINRFTVPARTYADEKVFVRKKPHVNIGTIGHVDHGKTTLTAAITKCLSDLGQASFMDYSQIDKAPEEKARGITISSAHVEYETANRHYAHVDCPGHADYIKNMITGAATMDGAIIVVSATDGQMPQTREHLLLARQVGVKQIVVYINKVDMVEPDMIELVEMEMRELLSEYGFDGDNTPIVSGSALCALEGREPEIGLNSITKLMEAVDSYITLPERKTDVPFLMAIEDVFSISGRGTVVTGRVERGTLKKGAEIEIVGYGSHLKTTVTGIEMFKKQLDAAVAGDNCGLLLRSIKREQLKRGMIVAQPGTVAPHQKFKASFYILTKEEGGRRTGFVDKYRPQLYSRTSDVTVELTHPDPNDSDKMVMPGDNVEMICTLIHPIVIEKGQRFTVREGGSTVGTALVTELLDLast
1 -123.000[J] KOG0460 Mitochondrial translation elongation factor Tu  ali  100  1MNSAKATSLLFQGFRKNCLRLNRISFASGLINRFTVPARTYADEKVFVRKKPHVNIGTIGHVDHGKTTLTAAITKCLSDLGQASFMDYSQIDKAPEEKARGITISSAHVEYETANRHYAHVDCPGHADYIKNMITGAATMDGAIIVVSATDGQMPQTREHLLLARQVGVKQIVVYINKVDMVEPDMIELVEMEMRELLSEYGFDGDNTPIVSGSALCALEGREPEIGLNSITKLMEAVDSYITLPERKTDVPFLMAIEDVFSISGRGTVVTGRVERGTLKKGAEIEIVGYGSHLKTTVTGIEMFKKQLDAAVAGDNCGLLLRSIKREQLKRGMIVAQPGTVAPHQKFKASFYILTKEEGGRRTGFVDKYRPQLYSRTSDVTVELTHPDPNDSDKMVMPGDNVEMICTLIHPIVIEKGQRFTVREGGSTVGTALVTELLD 439
2 -111.000[J] COG0050 GTPases - translation elongation factors  ali follow..  61  1.........................................MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKTYGGSARAFDQIDNAPEEKARGITINTSHVEYDTPARHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGPMPQTREHILLGRQVGVPYIIVFMNKCDMVDEELLELVEMEVRELLSAYDFPGDDLPVVRGSALKALEGEAEWE--AKIIELAGYLDSYIPEPERAIDKPFLLPIEDVFSISGRGTVVTGRVERGIVKVGEEVEIVGIKDTVKSTCTGVEMFRKLLDEGRAGENVGVLLRGIKREDIERGQVLAKPGSIKPHTTFESEVYILSKDEGGRHTPFFKGYRPQFYFRTTDVTGTIELP---EGVEMVMPGDNINMIVTLIHPIAMDDGLRFAIREGGRTVGAGVVAKVI. 393
3 -87.000[J] KOG0466 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  18  2.............AGGEAGVTLGQPHLSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNANAKIYQLDDPSCPRPECYRSCGSSMPDEFPVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCQPQTSEHLAAIEIMKLKHILILQNKIDLVKERQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIE------------VVCEYIVKKIPVPPRDFTSEPRLIVIRSFDVNKKGGVAGGSILKGVLKVGQETEVRPGIKSIFSKIVSLFAEHNDLQYAAPGGLIGVGTKTLCRADRMVGQILGAVGALEIFTELEISYFLLRRLLGVRTQKLSKNEVLMVNIGSLSTGGR------------VSAVKADLGKIVLTNPVCTEVGEKIALSKHWRLIGWGQIRRGVT 464
4 -83.900[J] COG5256 Translation elongation factor EF-1alpha (GTPase)  ali follow..  33  2............................................KIMASQKPHLNLITIGHVDHGKSTLVGRLLYEHGQKGKATFEFAWVMDRFKEERERGVTIDLAHRKFETDKYYFTLIDAPGHRDFVKNMITGTSQADAAILVISAREGEGEQTREHAFLARTLGVPQMVVAINKMDATSEKRYNEVKADAEKLLRSIGFKDISFVPISGYKGDNVTKPSPNMPWYKGPTLLQALDAF-KVPEKPINKPLRIPVEDVYSITGIGTVPVGRVETGVLKPGDKVIFLPADK--QGDVKSIEMHHEPLQQAEPGDNIGFNVRGIAKNDIKRGDVCGHLDPPTVVKAFTAQIIVLNH-----PSVIAPGYKPVFHVHTAQVACRIDEIVKKEKPDFIKNGDVAIVKVIPDKPLVIEKVGRFAVRDMGQTVAAGQCIDLEK 426
5 -81.800[J] COG5257 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  25  2................................................KNQSEINIGLVGHVDHGKTTLTKALSGV-------------WTDTHSEETKRGISIRLGYADITFRKRKVSFVDAPGHETLMATMLSGAALMDGAILVIAANEPCQPQTKEHLMALDVIGVKDVIVVQNKIDIVSKERALESYREIKEFVKGTCAEDAPIIPVSAQQGANID------------ILIETIEERIKTPKRDVDKPARMYVARSFDINKAGGVIGGSLVQGRLRVGDEIEIRPGIMSLHSTITGLVAGGEEMEEVGPGGLVGVGTLALTKADSLSGSVAGEPGTLPPVHSFTMETHLLERVVGTKEEPIKTGEPLMINVGTTTTVGVVK------------SARADDADVVLKLPACAEEGQRIALSARWRLIGYGII..... 407
6 -80.800[J] KOG0052 Translation elongation factor EF-1 alpha/Tu  ali follow..  32  1..............................................MGKEKVHINIVVIGHVDSGKSTTTGHLIYKCGEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETAKYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGEFEQTREHALLAQTLGVKQLIVACNKMDSTEEARFTEITNEVSGFIKKIGYNPKAVPFVPISGFNGDNMLEVSEGNASGKTLLEALDSI-IPPQRPTDRPLRLPLQDVYKIGGIGTVPVGRVETGIIKPGMVVTFAPQNV--TTEVKSVEMHHESLPEAVPGDNVGFNVKNVSVKDIRRGSVCSDSKPAKEARTFHAQVIIMNH-----PGQISNGYTPVLDCHTAHIACKFNELKEEDFPKFLKSGDAGIVELIPTKPLCVESFGRFAVRDMRQTVAVGVIKSVEK 443
