current user: public

If you have questions about the server, please let us know.

Query: [F] KOG0707 Guanylate kinase, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .
# Score Template Links and tools%idFirst MGEAPAVLVDHPENGHSNGVCVKSEPENTEITVDVGDRIFLIGGTHERNNFSIGVQIYDKISNNWFSPIVLGTGPKPSKGYSAFVLEQGRILVIKKGSPRNDSIWFLEVDSPYVREQKKLLRKEVVAWSKGVRGNAEKPIVISGPSGVGKGTLISMLMKEFPSMFGFSVSHTTRSPRSMEMDGVHYHFADKKVMEKEIKDGKFLEFASVHGNLYGTSIESVEAVTDSGKRCILDIDVQGARSVRASSLDAIFIFVCPPSMKELEDRLRARGTETEEQIQKRLRNAEAEIKEGISSGIFGLILYNDNLEECYKKLKVNHLLLIAQNVVMFLast
1 -111.000[F] KOG0707 Guanylate kinase  ali  100  1MGEAPAVLVDHPENGHSNGVCVKSEPENTEITVDVGDRIFLIGGTHERNNFSIGVQIYDKISNNWFSPIVLGTGPKPSKGYSAFVLEQGRILVIKKGSPRNDSIWFLEVDSPYVREQKKLLRKEVVAWSKGVRGNAEKPIVISGPSGVGKGTLISMLMKEFPSMFGFSVSHTTRSPRSMEMDGVHYHFADKKVMEKEIKDGKFLEFASVHGNLYGTSIESVEAVTDSGKRCILDIDVQGARSVRASSLDAIFIFVCPPSMKELEDRLRARGTETEEQIQKRLRNAEAEIKEGISSGIFGLILYNDNLEECYKKLKVNHLLLIAQNVVMF 329
2 -82.700[T] KOG0609 Calcium/calmodulin-dependent serine protein kinase/membrane-associated guanylate kinase  ali follow..  24  218....................GKKLTCYMRALFTYNPSEDSLLPCRDIGLPFKSGLQIINVKDPNWWQAKNITAESDKIGLIPSQELEERRKAFVAPESKRKRKTMYRSVANCEFDKAELLLYEEVTRMPP----FRRKTLVLIGVSGVGRRTLKNRLINSDVDKFGAVIPHTSRPKRALEENGSSYWFMDREEMEEAVRNNEFLEYGEHNGNLYGTHLQSIKDVINSGRMCILDCAPNALKILHNSELMPFVIFVAAPGMEQLKTIYADRATGSNRNLSATLVALLDLCLQRKYEKYFDMVIVNEDFDETFRQVVETLDQMEEQWVPV. 572
3 -71.000[F] COG0194 Guanylate kinase  ali follow..  40  42.....................................................................................................................................KERGLLIVLSGPSGVGKGTVRQAIFSQEDTKFEYSISVTTRSPREGEVNGVDYFFKTRDEFEQMIADNKLLEWAEYVGNYYGTPVDYVEQTLQDGKDVFLEIEVQGALQVRNAFPEGLFIFLAPPSLSELKNRIVTRGTETDALIENRMKAAKAEIEMMDA---YDYVVENDNVETACDKIKAIVLAEHLK..... 229
4 -53.700[PT] KOG3812 L-type voltage-dependent Ca2+ channel, beta subunit  ali follow..  15  36RESARREVESQAQQQLERAKHKPEAFAVRTNVSYCGVLDEECPVQGSGVNFEAKLHIKEKYSNDWWIGRLVKEGGD-IAFIPSPQRLESIRLKQEQKARNRRSPPPSLAKQKQKQAEHVPPYDVVPSM---------RPVVLVGPSLKGTDMMQKALFDFLKHRFDGRISITRVTA---------DLSLAKRSVLNNPGKRTIIERSSARSAEVQSEIERIFELAKSLQLVVLDADTNHPAQLAKTSLAPIIVFVKVSSPKVLQRLIRSRGKSQMKH--LTVQMAYDKLVQ-CPPESFDVILDENQLEDACELLAEYLEVYWRA..... 357
5 -52.800[P] COG3709 Uncharacterized component of phosphonate metabolism  ali follow..  19  7................................................................................................................................DSRRTLSPGTMIVIVGPSGAGKDTLMDYAAAQLSGRFHFTRRVITRS---CDAGGENHDAVSMHEFNQLEDAGAFAVSWQAHGLKYGIPAA-VYRHLEAGDVVIANGSRSALPHFGTAFSR-LKVVNIVARPDVLARRLEQRGRESRDDILRRLERSSLAVAGD-----FDVTTVDNSIEDAGKTIMQVLQQSAGSSQP.. 199
