current user: public

If you have questions about the server, please let us know.

Query: [J] KOG0466 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase), from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470
# Score Template Links and tools%idFirst MAGGEAGVTLGQPHLSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYQLDDPSCPRPECYRSCGSSMPDEFPTDIPGTKGNFRLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMKLKHILILQNKIDLVKERQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIVKKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQETEVRPGIVSKDSEGKLMCKSIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQILGAVGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDDLast
1 -131.000[J] KOG0466 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali  100  1MAGGEAGVTLGQPHLSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHVAHGKSTVVKAISGVHTVRFKNELERNITIKLGYANAKIYQLDDPSCPRPECYRSCGSSMPDEFPTDIPGTKGNFRLVRHVSFVDCPGHDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMKLKHILILQNKIDLVKERQAKEQYEQILAFVQGTVAEGAPIIPISAQLKYNIEVVCEYIVKKIPVPPRDFTSEPRLIVIRSFDVNKPGCEVDDLKGGVAGGSILKGVLKVGQETEVRPGIVSKDSEGKLMCKSIFSKIVSLFAEHNDLQYAAPGGLIGVGTKIDPTLCRADRMVGQILGAVGALPEIFTELEISYFLLRRLLGVRTEGDKKAAKVQKLSKNEVLMVNIGSLSTGGRVSAVKADLGKIVLTNPVCTEVGEKIALSRRVEKHWRLIGWGQIRRGVTIKPTVDDD 472
2 -107.000[J] COG5257 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  45  1...................................MKNQSEINIGLVGHVDHGKTTLTKALSGVWTDTHSEETKRGISIRLGYADITFRKCPQCEAPM-----------CYTTAEICERCGTETELLRKVSFVDAPGHETLMATMLSGAALMDGAILVIAANEPCPQPQTKEHLMALDVIGVKDVIVVQNKIDIVSKERALESYREIKEFVKGTCAEDAPIIPVSAQQGANIDILIETIEERIKTPKRDVDKPARMYVARSFDINKPGADPEHLAGGVIGGSLVQGRLRVGDEIEIRPGIQV-KKDGKQTWMSLHSTITGLVAGGEEMEEVGPGGLVGVGTLLDPALTKADSLSGSVAGEPGTLPPVRHSFTMETHLLERVVGTKEE-----TKVEPIKTGEPLMINVGTTTTVGVVKSARADDADVVLKLPACAEEGQRIALSRRVGARWRLIGYGII............. 407
3 -87.000[J] KOG0460 Mitochondrial translation elongation factor Tu  ali follow..  18  14.FRKNCLRLNRISFASGLINRFTVPARTYADEKVFVRKKPHVNIGTIGHVDHGKTTLTAAITKCLSDLGQA------------SFMDYSQIDKAPEEKARGITISSAHVEYETA------------NRHYAHVDCPGHADYIKNMITGAATMDGAIIVVSATDGQ-MPQTREHLLLARQVGVKQIVVYINKVDMVEPDMIELVEMEMRELLSEYGFDGDNTPIVSGSALCALEKLMEAVDSYITLPERKTDVPFLMAIEDVFSISG--------RGTVVTGRVERGTLKKGAEIEIVGYG-----------SHLKTTVTGIEMFKKQLDAAVAGDNCGLLLR---SIKREQLKRGMIVAQPGTV-APHQKFKASFYILTKEEGGRR---------TGFVDKYRPQLYSRTSDVTVEVMPGDNVEMICTLIHPIVIEKGQRFTVR----EGGSTVGTALVTELLD........ 439
4 -82.400[J] COG0050 GTPases - translation elongation factors  ali follow..  22  3...............................KEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKT-------------GGSARAFDQIDNAPEEKARGITINTSHVEYDTP------------ARHYAHVDCPGHADYVKNMITGAAQMDGAILVVAATDGP-MPQTREHILLGRQVGVPYIIVFMNKCDMVDEELLELVEMEVRELLSAYDFPGDDLPVVRGSALKALEELAGYLDSYIPEPERAIDKPFLLPIEDVFSISG--------RGTVVTGRVERGIVKVGEEVEIVGIK-----------DTVKSTCTGVEMFRKLLDEGRAGENVGVLLR---GIKREDIERGQVLAKPGSI-KPHTTFESEVYILSKDEG---------GRHTPFFKGYRPQFYFRTTDVTGTIMPGDNINMIVTLIHPIAMDDGLRFAIR----EGGRTVGAGVVAKVIA........ 394
5 -73.300[J] COG3276 Selenocysteine-specific translation elongation factor  ali follow..  23  1.........................................MIIVTSGHVDHGKTALLKALTGTSTAHLPEEKKRGMTIDLGYAYLPL-------------------------------------ENKVLGFIDVPGHEKFLSNMLAGLGGVHYAMLIVAADEGV-AVQTKEHLAILRQLQFHEIIVVITKADRTNSAQIESLIQTIKQDY--SFLRNANYFVTSAETGQGISELRHYLANLA--ELADTQKPFRYAIDRVFSVKGA--------GTVVTGTAFSGTVKVNDEIYLSTG--------------QKIRIKAIHAQNTSSEQGIAGQRLALNLNA--DLDRTPMKRGDWLLQNEPL-PPTDRISVQILAE-----------------VPLNESQPVHIYHGASRTTGKLTKNDRTLAEIILDSPLFLAFGDKLILRS--GDTKTLIAGARVLEINSPKRHKRTE 353
6 -69.200[J] COG5256 Translation elongation factor EF-1alpha (GTPase)  ali follow..  19  2................................KIMASQKPHLNLITIGHVDHGKSTLVGRLHGEIPAHIIEEYRKEAEQKGKATFEFAWVMDRFKEERERGVTIDLAHRKFETD------------KYYFTLIDAPGHRDFVKNMITGTSQADAAILVISAREGEGVEQTREHAFLARTLGVPQMVVAINKMDATSEKRYNEVKADAEKLLRSIGFKDISFVPISGYKGDNVPTLLQALDA-FKVPEKPINKPLRIPVEDVYSITG--------IGTVPVGRVETGVLKPGDKVIFLPADKQ-------------GDVKSIEMHHEPLQQAEPGDNIGFNVR---GIAKNDIKRGDVCGHLDTPPTVVKAFTAQIIVLNHPSVIAPGYKPVTAQVACRIDEIVKTLNPKDGTTLKEIKNGDVAIVKVIPDKPLVIEKVSEILGRFAVRDMGQTVAAGQCIDLEKR....... 427
7 -67.600[R] COG5258 GTPase  ali follow..  15  67LREMARRVGASLYILRVSEGIRGKVAEVLLRAVSREEPPPTVTVVALGNVDAGKSTLVGVLTTGRLDRYKHEVLTGRTSAVSLRLLGF----SGDKVVNHGLIDPLDEAEV------------KRSDKLVLLVDVGGHERYLRTALRGLFSPDYVMLVVAANSGV-QKMTKEHLGIAVAIGIP-VFVVVTRIDITPSEVFQKTVEEVVRILKMPGVSKAPVFYVSSVTGHGLDLLLRFLSLLPRRRRWDYGGEFLMYISDIYLVKG--------VGVVIGGLVEKGILHVGDRVWLGPYSDG---------KWMQTVVKSIHFNRTPVESAKAGSFITVALDKV------EKVEKGMVLSARPL-KAVREVTADVLVLRH--------------PTVIRAGFSGVFHYKAVRTGGYIKVGDSGVVKIELSRPWHIDSG-VFVFRN-----GPTRILGRIIGTDGTLSA.... 517
8 -65.200[J] KOG0052 Translation elongation factor EF-1 alpha/Tu  ali follow..  18  1..................................MGKEKVHINIVVIGHVDSGKSTTTGHLCGGIDKRTIEKFEKEAQEMGKGSFKYAWVLDKLKAERERGITIDIALWKFETA------------KYYITIIDAPGHRDFIKNMITGTSQADCAVLVVACGTGEFEAQTREHALLAQTLGVKQLIVACNKMDSTEEARFTEITNEVSGFIKKIGYKAVPFVPISGFNGDNMKTLLEALDS-IIPPQRPTDRPLRLPLQDVYKIGG--------IGTVPVGRVETGIIKPGMVVTFAPQNVT-------------TEVKSVEMHHESLPEAVPGDNVGFNVK---NVSVKDIRRGSVCSDSKQDPKEARTFHAQVIIMNHPGQISNGYTPVTAHIACKFNELKEKVDRRTGKKVEDLKSGDAGIVELIPTKPLCVESFTDYLGRFAVRDMRQTVAVGVIKSVEKSDGSSGK. 450