7 -76.100[J] COG3276 Selenocysteine-specific translation elongation factor  ali follow..  27  1.....................................................MIIVTSGHVDHGKTALLKALTGT-------------STAHLPEEKKRGMTIDLGYAYLPLENKVLGFIDVPGHEKFLSNMLAGLGGVHYAMLIVAADEGVAVQTKEHLAILRQLQFHEIIVVITKADRTNSAQIESLIQTIKQDYS--FLRNANYFVTSAETGQGISELRHYLANL--------------AELADTQKPFRYAIDRVFSVKGAGTVVTGTAFSGTVKVNDEIYLST---GQKIRIKAIHAQNTSSEQGIAGQRLALNLNALDRTPMKRGDWLLQNEPLPPTDRISVQILAEV--------PLNESQPVHIYHGASRTTGKLTLLQGKN----AAKNDRTLAEIILDSPLFLAFGDKLILRSGDTLIAGARVLEI.. 343
8 -74.400[P] COG2895 GTPases - Sulfate adenylate transferase subunit 1  ali follow..  18  2...........................NTALAQQIANEGGVEAWMIAQQHKSLLRFLTCGSVDDGKSTLIGRLLHDTRQIQGEKLDLALLVDGLQAEREQGITIDVAYRYFSTEKRKFIIADTPGHEQYTRNMATGASTCELAILLIDARKGVLDQTRRHSFISTLLGIKHLVVAINKMDLVDEETFTRIREDYLTFAGQLPGN-LDIRFVPLSALEGDNVASESMPWYSGPTLLEVLETV-EIQRVVDAQPMRFPVQYVNRPNLDFRGYAGTLASGRVEVGQRVKVLPSGV--ESNVARIVTFDGDREEAFAGEAITLVL--TDEIDISRGDLLLAADALPAVQSASVDVVWMA------EQPLSPGQSYDIKIAGKKTRARVDGIRTQREVENLPLNGIGLVDLTFDEPLVLDRYGGLIFIDSNVTVGAGMVHEPVS 439
9 -74.000[R] COG5258 GTPase  ali follow..  18  55LPDEELVKALETLREMARRVGASLYILRVSEGIRGKVAEVLLRAVSREEPPPTVTVVALGNVDAGKSTLVGVLTTGRLDDGKGLARSY--ASRYKHEVLTGRTSAVSLRLLKRSDKLVLLVDVGGHERYLRTALRGLFSPDYVMLVVAANSGVQKMTKEHLGIAVAIGIP-VFVVVTRIDITPSEVFQKTVEEVVRILKMPGVSKIPYVVLAAKAMPAGRVAPSSVTGHGLDLLLRFLSLLPRRRRWDYGGEFLMYISDIYLVKGVGVVIGGLVEKGILHVGDRVWLGPYGKWMQTVVKSIHFNRTPVESAKAGSFITVALDKVEKV---EKGMVLSARPLKAVREVTADVLVLRHP-----TVIRAGFSGVFHYKAVRTGGYIKEID----KGELMVGDSGVVKIELSRPWHIDSG-VFVFRN-GPTRILGRIIGTD. 512
10 -73.200[J] KOG0458 Elongation factor 1 alpha  ali follow..  21  115LPDWLDEEESEGERNGEEANDEKTVQRYYKTTVPTKPKKPHDISAFVKSALPHLSFVVLGHVDAGKSTLMGRLLYDLNTMGKSSFKFAWIMDQTNEERERGVTVSICTSHFSTHRANFTIVDAPGHRDFVPNAIMGISQADMAILCVDCSTNAFEQTKEHMLLASSLGIHNLIIAMNKMDNVDQQRFEEIKSKLLPYLVDIGFFEDNINWVPISGFSGEGVYKIERQWYNGPNLMSTLENAAENEGINKDDPFLFSVLEIIPTSNDLALVSGKLESGSIQPGESLTIYPSEQ--SCIVDKIQTNHEETDVAIKGDFVTLKLRKAYPEDIQNGDLAASVDSIHSAQCFVLELTTFD-----MNRPLLPGTPFILFIGVKEQPARIKRLASKKKIRHLGSKQRAFVEIELKRWIPLLTAGRVVLRKDGRTIAAGKISEITQ 611
11 -70.900[J] KOG0459 Polypeptide release factor 3  ali follow..  26  50.IPVPDEQEASEDHDEVMLHPVHNPAKAKEKAAQEKAAKEEAEDVAEANKKRHLNVVFIGHVDAGKSTIGGQILFLSGDKSRESWYMAYIMDTNEEERLKGKTVEVGRAHFETESTRFTILDAPGHKSYVPNMISGASQADIGVLVISARKGEFEQTREHVQLAKTLGVSKLIVVVNKMDDPSKERYDEIEQKMVPFLKASGYNTKDVVFLPISGLMGKNMDQRMCPWWSGPSFFEVLDSI-EIPPRDPNGPFRMPIIDKFK--DMGTVVMGKVESGSIREGDSLVVMPNKE--QVKVVAIYCDEDKVKRAGPGENLRVRITGIEDEDILSGFVLSSIVPVPAVTEFVAQLQILELLD---NAIFTAGYKAILHIHAVVEECEIIELKSKKKVLFVKNGAAVVCRIQVTNSICIEKFGRFTLRTEGKTIAVGKVTELLS 527
12 -37.900[T] COG1217 Predicted membrane GTPase involved in stress response  ali follow..  26  7......................................................NIAIIAHVDHGKTTLVDKLLKLSGTLDRKEAESERVMDSNDQEKERGITILAKNTAIKWNGYNINIVDTPGHADFGGEVERVMSMVDSVLLVVDAQDGPMPQTRFVTQKAFKAGLR-PIVVVNKIDRPGAR-PDWVIDQIFDLFDNLGATDEQLPIVYASALNGIAGLDHEKMDDNMDALFQAIIDHVPAPVVDTEGPFQMQISQLDYNSFLGVIGIGRITRGKVKSNTPVVAISDDGSKRNGMGHHGLQRVEVAEAEAGDIVCV----SGMEELFISDTLCDPQNVEALPPLTVDQPTVS.................................................................................... 308
13 -37.300[M] COG0481 Membrane GTPase LepA  ali follow..  23  6......................................................NFSIIAHIDHGKSTLSDRLIQTCGGLSDRE-MEAQVLDSMDLERERGITITLNYKAKDGETYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAGQGVEAQTLANCYTAIEMNLE-VVPILNKIDLPAAD-PERVAEEIEDIV---GIDAMEAVRCSAKTGVGIE------------DVLEEIVHKIPAPEGDPNAPLQALIIDSWFDNYLGVVSLVRIKNGTLRKGDKIKVMSTGQSYNVRLGIFTPKQVDTTILNCGEVGWVVCAIKDILGAPVGDTLTSHN.................................................................................................... 278