6 -34.600[F] KOG0708 Membrane-associated guanylate kinase MAGUK (contains PDZ, SH3, HOOK and GUK domains)  ali follow..  13  315VEEVYVEMLKPRDGVRLKVQYRPEEKGLPGDSFYIRALYDRLADVEQELSFKKDLYVDDQGTFGSWMAWQLDEQKIQRGQIPSKYVMDQEFSRRLSMSEVKDLDAFSSDSIPLFEDSVSLAYQRVQKVDCTAL----RPVLILGP----LDVVKEMLVNEAPGKFCRCPL--------------EVMKASQQAIERGVKDCLFVDYKRRSGHFDVTTVASIXEITEKNRHCLLDIAPHAIERLHHMHIYPIVIFIHYKSAKHIKEPIYLRDKVTQRHSKEQFEAAQK--LEQEYSRYFTGVIQGGALSSICTQILAMVNQEQNKWIPA. 671
7 -22.100[V] COG3896 Chloramphenicol 3-O-phosphotransferase  ali follow..  12  13..............................................................................................................................RLAAMAGMPEGKLILLNGGSSAGKTSLALAFQDLAAECMHIGIDLFWFALPPEQLDLARVYYTWDSAVEADGLEWFTVHPGPILDLAMHSRYRAIRAYLDNGMNVIADDVIWTREWLVDEGCRVWMVGVHVS-DEEGARRELERGDRHPGWNRGSARAAHADAE-------YDFELDTTATHELARELHESYQA......... 209
8 -17.700[G] COG2074 2-phosphoglycerate kinase  ali follow..  10  2..................................................IMVQGEVSGKKYTEPFSKGVLARSLTRAEMDPNRAYTRIEAHLKKNKVDLITIEELVEIVSEHLRKEDPEVAEKYMLWRKIRQCKEPLIILIGGASGVGTSSIAFEVANRL-GIRNMISTDMIREVMRKIVSRELLPSIYESSYTPPELDEVLIGFRDHVESVSIGVEAVIERALTEGISIVIEIVPGFIREDLVNKENVAMFVLTVSDENVHKGRFYSRCRRPLKRYISYFWAIRHRYIENQARKHGVPVIENIDVVTTIDSIIKSLTKTTVKGGE.. 299
9 -16.200[S] COG4185 Uncharacterized protein conserved in bacteria  ali follow..  1.............................................................................................................................MSIVRLKKLEQPVFLIVAGPNGSGKSSVYANADL--------------------ELEGRSVWIVNPDLLAGRISEVENKPLPEANLVAVQRIEAWIQSSISVHKTIGVETVLSTVEAAEAVGFAIWLFYTVLDSPERSIERIKLRVAKPADKVRARYARSLDQLPWFL--ERADRAWIWDNSGATPKLIGEK............ 181
10 -15.700[R] COG0645 Predicted kinase  ali follow..  11  1........................................................................................................................................RFLAVTHGVSAVGKSQVAMRLVEALGAVR------------RSDIERKRLFGEQPEHDRGQFAAGIYSS--QASEATYAHLHQLAAKILQAGYPVVIDAA-QAACHIAEETGVPFLILDCQAPEAVIAGWLAQRGKDPSDATLDVIRTQQATREPLTAAETVQSKRVDTHDAASLDGLVDGIRQRLPG..... 184
11 -14.400[F] COG2019 Archaeal adenylate kinase  ali follow..  12  3...........................................................................................................................................SVITGVAGVGKTTVLDIVARE-----------------------SGIPVVNYGTLMFEVAKRRGLQIRKLSRETQVDLQKLAGEEIGKMENAIVD-YLPGLPEWVLRSINASVFVIIEADPAIIKRRRRARDDEGVDSIREHQEMNRYFAAAYSIFSGATVKIVKNKPEQAADEIVRVIK.......... 181
12 -13.600[R] COG4639 Predicted kinase  ali follow..  10  3...................................................................................................................................ITIPELSLVVLIGASGAGKSTFARKHFQ-------------------------PFEVISSDFCRGLVSNDENSQSAS--RDAFDVLHYITTKRLAAGKLTVID---TLLQMAKQYHCFTVAIVFDLPEELCHERNQQRSDRQFGSHVVRRHTQMLRRSLRSLEKEGFRYVYTPEEIANVAIELQPLWNNKKHE..... 178