9 -63.300[P] COG2895 GTPases - Sulfate adenylate transferase subunit 1  ali follow..  16  1..............MNTALAQQIANEGGVEAWMIAQQHKSLLRFLTCGSVDDGKSTLIGRLTRQIYEDQLSSLHNDSK-TQGEKLDLALLVDGLQAEREQGITIDVAYRYFSTE------------KRKFIIADTPGHEQYTRNMATGASTCELAILLIDARKGV-LDQTRRHSFISTLLGIKHLVVAINKMDLVDEETFTRIREDYLTFAGQLPGLDIRFVPLSALEGDNVPTLLEVLET-VEIQRVVDAQPMRFPVQYVNRPNL--------DFRGYAGTLASGRVEVGQRVKVLPSGVE-------------SNVARIVTFDGDREEAFAGEAITLVL-----TDEIDISRGDLLLAADEALPAVQSASVDVVWMAE---------------QPLSPGQSYDIKIAGKKTRARVDLNGIGLVDLTFDEPLVLDRYQGLIFIDR--LSNVTVGAGMVHEPVSQATAAPSE 447
10 -59.600[J] KOG0458 Elongation factor 1 alpha  ali follow..  13  128.RNGEEANDEKTVQRYYKTTVPTKPKKPHDISAFVKSALPHLSFVVLGHVDAGKSTLMGRLLNIVNQSQLRKLQRESETMGKSSFKFAWIMDQTNEERERGVTVSICTSHFSTH------------RANFTIVDAPGHRDFVPNAIMGISQADMAILCVDCSTNAFESQTKEHMLLASSLGIHNLIIAMNKMDNVDQQRFEEIKSKLLPYLVDIGFDNINWVPISGFSGEGVPNLMSTLENA-ENEGINKDDPFLFSVLEIIPSKKTSND-----LALVSGKLESGSIQPGESLTIYPSEQS-------------CIVDKIQTNHEETDVAIKGDFVTLKLR---KAYPEDIQNGDLAASVDYSIHSAQCFVLELTTFDMNRPLLPGTPFILFEQPARIKRLISFIDKGNTASKKKLGSKQRAFVEIELKRWIPLLTAHRVVLR----KDGRTIAAGKISEITQ........ 611
11 -59.600[J] KOG0459 Polypeptide release factor 3  ali follow..  17  62.HDEVMLHPVHNPAKAKEKAAQEKAAKEEAEDVAEANKKRHLNVVFIGHVDAGKSTIGGQISGQVDDRQIQKYEKEAKDKSRESWYMAYIMDTNEEERLKGKTVEVGRAHFETE------------STRFTILDAPGHKSYVPNMISGASQADIGVLVISARKGEFETQTREHVQLAKTLGVSKLIVVVNKMDDPSKERYDEIEQKMVPFLKASGYKDVVFLPISGLMGKNMPSFFEVLDS-IEIPPRDPNGPFRMPIIDKFK-----------MGTVVMGKVESGSIREGDSLVVMPNKEQ-------------VKVVAIYCDEDKVKRAGPGENLRVRIT---GIEDEDILSGFVLSSIVNPVPAVTEFVAQLQILE-TAGYKAILHIHAVVEECEIIELKSQIDLKTRKPMKKVKNGAAVVCRIQVTNSICIEKFSRFTLR----TEGKTIAVGKVTELLSSVSS.... 531
12 -34.400[M] COG0481 Membrane GTPase LepA  ali follow..  22  6..........................................NFSIIAHIDHGKSTLSDRLCGGLSDREMEAQ----------------VLDSMDLERERGITIKAQSVTLNYK-------AKDGETYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDAGQGV-EAQTLANCYTAIEMNLE-VVPILNKIDLPAAD-PERVAEEIEDIVG---IDAMEAVRCSAKTGVGIEDVLEEIVHKIPAPEGDPNAPLQALIIDSW---------DNYLGVVSLVRIKNGTLRKGDKIKVMSTGQSYNVDRLGIFTPKQVDTTIL------NCGEVGWVVCAIK-------DILGAPVGDTLTSHNN............................................................................................................. 279
13 -31.100[J] KOG0462 Elongation factor-type GTP-binding protein  ali follow..  21  23.....................STAGDPTKLVNLSEFTPDKIRNFGIVAHVDHGKSTLADRLLEM-CGAVPPGQKQ--------------MLDKLQVERERGITVKAQTAALRHR------------GYLLNLIDTPGHVDFSAEVSRSLAVCDGILLLVAANQGV-QAQTIANFWLAFEKNIQ-IIPVINKIDLPGAD-IKSVETQLKNLFE---FNPEECLHISAKSGLNVDKVLEAIIDRVPAPTAIIDAPFRSMIFDSY---------DHFRGAIAHIMVKEGSVKKGDKIQSYQNEKVYDVS-------EVGVMRPEMVKCTELRAGQVGYLVCNMRTV------NEAVVGETLFAETT............................................................................................................. 310
14 -30.700[T] COG1217 Predicted membrane GTPase involved in stress response  ali follow..  18  7..........................................NIAIIAHVDHGKTTLVDKLSGTLDRKEAESER---------------VMDSNDQEKERGITILAKNTAIKWN------------GYNINIVDTPGHADFGGEVERVMSMVDSVLLVVDAQDGP-MPQTRFVTQKAFKAGLR-PIVVVNKIDRPGAR-PDWVIDQIFDLFDNLGATDFPIVYASALNGDNMDALFQAIIDHVPAPVVDTEGPFQMQISQL--------DYNSFLGVIGIGRITRGKVKSNTPV------VAISDDGSKRNGRILKIMGHHGLQRVEVAEAEAGDIVCV-------SGMEELFISDTLCDPQN............................................................................................................. 293
15 -27.700[J] KOG0469 Elongation factor 2  ali follow..  15  5..........................TVDEIRALMDRKRNIRNMSVIAHVDHGKSTLTDSLAGIITDTRKDEQERCITIKSTAISLFFELEKKDLEFVKGENQFETVEVDGKKEKY---------NGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGV-CVQTETVLRQAIAERIKP-VLFMNKMDRALLETFQRIVENINVIIATYGDDDPLMKVFMRKWLPAGDTMLQMIAFHLPSPVTAQKYRMEMLYEGPHDDE---VPTSDKGRFYAFGRVFSGKVATGMKARIQGPNYVPGKKEDLYEKTIQRTILMMGRFIEPIEDIPSGNIAGLV-----GVDQYLVKGGTITTYKDAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIFEESGEHIIAGAGELIPLKKSDPVVS..................................... 572
16 -26.800[J] COG4108 Peptide chain release factor RF-3  ali follow..  13  2...........................LMSTTPYFGEVSKRRTFAIISHPDAGKTTITEKVGRAIQVTVKGRGSNQHAK-----------SDWMEMEKERGISVTTSVMQFPYG------------DCLVNLLDTPGHEDFSEDTYRTLTAVDSCLMVIDAAKGV-EDRTRKLMEVTRLRDTPI-VTFMNKLDREIRDPMELMDEASHEFDRELFLQGTPVFFGTALGNFGVDHMLDGLTQWAPSPMPRQAAERVVEASEEFVFKIQANMDPKHRDRIAFVRIVSGTYKQGMKMNHVRLGKQ---------VNISDAVTFMAGDRARAEEAFAGDIIGL-------HNHGTIQIGDTFTQGETLKFTGIPNFAPELFRRIRLRDPLKQKQLLKGLVQLSEEGAVQVFRPLQNNDLIVGAVGVLQFDVVVSR......................................... 454
17 -25.700[J] KOG0468 U5 snRNP-specific protein  ali follow..  14  133..........................................NVALVGHLHHGKTTFVDCLIRQTHPQFETMEERQLRY-----------TDTLFTEQERGCSIKATPVTLVLQ-------DVKQKSYLLNIFDTPGHVNFSDEATAAMRMSDGVVLFIDAAEGV-MLNTERLLKHAVQERQAI-TVCINKIDRLVDTTLSDTLAELNVRVSKEEMKSNIRPLLRLVCNRFMSGFVDMCVEHIKSPLENQYGTLMVHSSKMYPND-------DCTFFQVLARIVSGTLHAGQEVRVLGENYTLQDEEDSRILQVGRLWVFESRYKVELNRVPAGNWVLI-EGIDQCIVKTSTIVDINVPEDLYIFRPLKFNTQSIIKIAVEPVNPSELPKMLDGLRKVNKSYPL-LSTRVEESGEHVILGTGELIDIKVADPVVA..................................... 664
18 -24.900[E] COG4917 Ethanolamine utilization protein  ali follow..  15  4...........................................IAFVGSVGAGKTTLFNALQG---NYTLARKTQAVEF------------------------------------------------NDKGDIDTPGHPRWYHALITTLQDVDMLIYVHGAND----PESRLPAGLLDIGVSKRQIAVISKTDMPDAD-----VAATRKLLLETGFEE-PMFELNSHDPQSVQQLVDYLASLTKQEE................................................................................................................................................................................................................................. 150