14 -35.200[J] KOG0462 Elongation factor-type GTP-binding protein  ali follow..  25  44......................................................NFGIVAHVDHGKSTLADRLLEMCGAVPPGQKQM---LDKLQVERERGITVKAQTAALRHRGYLLNLIDTPGHVDFSAEVSRSLAVCDGILLLVAANQGVQAQTIANFWLAFEKNIQ-IIPVINKIDLPGAD-IKSVETQLKNLF---EFNPEECLHISAKSGLNVD------------KVLEAIIDRVPAPTAIIDAPFRSMIFDSYFDHFRGAIAHIMVKEGSVKKGDKIQSYQNEKVYDVSEVGVMVKCTELRAGQVGYLVCN-MRTVN--EAVVGETLFAET.................................................................................................... 309
15 -30.300[J] COG4108 Peptide chain release factor RF-3  ali follow..  21  1......................................MLMSTTPYFGEVSKRRTFAIISHPDAGKTTITEKVIQVAGTVKGRGSNQHAKSDWMEMEKERGISVTTSVMQFPYGDCLVNLLDTPGHEDFSEDTYRTLTAVDSCLMVIDAAKGVEDRTRKLMEVTRLRDTPI-VTFMNKLDREIRDPMELMDEASHEFDRELFLQGELTPVFFGTALGNF----------GVDHMLDGLTQWAPSPSEEKFTGFVFKIQANMDPKHRDRIAFVRIVSGTYKQGMKMNHVRLGKQVNISVTFMAGDRARAEEAFAGDIIGL----HNHGTIQIGDTFTQGETLK................................................................................................. 388
16 -29.900[J] KOG0469 Elongation factor 2  ali follow..  19  10...........................................RALMDRKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGSKAGETRFTDTRKDEQERCITIKSTAISLKYNGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKP-VLFMNKMDRALLE-LQLGAEELFQTFQRI-VDPSIGNVGFGSGLHGWAFTLKQFAEMAGDTMLQMIAFHLPSPVTPNGPLMMYISKMVPTSDKGRFYAFGRVFSGKVATGMKARIQGPNDLYEKTIQRTILFIEPIEDIPSGNIAG--LVGVDQYLVKGGTITTEAKNPADLPKLVEGLKRLAKSDPMVQCIFEESGEHII-AGAGELHLEICLKDLEE--------DHACIPLKKSDPVV.......................... 571
17 -29.300[J] KOG0468 U5 snRNP-specific protein  ali follow..  18  133......................................................NVALVGHLHHGKTTFVDCLIRQTHPQFEMEERQLRYTDTLFTEQERGCSIKATPVTLKQKSYLLNIFDTPGHVNFSDEATAAMRMSDGVVLFIDAAEGVMLNTERLLKHAVQERQAI-TVCINKIDRLILEKLKHIVEEVNGLLSTYGAPDDNLLVSPILGNVCFASSLYGFCFTDCSGFVDMCVEHIKSPLENQYGTLMVHSSKMYPNDDCFFQVLARIVSGTLHAGQEVRVLGENDSRILQVGRLWVYKVELNRVPAGNWVL--IEGIDQCIVKTSKIAVEPVNPSELPKMLDGLRKVNKSYPLLSTRVEESGEHVI-LGTGELYLDCVMHDLRK--------MYSEIDIKVADPVV.......................... 663
18 -25.900[J] COG0480 Translation elongation factors (GTPases)  ali follow..  19  12......................................................NIGIAAHIDAGKTTTTERILFYSGIIHKIGEVHTAVTDWMDQERERGITITAAAISTSWKDYQINIIDTPGHVDFTIEVERSMRVLDGVIAVFCSVGGVQPQSETVWRQADRYKVPR-IAFINKMDRTGANFYRVHEEEIRSALRKGTIAGTIVPVLCGSAFKNK----------GVQLMLDAVVDYLPAPTEDDNEPLAALAFKIMA-DPYGRLTFVRVYSGVLKKGSYV--LNATKNKKERISRLVLDRQDVEELRAGDLGAA----LGLKDTLTGDTITDEGAPVILESLFIPEPVISVAVEPKTKNDMDKLSKALQSLSEEDPTFRVNVDPETNQTVIAGMGELHLEILVDR............................. 461
19 -23.500[J] KOG1145 Mitochondrial translation initiation factor 2 (IF-2; GTPase)  ali follow..  23  182......................................................VVTIMGHVDHGKTTLLDKFRK----------------TQVAAVETGGITQHIGAFLVSLPSGEITFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDGVMKQTVESIQHAKDAQVP-IILAVNKCDKAEAD--EKVKKELLAVVCEDYGGDVQAVPVSALTGDNLMALAEAT------VALAEMLELKADPNGPVEG-----VIESFTDKGRGLVTTAIIQRGTLRKGSVLVA-----KCWAKVRLM-FDENGKTIDEAYPSMPVGITGWRDLPSAGEEILEVESEPRAREVVDWRKYEQEQEK................................................................................. 455
20 -21.000[J] KOG0465 Mitochondrial elongation factor  ali follow..  20  72......................................................NIGISAHIDSGKTTFTERVLYYTKRIKAGRDNVGAKMDSMDLEREKGITIQSAATYCSGKNYHFNLIDTPGHIDFTIEVERALRVLDGAVLVVCAVSGVQSQTVTVDRQMRRYNVPR-VTFINKMDRMGSDPFRAIEQQIKDAIRRSTIARSFTPVLMGSALANT----------GIQPVLDAIVDYLPNPSEAVQQPFVGLAFKLEE-GKYGQLTYVRVYQGRLRKGNYITNVKTGKKVKVAVRMHSSEMEDVDEVGSGE-----ICATFGIDCASGDTFTDGSVQYSMSSMYVPDAVVSLSITPNSKDASNFSKALNRFQKEDPTFRVKF-DPESKETIISGMGELHLEIYVER............................. 527