13 -12.800[F] KOG3347 Predicted nucleotide kinase/nuclear protein involved oxidative stress response  ali follow..  15  6...........................................................................................................................................ILLTGTPGVGKTTLGKELASK-----------------------SGLKYINVGDLAR--EEQLYDGYDEEYDCPILDEDRVVDELDNQMREGGVIVDYHGCDFFPERWFHIVFVLRTDT--NVLYERLETRGYNEKDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQ...... 165
14 -12.700[F] COG4088 Predicted nucleotide kinase  ali follow..  12  3..........................................................................................................................................LIIVSGYPSSGKTTRSNELKKALEDRIHQNI-------------------DNTKDYRVIIINDESLN-SKNEKAARGLLYSAVQRELSKSTFVICD---QLYCESKSMYTTHCVIHVAVP-QDLCRKFNSNKEQPYPDDVLEQLMFRYEEPNGMTRWDSPLFTVLHDDASCPIDDIWSVL........... 176
15 -12.600[F] KOG3079 Uridylate kinase/adenylate kinase  ali follow..  17  34.......................................................................................................................................KPLVVFVLGGPGAGKGTQCARIVEKY-GYTHLSAGELLRDKNPDSQYG--------ELIEKYIKEGKIVP-VEITISLLKREMDQTMAANAQKNKFLID-NLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKDNRESLEKRIQTYLQSIDLYEEMGKVKKIDASKSVDEVFDEVVQIFDK......... 226
16 -12.300[F] COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases)  ali follow..  18  3...........................................................................................................................................IAITGTPGVGKTTVAKLLAKK-----------------------LNYEYVSLKDF---ALEKGCGRRVNDEVEVEIDELAYFIERELKGKNAVLDGHLSHLMPVD-------LVVVLRAHPKLIGERLRERGY-DREKIGENVEAELVDAVLIEAIEEHENVIEVDTTNKSPEDVVEEIVSLINSGIK.. 156
17 -12.300[F] COG1428 Deoxynucleoside kinases  ali follow..  12  1...................................................................................................................................MEGVGNKVIVLAGMIGAGKSSYTELIANELGTKAFYELEMFYDDPKRWAFALQIYFLNTRFRSIKAALTDNVLDRSIYEDALFTQINFEEGNISEPEMDTYLDLLDNMMEELAYMKKAPDLLIYLRGSLDTVLSRISLRGRPYEQTFDNPGLLDYYKHLHSRYDSWFDTLVINSDAKYVMQLIHEKLKR......... 214
18 -12.100[R] COG3911 Predicted ATPase  ali follow..  11  1...................................................................................................................................MQNDFDRVFVLTGGPGSGKTTLIAAL----RRAGFATSVVAGRG-------------IVRDQSSIGGTALPWSDRTLFAELMLSWEMRSYQNAVEQKGPVFFDRGVPETTAAKRFRYNPRVFIAPPWPDIFAQDEERKQTPDEAKCTYHALAEIYTELGYE-------VPLPLAPVETRLRFVLADAGL......... 182