19 -24.000[J] KOG1145 Mitochondrial translation initiation factor 2 (IF-2; GTPase)  ali follow..  15  141VITKAGMKLKWSKLKQDKVRKNKDAVRRPQADPALLTPRSPV-VTIMGHVDHGKTTLLDKF-------------RKTQVAAV---------------ETGGITQHIGAFLVSLP-----------SGEKITFLDTPGHAAFSAMRARGAQVTDIVVLVVAADDGV-MKQTVESIQHAKDAQVP-IILAVNKCDKAEAD-PEKVKKELLAVVCEDYGGDVQAVPVSALTGDNLMALAEATVALAEMLEADPNGPVEGTVIES--------FTDKGRGLVTTAIIQRGTLRKGSVLVA----------------KCWAKVRLMDENGKTIDEAYPSMPVGI-SAGEEILEVESEPRAREVVDWRKYEQEQEKGQEDLKIIEEKRKEHKEAHQKAREKKKRSILRFLERKEQIPLKPKEKRERDSNVLSVIIKGDVILNIIDTYDASHECELELVHFGVGDISA........... 558
20 -23.000[J] COG0480 Translation elongation factors (GTPases)  ali follow..  14  2................................ARINPLEKVRNIGIAAHIDAGKTTTTERIL----------FYSGIIHKIGEVHEGTAVTDWMDQERERGITITAAAISTSWK------------DYQINIIDTPGHVDFTIEVERSMRVLDGVIAVFCSVGGV-QPQSETVWRQADRYKVPR-IAFINKMDRTGANFYRVHEEEIRSALRKGTIAGVPVLCGSAFKNKGVQLMLDAVVDYLPAPTEVPPIQGTLPNGDAIERRADDNEPADPYGRLTFVRVYSGVLKKGSYVL----------NATKNKKERISRLVLMKADDQDVEELRAGDLGAA-------LGLKDTLTGDTITDEGAPVILESLFIPEPVISVAVEPKTKNDMDKLSKALQSLSEEDPTFRVNVDPETNQTVIAGMGELHLEI........................................... 457
21 -21.500[R] KOG2486 Predicted GTPase  ali follow..  11  122...........................KSSVKTEDCPADGLPEFALVGRSNVGKSSLLNSLVR----------RKRLAL----------------TSKKPGKTQCINHFRIN---------------DKWYLVDLPGYNKFTKDYFLNRSTLVSVFLLVDASIP-VKPIDLEYASWLGQNQVP-MTLIFTKCDKRKKKKNEANIKEFQDLIQGFFETTPPWIMTSSVTNQGRDEILLHMAQLRNYWLKH............................................................................................................................................................................................................................... 318
22 -20.000[J] KOG0465 Mitochondrial elongation factor  ali follow..  12  72..........................................NIGISAHIDSGKTTFTERVTKRIKA--IHEVRGRDNVGA--------KMDSMDLEREKGITIQSAATYCSWDKE--------GKNYHFNLIDTPGHIDFTIEVERALRVLDGAVLVVCAVSGV-QSQTVTVDRQMRRYNVPR-VTFINKMDRMGSDPFRAIEQQIKDAIRRSTIARTPVLMGSALANTGIQPVLDAIVDYLPNPSNNEAKVNLVPAVQQPFVGLAFKLEEGKYGQLTYVRVYQGRLRKGNYIT----------NVKTGKKVKVARLVRMHSSEEDVDEVGSGEICAT--------FGIDCASGDTFTDGSVQY-SMSSMYVPDAVVSLSITPNSKDASNFSKALNRFQKEDPTFRVKFDPESKETIISGMGELHLEI........................................... 523
23 -19.500[R] COG3596 Predicted GTPase  ali follow..  14  36......................................HYEPVIGIMGKTGAGKSSLCNALFAGEVSPVSD----------------------------AACTRDPLRFRLQI------------GEHFMTIVDLPGDTEYAALYREQLPRLDLILWLIKADDRALATDEHFYRQVIGEAYRHKMLFVISQSDKAEPTSGGNILSTEQKLLHELFQPVHPVCAVSVRLQWGLRVMAERMIKCLPREPS................................................................................................................................................................................................................................ 221
24 -18.700[J] COG0532 Translation initiation factor 2 (IF-2; GTPase)  ali follow..  18  407ILMDYGVTPVKKVEEDKSDIERLFVEDGYLKEENMVERPAVVTI--MGHVDHGKTTLLDRF-------------RESRVTEG---------------EAGGITQHIGAYQIKAN------------GKKITFLDTPGHEAFTSMRARGASVTDITILVVAADDGV-MPQTIEAINHSKAAGVP-IIVAINKIDKPGAN------QRVTQELTEHGV-GSEFVEISAKFNQNLDELLDTVAEVQELKADPTVRAIGTVVE---------ARLDQGKGAIATLLVQQGTLHVQDPIVV----------------NTYGRVRTMNDLGRRIKEAGPSTPIELGLSDVP-------QAGDHFAVFEDEKAARAAGEERAKRAQLIKRQNTRRVNLDNLFDTLKEGQTKSVNI-KADVQGSAEALAASLQKIEVEG......................................... 771
25 -18.500[R] COG0218 Predicted GTPase  ali follow..  15  12...........................LSAANKSHYPQDELPEIALAGRSNVGKSSFINTMLN------RKNLARTSGKPGKTQLLNFFNIDD-----------------------------------KMRFVDVPGYGCMIEEYLTTRENLRAVVSLVDLRHD-PSADDVQMYEFLKYYEIP-VIIVATKADKIPRGKWNKHESAIKKKLNFD--PSDDFILFSSVSKAGMDEAWDAILEKL..................................................................................................................................................................................................................................... 195
26 -18.200[R] COG1084 Predicted GTPase  ali follow..  15  151.............................KLRNMPTVDLDAFTVVIAGFPNVGKSTLLRTLTG----------------------------AEPEVADYPFTTKGIQIGHLERK------------WKRIQVIDTPGNNIELQAMVALENIADVIMFIFDASETCGYTLESQYSLYLGIRSVIPVVTVFNKMDLAENVKYLEEYINMVE----------DPLKVSAFEGRGVSKIIKKLEGLYEKETREAH............................................................................................................................................................................................................................. 333
27 -16.800[U] KOG0076 GTP-binding ADP-ribosylation factor-like protein yARL3  ali follow..  15  10.................................NNWNKKEQYSILILGLDNAGKTTFLETLKKEYSLAFKALEKIQPTVGQNVATIPV------------------------------------DSKQILKFWDVGGQESLRSMWSEYYSLCHGIIFIVDSSDRERLDECSTTLQSVEEIEGVPILMLANKQDRQDRMEVQDIKEVFNKIAEHISARDSRVLPISALTGEGVKDAIEWMIVRLERNKKSRPPIYK......................................................................................................................................................................................................................... 198
28 -16.300[R] COG2229 Predicted GTPase  ali follow..  14  2.......................................RENKIIFTGPVGVGKTTAIAAITDASASDMTLDRKRNTTVAMDYGAISL------------------------------------DEDTKVHLYGTPGQERFNFMWEILSQGSMGLVLLLDNARTNPLKDLEFFLSFRGLLEKAPVVVGITKMDIRSQPGIDVYHKYLAKH------LNVPVFEIDARKEDDVKQLVSAMLFSID.................................................................................................................................................................................................................................... 173