21 -20.700[E] COG4917 Ethanolamine utilization protein  ali follow..  25  4.......................................................IAFVGSVGAGKTTLFNALQG----------------NYTLARKTQAVEF-----------NDKGDIDTPGHPRWYHALITTLQDVDMLIYVHGAND---PESRLPAGLLDIGVSKRQIAVISKTDMPDAD-----VAATRKLLLETGFE-EPMFELNSHDPQSVQQLVDYL..................................................................................................................................................................................................................... 142
22 -19.000[R] KOG2486 Predicted GTPase  ali follow..  16  138.......................................................FALVGRSNVGKSSLLNSLVR----------------RLALTSKKPGKTQCINHFRI---NDKWYLVDLPGYNKFTKDYFLNRSTLVSVFLLVDASIPVKPIDLEYASWLGQNQVP-MTLIFTKCDKRKKKKPEANIKEFQDLIQGFFETTPPWIMTSSVTNQGRDEILLHM..................................................................................................................................................................................................................... 308
23 -18.800[J] COG0532 Translation initiation factor 2 (IF-2; GTPase)  ali follow..  20  447......................................................VVTIMGHVDHGKTTLLDRFRES----------------RVTEGEAGGITQHIGAYQIKANGKKITFLDTPGHEAFTSMRARGASVTDITILVVAADDGVMPQTIEAINHSKAAGVP-IIVAINKIDKPGAN------QRVTQELTEHGVFPVAFVEISAKFNQNLDELLDTV------LLVAEVQELKADPTVRAIG-----VVEARLDQGKGAIATLLVQQGTLHVQDPIVV-----NTYGRVRTM-TNDLGRRIKEAGPSTPIELTGLS----QAGDHF-----AVFEDEKAARAAGEERAKRAQLIKRQNTRRVNL----------------DNLFDTLKEGQTKSVNIIIKADVSAEALAASLQKIEVEGVAVGAISE... 786
24 -17.800[R] COG3596 Predicted GTPase  ali follow..  14  24......................................SERILQQINQLTHYEPVIGIMGKTGAGKSSLCNALFA----------------EVSPVSDVAACTRDPLRFRLQIGEHFMTIVDLPGDTEYAALYREQLPRLDLILWLIKADDRALATDEHFYQVIGEAYRHKMLFVISQSDKAEPTSGGNILSTEQKLLHELFQPVHPVCAVSVRLQWGLRVMAERM..................................................................................................................................................................................................................... 212
25 -17.000[R] COG0218 Predicted GTPase  ali follow..  14  28.......................................................IALAGRSNVGKSSFINTMLNRKN---------------ARTSGKPGKTQLLNFFNI---DDKMRFVDVPGYGCMIEEYLTTRENLRAVVSLVDLRHDPSADDVQMYEFLKYYEIPVIIV-ATKADKIPRGKWNKHESAIKKKLNFD--PSDDFILFSSVSKAGMDEAWDAI..................................................................................................................................................................................................................... 191
26 -15.700[R] COG1084 Predicted GTPase  ali follow..  15  152..........................................LRNMPTVDLDAFTVVIAGFPNVGKSTLLRTLTGAEPEVADYPFT----------------TKGIQIGHLERKWKRIQVIDTPGNNIELQAMVALENIADVIMFIFDASETCGYTLESQYSLYLGI--IPVVTVFNKMDLAENV----------KYLEEYINMVEDPLKVSAFEGRGVSKIIKKL..................................................................................................................................................................................................................... 321
27 -15.000[U] KOG0090 Signal recognition particle receptor, beta subunit (small G protein superfamily)  ali follow..  16  51................................................RRTKSNTVLLSGLSGSGKTVLFYQLRD----------SSHQGAVTSMEPNEGTFVLHNENNTKKGKVKPVHLIDVPGHSRLISKLEEYLPRAAAVVFVVDALE-NIRAASEYLDILTNASVIKVLLCCNKTDKVTAHTKEFIRKQMEKEIDK............................................................................................................................................................................................................................................... 200