19 -11.900[G] COG3265 Gluconate kinase  ali follow..  12  2.......................................................................................................................................SGKCIIVMGVSGTGKSCVGQALALA-----------------------LGAKFIDGDDLHPRANIQKMAAGQPLNDQWLERLSDVAYSLQQKNEVGFLVCS----DRLREGNEGIRFLWLTG-DYDLVLHRMQQR---AGHFMPESLLKSQFATLEAPGSDEPDVIPIDISIADVVEHCIAALSLENHV..... 172
20 -11.400[F] COG1102 Cytidylate kinase  ali follow..  16  2.....................................................................................................................................PKGCLVITVSGLAGSGTTTLCRNLAKH-----------------------YGFKHVYAGLIERGMSLEEFQKYAELHPEIDREVDRRQVEAAKECNVVI-----EGRLAGWMVKNADLKIWLDAPIRVRAERVAKREGISVEEAFMKIAEREMQNRKRYLNLSIYDLIIDTSKWEGVFAIVKAAIDHLYEK..... 180
21 -11.400[F] COG0563 Adenylate kinase and related kinases  ali follow..  16  3...........................................................................................................................................LILMGLPGAGKGTQAEKIIEKYGDMFRAAMKNETELGLKAKSYMDAGELVPDEVTIGIVRDNGFLLDGFPRTVAQAEALEDILASLDKKLDYVINIDVPEQLLMDRLT-RTYHVIFNPPKVEGI-SELIQRDDDKPETVKKRLEVNQKQIDFYSEKGYLQNINGDQDISRVFEDINELLKGLSS...... 217
22 -11.300[F] KOG3078 Adenylate kinase  ali follow..  13  7................................................................................................................................AAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRIT-RSYHEEFNPPKEPMK-EPLIRRSDDNEKALKIRLQAYHTQIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATS...... 232
23 -11.200[F] COG1618 Predicted nucleotide kinase  ali follow..  13  1...............................................................................................................................MRIEGKEKTMLRIAVTGSPGVGKSTVVAKTAEKLAEKPGFKIGRTAEIRKEGHREGFSIRDLATGKAVRNALACDLVEIGPMELISQS--VSAVEEVLESDKPVLAVLHHSSRHPLAQRFRKGFEVLVDKGNRDELPEKIT-------NRFLRKLG.............................................. 184
24 -10.800[H] COG3172 Predicted ATPase/kinase involved in NAD metabolism  ali follow..  12  1.................................................................................................................................TEVKPFFVRTVAILGGESSGKSTLVNKLANIFNWEYGRDYVFSHLGGDEIALQYSDYDKIALGHAQYIFIDTDFVTTQAFCKKYEGREHPFVQALIDEYR----------------------LVILLENNTPWVADGLRSLGSSVDKEFQNLLVEMLEENNIE-------VRVEEEDYDSRFLRCVELVREMMGE..... 185
25 -10.800[C] KOG3877 NADH:ubiquinone oxidoreductase, NDUFA10/42kDa subunit  ali follow..  12  59.................................................................................................................YKTKKYSVFNAIFDKTSKRFDENSKVICVEGPIAAGKSKFAKELAEELDLIYINSYGYDMRKLDPQLPPSCRSYDVRN--CLDPSHDLAAQFQIRMYMLRYSQYIDALQHVLSTGQGVVLERSPYS-QNTIGELLKPHLVIYLDLPVDAVKKQIKARNVDYEVQSKSDLEQLYKQQYLKDISTHAELLIYDWTAGGETEVVVEDIERIDFN..... 310