29 -15.400[P] COG0370 Fe2+ transport system protein B  ali follow..  12  1......................................MSQNTYCILGNPNTGKTSLFNALTGS----------------------------YEYVGNWSGVTVEKKVGTLR--------------SKTGKLIDLPGDETVVTRFLLE-EKFDCMLNIVDSSQ------ERNLNLTVQLLEYGPVVMGLNMIDVAAGRGIHLNIQNLAKKL------RIPILPVVARSGKGTEDILSTLSEKHVAPAIPLVLQYGEPAEKAIK................................................................................................................................................................................................................. 181
30 -15.100[R] KOG0075 GTP-binding ADP-ribosylation factor-like protein  ali follow..  15  18......................................KEEMELTLVGLQFSGKTTFVNVIA-------SGQFAEDMIPTVGFNMRKI-----------------------------------TRGNVTIKVWDIGGQPRFRSMWERYCRGVNAIVYMVDAADLDKLEASRNELHSLPQLAGIPVLVLGNKRDLPGALDETGLIERMN--LSSIQDREICCYSISCKEKDNIDITLQWLIQHSKSQSR................................................................................................................................................................................................................................ 186
31 -14.500[R] COG1159 GTPase  ali follow..  16  11...........................................IAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRHRIVGIH---------------------------------------TEGPYQAIYVDTPGNRLMNKAASSSIGDVELVIFVVEGTR-----WTPDDEMVLNKLR-APVILAVNKVDNVQEK--VDLLPHLQFLASQMNFLD--IVPISAETGMNVDTIAGIVRKHLPEAIHHFPEDYITDRSQRFMA-----------SEIIREKLMR---FLGAEL---PYSVTVEIERFVTNERGGYDINGLILVEREGQKKMVIGNKGAKIKTIGIEARKDMQE...................................................................................................................... 267
32 -14.400[U] KOG0090 Signal recognition particle receptor, beta subunit (small G protein superfamily)  ali follow..  14  48.................................RLFRRTKSNTVLLSGLSGSGKTVLFYQLR------------------------------DGSSHQGAVTSMEPNEGTFVLHNENNTKKGK---VKPVHLIDVPGHSRLISKLEEYLPRAAAVVFVVDALE---IRAASEYLDILTNASVIKVLLCCNKTDKVTAHTKEFIRKQMEKEIDKL--NKVTVAEASGLTG-ETDQVQEFIREHVK.................................................................................................................................................................................................................................... 259
33 -14.100[R] KOG1490 GTP-binding protein CRFG/NOG1 (ODN superfamily)  ali follow..  15  170..........................................TVLICGYPNVGKSSFMNKVTRADVD-----------------------------------------QPYAFTTKSLFVGHTDYKYLRYQVIDTPG-EMCSITALAHLRAAVLFFLDISGSCGYTIAQQAALFHSIKLFMNKPLVIVCNKTDLMPMENISEEDRKLIEEMKSEAMEEQVLLKMSTLTDEGVMSVKNAACERL..................................................................................................................................................................................................................................... 349
34 -14.100[R] COG1160 Predicted GTPases  ali follow..  14  177..TSEEEQDEWEQEFDFDSEEDTALIDDALDEELEEEQDKNIKIAIVGRPNVGKSTLTNRILG---------EDRVVVFDM------------------PGTTRDSIYIPMER------------DGQQYTLIDTAGEKFSVIKTLQAIQDANVVLLTIDARENI----SDQDLSLLGFI--RSLVIVVNKWDGLDQDVKDRVKSELDRRLD--FIDFARVHFISALHGSGVGNLFDSIKEAYACATQKMTT............................................................................................................................................................................................................................ 394
35 -14.000[T] KOG3886 GTP-binding protein  ali follow..  12  1MEESDSEKTTEKENLGPRMDPPLGEPE-GSLGWVLPNTAMKKKVLLMGKSGSGKTSMRSIIF----ANYIARDTRRLGATILDRIHSLQINSSLSTYSLVDSVGNTKTFDVEHSH-------RFLGNLVLNLWDCGGQDTFMENYFTSQRNVEVLIYVFDVESRELEKDMHYYQSCLEAI---KIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECSCFRTSIWDETLYKAWSSIVYQL..................................................................................................................................................................................................................................... 241
36 -13.800[R] KOG0074 GTP-binding ADP-ribosylation factor-like protein ARL3  ali follow..  16  14.....................................PDQEVRILLLGLDNAGKTTLLKQLASEDISHITP-------------------------------TQGFNIKSVQSQ------------GFKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELEKLSCVPVLIFANKQDLLTAAPASEIAEGLN--LHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAKKK................................................................................................................................................................................................................................ 182
37 -13.500[UZ] KOG0073 GTP-binding ADP-ribosylation factor-like protein ARL2  ali follow..  14  9.................................KMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISP-------------------------------TLGFNIKTLEHR------------GFKLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLERLAGATLLIFANKQDLPGALSSNAIREALE--LDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRIFTAD............................................................................................................................................................................................................................. 184