28 -13.800[R] COG1160 Predicted GTPases  ali follow..  15  204.........................................LDEELEEEQDKNIKIAIVGRPNVGKSTLTNRILGE---------------DRVVVFDMPGTTRDSIYIPMERDGQQYTLIDTAGVRK-VIKTLQAIQDANVVLLTIDARENISDQDLSLLGFILNAG-RSLVIVVNKWDGLDQDVKDRVKSELDRRLDFIDF--ARVHFISALHGSGVGNLFDSIQKMTTSLLTRILQMATDEHQPPMIGGRRIKL...................................................................................................................................................................................... 420
29 -13.600[P] COG0370 Fe2+ transport system protein B  ali follow..  16  2...................................................SQNTYCILGNPNTGKTSLFNALTGSYEYVGN------------------GVTVEKKVGTLR--SKTGKLIDLPGDETVVTRFLLE-EKFDCMLNIVDSSQ-----ERNLNLTVQLLEYGPVVMGLNMIDVAAGRGIHLNIQNLAKKL------RIPILPVVARSGKGTEDILSTL..................................................................................................................................................................................................................... 157
30 -12.800[R] KOG1490 GTP-binding protein CRFG/NOG1 (ODN superfamily)  ali follow..  12  170......................................................TVLICGYPNVGKSSFMNKVTRADVDVQPYAFT----------------TKSLFVGHTDYKYLRYQVIDTPG---ILDRPFEDRNIIEAVLFFLDISGSCGYTIAQQAALFHSIK-KPLVIVCNKTDLMPMENISEEDRKLIEEMKSEAMEEQVLLKMSTLTDEGVMSVKNAA..................................................................................................................................................................................................................... 345
31 -12.800[R] COG2229 Predicted GTPase  ali follow..  14  2...................................................RENKIIFTGPVGVGKTTAIAAIS----DEALVQTDASASDMTLDRKRNTTVAMDYGAISLD-EDTKVHLYGTPGQERF-EILSQGSMGL--VLLLDNARTNPLKDLEFFLSFRGLLEKAPVVVGITKMDIRSQPGIDVYHKYLAK-------HNLNVPVFEIDARKEDDVKQ------LVSAMLFSIDPGLEV................................................................................................................................................................................................... 178
32 -11.500[R] COG1159 GTPase  ali follow..  15  11.......................................................IAIVGRPNVGKSTLLNKLLG-------QKISITSRKAQTTRHRIVGI--------HTEGPYQAIYVDTPGNRLMNKAASSSIGDVELVIFVVEGTR----WTPDDEMVLNKL--APVILAVNKVDNVQEK--VDLLPHLQFLASQMNF--LDIVPISAETGMNVDTIEDYITDRSQRFMASEIEKLMRFLGAELPYSVTVEIERFVTNERGGYDINGLIL--VEREGQKKMVIGNKGA---KIKTIGIEARKDMQEMFEAPVHLEL...................................................................................................................... 277
33 -11.300[U] KOG0072 GTP-binding ADP-ribosylation factor-like protein ARL1  ali follow..  20  14.................................................GSREMRILILGLDGAGKTTILYRL-------------------QVGEVVTTIPTIGFNVEQVTYKNLKFQVWDLGGQTSIRPYWRCYYSNTDAIIYVVDSAD--IGISKDELLYMEELAGAILVVLANKQDMDG----CMTVAEVHHALGLENLKNRTFQIFKTSATKG............................................................................................................................................................................................................................. 163
34 -11.300[R] KOG0074 GTP-binding ADP-ribosylation factor-like protein ARL3  ali follow..  18  14.................................................PDQEVRILLLGLDNAGKTTLLKQL-------------------ASEDISHITPTQGFNIKSVQSQGFKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKFEETGQELAELEKLSCVPVLIFANKQDLLT----AAPASEIAEGLNLHTIRDRVWQIQSCSALTG............................................................................................................................................................................................................................. 163