26 -10.700[F] KOG3308 Uncharacterized protein of the uridine kinase family  ali follow..  13  2.....................................................................................................................................TRKTIIVGVSGASCSGKSTLCQLLHAIFEGSSLVHEDDFYKTDAEIPVKNGIADWDCQESLNHYIRDHGVLPTHLRNRENKNVAPEALAIPTLEQHLVFVD----GFMMYVNEDLINAFLMLVTDFDTLKRRREARTGYITLEGFWQDPPHYFENYVWPGYVHGHSHLFVNGDVT..................... 196
27 -10.700[R] KOG3062 RNA polymerase II elongator associated protein  ali follow..  11  3..........................................................................................................................................LVVITGLPASGKSTRARQLRDH-------------------VERGRKVHLISENEAKAGFGKNSHTGDSQKEKVVRSDLKSEASRHLNQEDLVILDYRYELYCMSKVSRTTQCTVFTCIP-QEEAWTFNSQRTAPDELPGDSERVQPVDNSDVPYTRETFDALCQRYEEPQSNNRWDSPLVVVLPK..... 178
28 -10.600[FH] KOG2702 Predicted panthothenate kinase/uridine kinase-related protein  ali follow..  14  99.............................................................................................................DGSCMDEIYDKLAERLVPTAAAMFSPNLKRLVLAGPPGAGKSTVANEVVRRVNKLWPQKAASFDAEVNPPDMDG--FHLYRSQNCLKKLKNEGSVYVPSFDHGVGDPVEDDI-FVSLQHKVVIVELEEGSWKDISDM----EKWFIDVNL-DTAMQRVENRHISTGKPPDVAKWRVDYNDR-IKSKTNADLLIRSMNI...................... 333
29 -10.600[F] COG0572 Uridine kinase  ali follow..  19  4....................................................................................................................................KAHQCVIIGIAGASASGKSLIASTLYRELREVIPEDGYYKDQSHLSMEERV-KTNYDHPSAMDQALKAGKPVELPLYS---YTEHTRKKETVHLEPKKVII---LEGILLLTDIRLRQEMIFVDTPLDICLMRRMKRDVNERGRSMDSVMAQYQKTVRPMFLQFIEDIIVPRGKNRIAIDILKAKISQF........ 211
30 -10.500[TZ] KOG4203 Armadillo/beta-Catenin/plakoglobin  ali follow..  16  61....................................................................................................................................KNDGLILVGLAGPSGAGKTIFTEKILNFMPSIAIINMDNYNDGTRVIDGNFDDPRLTDYDTLLDNIHDGKPVQVPIYD---FKSSSRIGYRTLEVPSSRIVILEGIYALSEKLRPLLDLRVSVTGGVHFDLVKRVQRAGQEPEEIIHQISETVYPMYKAFIEPDL-QIKILNKFNPFSGFQNPTYILKSSKA..... 258
31 -10.500[R] KOG2486 Predicted GTPase  ali follow..  138...........................................................................................................................................FALVGRSNVGKSSLLNSLVRRK------RLALTSKKP--GKTQCINHFRINDKWYLVDLPGYGYASAPHELKQDWNKFTKDYFLNRSTLVSVFLLVDASIPVKPIDLEYASWLGQNQVPMTLIFTKCDKRKKKKNGGKKPEANIKEFQDLIQGFFETTPPWIMTSSVTNQGRDEILLHMAQLRNYWLK.. 317
32 -10.300[G] KOG3354 Gluconate kinase  ali follow..  10  7.................................................................................................................................NPTNQPYKYVFVVIGPAGSGKTTMAKAVSEKLGFEYIEGDDLHPKANIEKMSQGHPLNDNDRWGWLHNCGGACAMELDKESIKGVVLTCSALKRSYRD------------RSSLEHRPAILRFIYLAASR-ETLIKRTTSR---KNHYMKADMVESQLAILEAPTADEKDVITISNGKEQSEEECLDIVHKMVNE..... 189