38 -13.200[U] KOG0077 Vesicle coat complex COPII, GTPase subunit SAR1  ali follow..  18  18......................................QKEAKILFLGLDNAGKTTLLHMLKDERLVQH-------------------------------------------QPTQHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVDAVVYLVDAYDKERFAESKRELDALEALATVPFLILGNKIDIPYAASEDELRYHLKVTLGDSGVRPLEVFMCSIVRKMGYGEGFKWLSQYIN.................................................................................................................................................................................................................................... 193
39 -13.200[R] COG1100 GTPase SAR1 and related small G proteins  ali follow..  14  5...........................FSSMFDKLWGSNKELRILILGLDGAGKTTILYRLQIGEVVTTKP-------------------------------TIGFNVETLSYK------------NLKLNVWDLGGQTSIRPYWRCYYADTAAVIFVVDSTDKDRMSTASKELHLMEELQDAALLVFANKQDQPGALSASEVSKELN--LVELKDRSWSIVASSAIKGEGITEGLDWLIDVIK.................................................................................................................................................................................................................................... 179
40 -13.100[U] KOG0072 GTP-binding ADP-ribosylation factor-like protein ARL1  ali follow..  11  10.................................RGLLGSREMRILILGLDGAGKTTILYRLQVGEVVTTIP-------------------------------TIGFNVEQVTYK------------NLKFQVWDLGGQTSIRPYWRCYYSNTDAIIYVVDSADRDRIGISKDELLYMEELAGAILVVLANKQDMDGCMTVAEVHHALG--LENLKNRTFQIFKTSATKGEGLDQAMDWLSNTLQ.................................................................................................................................................................................................................................... 178
41 -13.000[U] KOG0071 GTP-binding ADP-ribosylation factor Arf6 (dArf3)  ali follow..  13  14.................................SRLFSNKEMRILMLGLDAAGKTTILYKLKLNQSVVTIP-------------------------------TVGFNVETVTYK------------NIKFNVWDVGGQDKIRPLWRHYFTGTKGLIFVVDSADSNRISEARQELHRIREMRDCLLLVLANKQDLPGALSPAQITDVLQ--LDKLKDRLWNVQPTCALTGDGLLEGLAWLSQNAK.................................................................................................................................................................................................................................... 182
42 -13.000[O] KOG0448 Mitofusin 1 GTPase, involved in mitochondrila biogenesis  ali follow..  13  61........................KDKLSIIGEVL--SRRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGHITNCFLSVEGTDGDKAYLMTEGSDEKKSVKTVNQLAHALHMDKDLKAGCLVR-RDDLVLVDSPGLDSWIDKFCLDA---DVFVLVANSESTLMNTEKHFFHKVNEWLSKPNIFILNNRWDASASEPEDVRRQHMERCLHNALEAQNRIFFVSAKEV................................................................................................................................................................................................................................................... 288
43 -12.900[U] KOG0070 GTP-binding ADP-ribosylation factor Arf1  ali follow..  13  10.................................SRLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIP-------------------------------TIGFNVETVEYK------------NISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRDRVVEARDELHRMDELRDAVLLVFANKQDLPNAMNAAEITDKLG--LHSLRQRHWYIQSTCATSGEGLYEGLDWLSNNIA.................................................................................................................................................................................................................................... 178
44 -12.900[OK] COG0378 Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase  ali follow..  13  2......................................KRPLIIGVGGPVGAGKTMLIERLT----RYLSTKGYS-ITNDIYTKEDARILLNTSVLPADRIAGVETGGCPHTAIREDASMNFAAIEDLQLLFLESGGDNLSATFSPDLV---DFSIYIIDVAQGEKIPRKGGQGMIKS-------LFIINKVDLAPYVGANV--EVMKADTLKSR-GNKDFFVTNLKTDEGLKSVADWIEKRLQLALLE............................................................................................................................................................................................................................... 205
45 -12.500[R] KOG0395 Ras-related GTPase  ali follow..  13  1......................MMKTLSSGNCTLSVPAKNSYRMVVLGASRVGKSSIVSRFL---NGRFEDQYTPTI-----------------EDFHRKVYNIRGDMYQLD-------------------ILDTSGNHPFPAMRRLSILTGDVFILVFSLDN----RESFDEVQILEVKSCLKMVICGNKNDHGELCR-QVPTTEAELLVSGD---NCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEM............................................................................................................................................................................................................................... 196
46 -12.400[V] KOG1707 Predicted Ras related/Rac-GTP binding protein  ali follow..  14  5...............................VGDSSGSPKPIRIVVVGEKGSGKSSLIMAAARNTFHPNIPSLLPYTNLPSEFF----------------------------------------PDRIPATVIDTSSRPEDKGKVVKEVRQADAIVLTFAFDR----PETLDRLSKYWLPLFRQIIVAGYEVDNKEAYNHFSIEQITSALMKQY--EVETSIQWSAQRLDQAKDVLYYAQKAVIDPNNVLKPRCIAALKRIFLL................................................................................................................................................................................................................ 206
47 -11.600[R] KOG1673 Ras GTPases  ali follow..  14  102.........................................LKISLLGDCQTGKTTFVV--------KYVGDENQSFLEMTGLNLM------------DKTFYVQGVTISFS-------------------IWDVGGDEKRSKDHIPIAKDAVAILFMFDLTSRSTLNSVFGWYSQARKWNKTAIPILITKFDDFVRLPPNLQWTIVTQARAYAKVMNASLFFSSATHNINVNKIFKFILARL..................................................................................................................................................................................................................................... 266