35 -11.300[U] KOG0070 GTP-binding ADP-ribosylation factor Arf1  ali follow..  20  14.................................................AKKEMRILMVGLDAAGKTTILYKL-------------------KLGEIVTTIPTIGFNVETVEYKNISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDVVEARDELHRMDELRDAVLLVFANKQDLPN----AMNAAEITDKLGLHSLRQRHWYIQSTCATSG............................................................................................................................................................................................................................. 163
36 -11.300[U] KOG0071 GTP-binding ADP-ribosylation factor Arf6 (dArf3)  ali follow..  18  18.................................................SNKEMRILMLGLDAAGKTTILYKL-------------------KLNQSVVTIPTVGFNVETVTYKNIKFNVWDVGGQDKIRPLWRHYFTGTKGLIFVVDSADSNISEARQELHRIREMRDCLLLVLANKQDLPG----ALSPAQITDVLQLDKLKDRLWNVQPTCALTG............................................................................................................................................................................................................................. 167
37 -11.200[U] KOG0077 Vesicle coat complex COPII, GTPase subunit SAR1  ali follow..  16  18..................................................QKEAKILFLGLDNAGKTTLLHML-------------------KDERLVQHQPTQHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAYDKEFAESKRELDALEALATVPFLILGNKIDIPYAASEDELRYHLG.................................................................................................................................................................................................................................................... 147
38 -11.200[O] KOG0448 Mitofusin 1 GTPase, involved in mitochondrila biogenesis  ali follow..  16  72.................................................SRRHMKVAFFGRTSSGKSSVINAMLWYLMTEGSDEKKSVKTVNQLDKDLKAGCLVRVFWPKAKCARDDLVLVDSPGLDSWIDKFCL---DADVFVLVANSESTLMNTEKHFFKVNEWLSKPNIFILNNRWDASASEHMERCLHFLVEELKVANALEAQNRIFFVSAKEVLSARKQ....................................................................................................................................................................................................................... 294
39 -11.200[UZ] KOG0073 GTP-binding ADP-ribosylation factor-like protein ARL2  ali follow..  18  13.................................................KERELRLLMLGLDNAGKTTILKKF-------------------NGEDIDTISPTLGFNIKTLEHRGFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSAD--MQDCQRELQSLERLAGATLLIFANKQDLPG----ALSSNAIREALELDSIRSHHWCIQGCSAVTG............................................................................................................................................................................................................................. 162
40 -11.200[V] KOG1707 Predicted Ras related/Rac-GTP binding protein  ali follow..  12  2........................................WMGVGDSSGSPKPIRIVVVGEKGSGKSSLIMAAAR----------------NTFHPNIPSLLPYTNLPSEFFPDRIPATVIDTSSRPEDKGKVVKEVRQADAIVLTFAFDR---PETLDRLSKYWLPLFRQIIVAGYEVDNKEAYNHFSIEQITSALMKQY--EVETSIQWSAQRLDQAKDV-----YYAQKAVIDPVGPVFDQENNVLKPRCIAALKRIFLLSDHN-------MDGILSDEELNELQKKCFDTPLVPCEIKQMKNVMQVTFPQNERGLTLDGLNTRLIEEARIQTL--TMLRKFGYSNDLRLGDDLVPYSSFKRQADQSVELTNVAIEFLREVYEFFDSNGDNNLEPHE....................................... 340
41 -11.100[R] COG1100 GTPase SAR1 and related small G proteins  ali follow..  20  10............................................DKLWGSNKELRILILGLDGAGKTTILYRL-------------------QIGEVVTTKPTIGFNVETLSYKNLKLNVWDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDMSTASKELHLMEELQDAALLVFANKQDQPG----ALSASEVSKELNLVELKDRSWSIVASSAIKG............................................................................................................................................................................................................................. 164