48 -11.600[R] KOG1489 Predicted GTP-binding protein (ODN superfamily)  ali follow..  20  333..................................LFELKSIADLGLIGLPNAGKSTILNKISNAKPK--------------------------------------IGHWQFTTLSPTIGTVSLGFGQDVFTVADIPG-------IIQGASLSNGWVFVLDLSNKNPLNDLIEEVGTLEKVKTKNILIVCNKVDIDAKSESFAKYLQVEKFSKS---QEWDCVPISALREKT................................................................................................................................................................................................................................................. 499
49 -11.500[R] COG2262 GTPases  ali follow..  13  168...........RNRIVQIQSRLERVEKQREQGRQSRIKADVPTVSLVGYTNAGKSTLFNRITE---ARVYAADQLFATLDPTLRRIDV------------------------------------ADVGETVLADTVG---FIRHLLQETRQATLLLHVIDAADVRVQENIEAVNTVLEEIDAHETLLVMNKIDMLEDFEPRIDRDE----------NKPIRVWLSAQTGAGIPQLFQALTERL..................................................................................................................................................................................................................................... 361
50 -11.500[L] KOG1532 GTPase XAB1, interacts with DNA repair protein XPA  ali follow..  12  1MDPMESSSEQDIVEESQKLVDSLDKLRVSAASSSSNFKKKPIIIIVVGMAGSGKTSFLHRLVCVNLDPAVMSLPFGANIDIR-DTVKYKEVMKQYNLGPNGGILTSLNLFATKFDEVVSVIEKRADQLDYVLVDTPGQIEIFTWSASGAIITEVVTYVVDTSPITFMSNMLYACSILYKTRLPL-VLAFNKTDVADHKFALEWMEDFEVFQAAIFYRNIRSVGVSAISGAGMDGFFKAIEAS----AEEYMETYKADLDMR................................................................................................................................................................................................................... 298
51 -11.200[R] KOG1533 Predicted GTPase  ali follow..  12  2......QMNLNEKKQLLRVRVYATSEKGENLGSTHWTMYGVLVIGAPG---AGKSTFCAGLTDINLDPANDTMAYAPDVNITEMITVNDVMDRLGLGPNGALKYCIETLGANCN------QKIEANHKKYLIIDCPGSEGELWKVIRFLEKSGVRLCALHLADSLYCSDPSKFISTMVTMEMPQ-VNCLSKADLFSEDKYRKLNEAICGVISD--FDLVSFVPLAVENKESMMKVIQMVDAAN..................................................................................................................................................................................................................................... 281
52 -11.100[R] KOG0410 Predicted GTP binding protein  ali follow..  13  280...........RTQIGVLKKELESVRKHRKQYRSRRVAIPVPVVSLVGYTNAGKSTLLNQLTG--ANVLAENR---------FA------------------TLDPTTRRVQMQ-----------NGKEFLLTDTVG---FIQKLLEEIAESSLLVHVVDISHPLAEQQIEAVEKVMSELDVSSKLVVWNKVDRVDDPQKVKLEAE----------ETGDTICISALTGEGLDDFCNAVHEKL..................................................................................................................................................................................................................................... 472
53 -10.900[R] KOG2485 Conserved ATP/GTP binding protein  ali follow..  14  30.......................................................................................................................................PGHAAATRAIRNRLKLSDLVIEVRDAR----IPLSSANEDLQSQMSAKRRIIALNKKDLANPNVLNVIRFFKWT--RHFESSKQDCIAINAHSRSSVMKLLDLVELKLKEVIAREPTLLVMVV---------------------------GVPNVGKSALINSIHQIAAARFPVQERLKRATVGPLPGVTQDIAGFKIAHRPSIYVLDSPGVSIPDIETGLKLALSGSVKD.......................................................................................................... 231
54 -10.800[R] KOG0394 Ras-related GTPase  ali follow..  13  9.........................................LKVIILGDSGVGKTSLMNQYV---NKKFSNQYKATIGADFLTKEVQF------------------------------------DRLFTLQIWDTAGQERFQSLGVAFYRGADCCVLVYDVNSMKSFENLNNWREEFLIQASPSFVLIGNKVDVDDGNSRVVSEKKAKAWCASKG--NIPYFETSAKVGTNVEEAFQCIAKDA..................................................................................................................................................................................................................................... 176
55 -10.800[U] KOG0096 GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily  ali follow..  14  3...............................APAANGEVPTFKLVLVGDGGTGKTTFVKRHL---TGEFEKKYIATIGVEV----------------HPLSFYTNFGEIKFD-------------------VWDTAGQEKFGGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCENIPIVLCNKVDVKERKVKAKTITFHRK-------KNLQYYDISAKSNYNFEKPFLWLARKL..................................................................................................................................................................................................................................... 170
56 -10.800[U] KOG0092 GTPase Rab5/YPT51 and related small G protein superfamily GTPases  ali follow..  16  21.........................................FKLVLLGESAVGKSSLVLRFV-------KGQFHEFQESTIGAAFL------------TQTVCLDDTTVKFE-------------------IWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALNKADLANKRAVD--FQEAQSYADDN---SLLFMETSAKTSMNVNEIFMAIAKKL..................................................................................................................................................................................................................................... 181
57 -10.600[TU] KOG1954 Endocytosis/signaling protein EHD1  ali follow..  16  68..............LPLEEFHKFHDFHSPALDDPDFDAKPMILL--VGQYSTGKTTFIRYLLESDFPGIRIGPENALVVDAKKQFRALSGFGNAFLNRFQCSTL------------------PNQVLESVTIVDTPG-------ILSGAERVDRIILLFDAHK---LDISDEFKRCIEALA-DKIRIVLNKSDMVDHQQLMRVYGALMWSLGKV.................................................................................................................................................................................................................................................................. 277
58 -10.600[U] KOG3887 Predicted small GTPase involved in nuclear protein import  ali follow..  14  55.................................DPFSTEVKPRILLMGLRRSGKSSIQKVV---------HKMSPNETLFLE--------------------TNKICREDVSNSSFV-----------NFQIWDFPGQIDFFDPTFD--RGTGALIFVIDSQDDYMEALARLHLTVTRAYKVNNFEVFIHKVDGLSDDHKIETQRDIHQRANDDLADAG-SFYLTSIYDHSIFEAFSKVVQKL..................................................................................................................................................................................................................................... 237
59 -10.200[U] KOG0094 GTPase Rab6/YPT6/Ryh1, small G protein superfamily  ali follow..  16  10.........................................YKLVFLGDQSVGKTSIITRFM---YDKFDTTYQATIGIDF----------------LSKTMYLEDRTVRLQ-------------------LWDTAGQERFRSLIPSYIRDSSVAVVVYDVANRLSFLNTSKWIEEVRNERAGDVIIVLNKTDLVEKRQVS--IEEGDSKGREY---GVMFIETSAKAGFNIKPLFRKIAAAL..................................................................................................................................................................................................................................... 170
60 -10.000[R] KOG0088 GTPase Rab21, small G protein superfamily  ali follow..  20  13.........................................FKIVLLGEGCVGKSSLVLRFV---ENKFSCKHLSTIQASFQNKTVNV------------------------------------DCQADLHIWDTAGQEKYHALGPIYYRGSNGVLLVFDITDRKSFEKVKNWVLEIKTCLGNTAEILINKIDLEEERQVT--RQDAEAYAESE---GALYMETSAQDNVGISDAFESLTAKM..................................................................................................................................................................................................................................... 173
61 -10.000[K] KOG1534 Putative transcription factor FET5  ali follow..  12  7.........................................FVCGVAS---SGKSTFCGALMSVNLDPAAENFEWEPTVDIRDLISIDDVMEELDYGPNGGLIYCFEFLMENLDWLNEEIG---DYDEDYLIFDMPGQIELLIRHLQVTLNFRPCAVYLLESQFLVDRTKFFAGVLSAMSAMVMMINLLSKMDLLKDNKFHELNRCIVQLIDDFNM--VNFLPLESGNEESVSRVLSYIDDATQ.................................................................................................................................................................................................................................... 254
62 -9.960[T] KOG4252 GTP-binding protein  ali follow..  17  10.........................................IKMVVVGNGAVGKSSMIQRYC---KGIFTKDYKKTIGVDFLERQIQV------------------------------------DEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRGSFEAVSSWREKVVAEVGDIPTVLVNKIDLLDDSCIK--NEEAEALAKRL---RLRFYRTSVKEDLNVNEVFKYLAEKY..................................................................................................................................................................................................................................... 169
63 -9.950[U] KOG0086 GTPase Rab4, small G protein superfamily  ali follow..  18  9.........................................FKFLVIGSAGTGKSCLLHQFI---ENKFKQDSNHTIGVEFGSRVVNV------------------------------------GKTVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNSLAAWLTDARTLASPNIVVILNKKDLDPEREVT--FLEASRFAQE---NELMFLETSALTGENVEEAFLKCARTI..................................................................................................................................................................................................................................... 169
64 -9.850[U] KOG0097 GTPase Rab14, small G protein superfamily  ali follow..  18  1..............................MATAPYNYSYIFKYIIIGDMGVGKSCLLHQFT---EKKFMADCPHTIGVEFGTRIIEV------------------------------------GQKIKLQIWDTAGQERFRAVTRSYYRGAAGALMVYDITRRSTYNHLSSWLTDARNLTNPNTVIILNKADLEAQRDVT--YEEAKQFAEE---NGLLFLEASAKTGENVEDAFLEAAKKI..................................................................................................................................................................................................................................... 172
65 -9.790[U] KOG0095 GTPase Rab30, small G protein superfamily  ali follow..  17  10.........................................FKIVLIGNAGVGKTCLVRRFT---QGLFPPGQGATIGVGFMIKTVEI------------------------------------GEKVKLQIWDTAGQERFRSITQSYYRSANALILTYDITCEESFRCLPEWLREIEQYASNKVITVLNKIDLAERREVS--QQRAEEFSEAQ---DMYYLETSAKESDNVEKLFLDLACRL..................................................................................................................................................................................................................................... 170
66 -9.740[R] KOG0091 GTPase Rab39, small G protein superfamily  ali follow..  12  10.........................................FRLILIGDSTVGKSSLLKFFT---DGKFAELSDPTVGVDFFARLIEM----------KDGTQI------------------------KLQLWDTAGQERFRSITKSYYRNSVGVLLVYDISNHASFEHIPLWMMEAQRHIEPHRPVFACKLDLINAGGHREVTTEEAQKFAKQ--HGLHFVETSARSGANVEEAFRMVTQEV..................................................................................................................................................................................................................................... 175