42 -11.000[R] KOG0075 GTP-binding ADP-ribosylation factor-like protein  ali follow..  18  18..................................................KEEMELTLVGLQFSGKTTFVNVI-------------------ASGQFAEDMITVGFNMRKITRGNVTIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAAD--LEASRNELHSLPQLAGIPVLVLGNKRDLPG----ALDETGLIERMNLSSIQDREICCYSISCKEK............................................................................................................................................................................................................................. 167
43 -11.000[U] KOG0076 GTP-binding ADP-ribosylation factor-like protein yARL3  ali follow..  14  14.................................................KKEQYSILILGLDNAGKTTFLETLKKEYSL-------------AFKALEKIQPTVGQNVATIPVDSKQLKFWDVGGQESLRSMWSEYYSLCHGIIFIVDSSD--LDECSTTLQSVEEIEGVPILMLANKQDRQDRMEVQDIKEVFNKIAEHISARDSRVLPISALTGEGVKD.......................................................................................................................................................................................................................... 177
44 -10.300[T] KOG3886 GTP-binding protein  ali follow..  13  2..............EESDSEKTTEKENLGPRMDPPLGEPEGSLGWVLPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATILDRIHSLQINSSLTFDVEHSHVRFLGNVLNLWDCGGQDTFMENYFTSQRNVEVLIYVFDVESRELEKDMHYYQILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLR................................................................................................................................................................................................................................................ 210
45 -10.200[R] KOG1489 Predicted GTP-binding protein (ODN superfamily)  ali follow..  17  337..................................................KSIADLGLIGLPNAGKSTILNKISNAKPKIGHWQFTT--------------LSPTIGTVSLGFGQDVFTVADIPG-LEFLRHI----ERSNGWVFVLDLSNKDLQLLIEEVGTLEKVKTKNILIVCNKVDIDAKSESFAKYLQVEKFSKS-----QEWDCVPISALREKT........................................................................................................................................................................................................................... 499
46 -10.000[OK] COG0378 Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase  ali follow..  15  2..................................................KRPLIIGVGGPVGAGKTMLIERLTRYLSTKGYSMAAITNDIYTLPADRIAGVETAIEEMCDKHPDLQLLFLESGG--------TFSPDLVDFSIYIIDVAQGEKIPRKGGQGMIKS------LFIINKVDLAPYV-VEVMKADTLKS------GNKDFFVTNLKTDEGLKSVADWI..................................................................................................................................................................................................................... 195
47 -9.790[R] COG1163 Predicted GTPase  ali follow..  16  37........................KLRRELLTSASSGSGGGAGIGFDVARTGVASVGFVGFPSVGKSTLLSKLTGTESEAAEYEFT----------------TLVTVPGVIRYKGAKIQMLDLPG-RGRGKQVIAVARTCNLLFIILDVNKPLHHKEKELEGVGIRLNKTPPDILIKKKEKGGISITNTVNDEIRAVMSEYRINSAEI....................................................................................................................................................................................................................................... 220