67 -9.720[U] KOG0081 GTPase Rab27, small G protein superfamily  ali follow..  16  10.........................................IKFLALGDSGVGKTSVLYQYTD----------------------------GKFNSKFITTVGIDFREKRVVYRASGPDGATGRGQRIHLQLWDTAGQERFRSLTTAFFRDAMGFLLLFDLTNEQSFLNVRNWISQLQMHAYCENPDIVNKSDLEDQRVVK--EEEAIALAEKY---GIPYFETSAANGTNISQAIEMLLDLI..................................................................................................................................................................................................................................... 181
68 -9.690[U] KOG0098 GTPase Rab2, small G protein superfamily  ali follow..  20  7.........................................FKYIIIGDTGVGKSCLLLQFT---DKRFQPVHDLTIGVEFGARMVTI------------------------------------GKQIKLQIWDTAGQESFRSITRSYYRGAAGALLVYDITRRDTFNHLTSWLEDARQHSNSNMVIMLNKSDLEARREVK--REEGEAFARE---HGLVFMETSAKTAANVEEAFIDTAKEI..................................................................................................................................................................................................................................... 167
69 -9.660[U] KOG0087 GTPase Rab11/YPT3, small G protein superfamily  ali follow..  19  11.........................................FKTVLIGDSGVGKSNLLMRFT---RNEFNIESKSTIGVEFATRNIVL------------------------------------NKKIKAQIWDTAGQERYRAITSAYYRGAVGALIVYDITKQSSFDNVGRWLKELREHADSNIVIMLNKTDLLHLRAVS--TEEAQAFAAE---NNLSFIETSAMDASNVEEAFQTVLTEI..................................................................................................................................................................................................................................... 171
70 -9.630[DZ] COG5019 Septin family protein  ali follow..  12  83............................NQWHRRCVRQGFNFNVLVLGESGSGKSTLVNTLLNRDVYPPTQKSLT----------------GDFGVNPEPTVMINSSAVEIV----------ENGISLQLNVIDTPGFGDFIDNTDCWQPVLTDI--YLELEKHNTIQDPRVHACIISAMELRNIIPIIAKADTLTDDELNFTKEMILRDIQYHNIRIFFPPTYETDDPESVAENADIMSRIPF-----------------AIIAS-NTFVVNNEGKRVRGRRYPGVVEVDNE................................................................................................................................................................................... 329
71 -9.610[TU] KOG0084 GTPase Rab1/YPT1, small G protein superfamily, and related GTP-binding proteins  ali follow..  15  9.........................................FKLLLIGDSGVGKSCLLLRFA---DDSYLDSYISTIGVDFKIRTVEQ------------------------------------GKTIKLQIWDTAGQERFRTITSSYYRGAHGIIVTYDVTDLESFNNVKQWLNEIDRYASENVNKLLNKCDLTSQKVVS--TETAKAFADEL---GIPFLETSAKNATNVEEAFMAMTAAI..................................................................................................................................................................................................................................... 169
72 -9.600[U] KOG0093 GTPase Rab3, small G protein superfamily  ali follow..  15  23.........................................FKILIIGNSSVGKTSFLFRYA---DDSFTPAFVSTVGIDFKVKTIYR------------------------------------DKRIKLQIWDTAGQERYRTITTAYYRGAMGFILMYDITNEESFNAVQDWSTQIKTYSWDNAQVLLNKCDMEDERVVS--SERGRQLADHL---GFEFFEASAKDNINVKQTFERLVDVI..................................................................................................................................................................................................................................... 183
73 -9.590[R] KOG0080 GTPase Rab18, small G protein superfamily  ali follow..  16  9.........................................LKILIIGESGVGKSSLLLRFT---DDTFDPELAATIGVDFKVKTISV------------------------------------GNKAKLAIWDTAGQERFRTLTPSYYRGAQGVILVYDVTRRDTFVKLDNWLNELETYCTRNDIVNMNKIDKENREVDRNEGLKFAR-------HSMLFIEASAKTCDGVQCAFEELVEKI..................................................................................................................................................................................................................................... 169
74 -9.480[R] COG1163 Predicted GTPase  ali follow..  15  60...................................VARTGVASVGFVGFPSVGKSTLLSKLTGTESE----------------------------------------AAEYEFTTLVTVPGVIRYKGAKIQMLDLPG-RGRGKQVIAVARTCNLLFIILDVNKPLHHKQIKELEGVGIRLNKTPPDILIKKKEKGGISITNTVNDEIRAVMSEYRINSAEIAFRCDATVDDLIDVLE........................................................................................................................................................................................................................................... 236
75 -9.410[TU] KOG0078 GTP-binding protein SEC4, small G protein superfamily, and related Ras family GTP-binding proteins  ali follow..  18  10.........................................IKLLLIGDSGVGKSCLLLRFS---EDSFTPSFITTIGIDFKIRTIEL------------------------------------GKRIKLQIWDTAGQERFRTITTAYYRGAMGILLLYDVTDKKSFDNVRTWFSNVEQHASENVYKILNKCDCEDQRQVS--FEQGQALADEL---GVKFLEASAKTNVNVDEAFFTLAREI..................................................................................................................................................................................................................................... 170

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 5 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Harder T, Godzik A. JAFA: a protein function annotation meta-server. Nucleic Acids Res. 2006 Jul 1;34(Web Server issue):W379-81.