48 -9.590[U] KOG3887 Predicted small GTPase involved in nuclear protein import  ali follow..  15  58................................................STEVKPRILLMGLRRSGKSSIQKVVFHKMS---------------PNETLFLESTNKICREDVSNSSFNFQIWDFPGQIDFFDPTFD--RGTGALIFVIDSQDDYMEALARLHLTVTRA---NFEVFIHKVDGLSDDHKIETQRDIHQRAND............................................................................................................................................................................................................................................... 202
49 -9.540[T] KOG1487 GTP-binding protein DRG1 (ODN superfamily)  ali follow..  11  32....................KARLAKLRRELITPKGGGGGGPGEGFDVAKTGDARIGFVGFPSVGKSTLLSNLAGVYSEVAAYEFT----------------TLTTVPGVIRYKGAKIQLLDLPG---IIEGAKDGARTCNLILIVLDVLKPLGHKENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCAETVKSILAEYKIHNADVTLRSDATADDLDVVEGNRVYIPCIYVLNKIDQISIEELDIIYKVPHCVPISAHHRWNFDDLQLPDYTSPVVLPYSRTTVEDFHKNLIKEFKYALVWGLSVK--HNPQKVGKDHTLEDEDVIQ............................................................................................................. 363
50 -9.520[DZ] COG5019 Septin family protein  ali follow..  13  44.SENKNEEKPIQDNSEQEFNPHVSIIQRQLNGYVGFASLPNQWHRRCVRQGFNFNVLVLGESGSGKSTLVNTL------LNRDVYPPTQKSLTGDFGVNPEPTVMINSSAVEIVENQLNVIDTPGFGDFIDNTDCWQPVLTDI---KHNPRSTIQDPRVHACIISAMELRNIIPIIAKADTLTDDELNFTKEMILRDIQYHNIR........................................................................................................................................................................................................................................... 270
51 -9.360[R] KOG1533 Predicted GTPase  ali follow..  16  2.....................QMNLNEKKQLLRVRVYATSEKGENLGSTHWTMYGVLVIGAPGAGKSTFCAGLTDIFSQTKRPFLTI--NLDPANDTMAYAPDVNITLQKIEANHKKYLIIDCPGSEGELWKVIRFLEKSGVRLCALHLADSLYCSDPSKFISVALSTLATMVNCLSKADLFSEDGTYDLEFFSH.................................................................................................................................................................................................................................................... 220
52 -9.300[DZU] KOG2655 Septin family protein (P-loop GTPase)  ali follow..  17  26...........................................HRKSVKKGFEFTLMVVGESGLGKSTLVNSLFLTDLYPERIIPDAIEKQKQTVKLEASTVEIEERGVKL-----RLTVVDTPGFGDAIDNSNSFGAILEYI---SGLNRRNIVDNRIHCCFLKPLDVENIVPVIAKADCLTKKEILRLKCRIMQEIESHGIK........................................................................................................................................................................................................................................... 207
53 -9.280[T] KOG1486 GTP-binding protein DRG2 (ODN superfamily)  ali follow..  13  10IEAEMARTQKNKATEYHLGQLKAKIAKLRTQLLEPPKGASGGGEGFEVTKYGHGRVALIGFPSVGKSTLLTMLTGTHSEAASYEFT----------------TLTCIPGVIHYNDTKIQLLDLPG-----RQVIAVAKSSDLVLMVLDASKSEGHRTKELEAVGLRLNKTPPQIYFKKKKTGGISLTHIDEKLCYQILHEYKIHNAEVLFRENATVDDFDVIEGNRKYIKCVYVYNKIDVVGIDDVDRLSRQPNS-VRVYSKPQGQQPDFDEPFVLSSDRGGCTVECNHVHRTLVKDMKYALVWGTSTR--HNPQNCGLSLEDEDVVQIKKERDEGGRGRFKSHSNAPARI-----ADREKKAPLKQ........................................................................ 399
54 -9.160[R] KOG0395 Ras-related GTPase  ali follow..  14  2...................................MKTLSSGNCTLSVPAKNSYRMVVLGASRVGKSSIVSRFL-------NGRFEDQYT-PTIEDFHRKVYNIRGDMYQLD-------ILDTSGNHPFPAMRRLSILTGDVFILVFSLDN---RESFDEVQILEVKSCLKMVICGNKNDHGELCR-QVPTTEAELLVS----GDENCAYFEVSAKKNTN........................................................................................................................................................................................................................... 178

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 5 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Harder T, Godzik A. JAFA: a protein function annotation meta-server. Nucleic Acids Res. 2006 Jul 1;34(Web Server issue):W379-81.