33 -9.990[F] COG0125 Thymidylate kinase  ali follow..  12  2.......................................................................................................................................SGLFITFEGPEGAGKTTVLQEIKNILTAEGLQVM--ATREPGGIDIAEQIREVILNENNILMDPKTEALLYAAARRQHL---VEKVKPALEQGFIVLCDLAYQGINEFAIGDMMPHVTVYFSIDPEEGLKRIYANGSREKNRLDTKVQEGYQELMK-RFPERFHSVDAGQSKDLVVQDVLKVIDEALKK..... 209
34 -9.860[R] COG3596 Predicted GTPase  ali follow..  13  24..........................................................................................................................SERILQQINQLTHYEPVIGIMGKTGAGKSSLCNALFAGEVSPVS-DVAACTRDPLRFQIGEHFMTIVDLP-----VGESGVRDTEYAALYREQLPRLDLILWLIKADDRALATDEHFYRQVIGEAYRHKMLFV----ISQSDKAEPTSGGNILSTEQKQNISRKICLLHELFQPVHPVCAVSVRLQWGLRVMAERMIKCLPR..... 218
35 -9.640[H] KOG3220 Similar to bacterial dephospho-CoA kinase  ali follow..  14  3..........................................................................................................................................IVAVTGGIATGKSTISKVFER-----QGIPVIDADKIAREIVEPGQPCWRQIREVFDEVLLPSKEINRAVLGKMIFEELRGKLNKITTGHAWIVLDLPLLFETGVLMDFIHKIVCVTCDSDKQL--ERLIARNELSESEARHRVD---SQMPLDKKCEKSHFVIDNNSVEEAESSAMSIYNLMRD...... 198
36 -9.480[J] KOG1384 tRNA delta(2)-isopentenylpyrophosphate transferase  ali follow..  16  2.........................................................................TELNFHLLPIISDRFTTTTTTSPSFSSHSSSSSSLLSFTKRRRKHQPLVSSIRMEQSRSRNRKDKVVVILGATGAGKSRLSSEIINSDKIQVYEGLEITTNQITLQDRRGVPHHLLG-NPEHGELTAGEFRSAAS----------NVVKEITSRQKVPIIDPFSSGSCLISSDLRYECCFIWVDVSETVLYEYLLRR----DEMMDSGMFEELSRFYDPVKSGL-WDALRKAAYDKAVDDIKRNTWTLAKRQVKKI 302
37 -9.380[C] COG3954 Phosphoribulokinase  ali follow..  14  2.....................................................................................................................................SAKHPVIAVTGSSGAGTTTTSLAFRKEGDSFHRYTRPEMDMAIRKARDAGRHISYFGPEANDFSLLEHEYGQTGKGQSRKYL-TFTPWQPLPEPTDVLFYEGVVTPQHDVARHV---LLVGVVPIVNLEWIQKLIRRGHSREAVMDSVVRSMDDYINYITPQFSRTHINFQ......................... 206
38 -9.330[R] COG2229 Predicted GTPase  ali follow..  16  6...........................................................................................................................................IIFTGPVGVGKTTAIAAISDEALVQTDASASDMTLDRKRNTTVAMDYGAISLDEDTKV--------------HLYGTPGQERFNFMSMGLVLLLDNARTNPLKDLEFFLHSFRGLLEKAPVVVGITKMDIRSQPGIDVYHKYLAKHNLNVPVFEIDAR------EDDVKQLVSAMLFSID.......... 173
39 -9.310[R] COG0218 Predicted GTPase  ali follow..  12  28...........................................................................................................................................IALAGRSNVGKSSFINTMLNRK------NLARTSGKP--GKTQLLNFFNIDDKMRFVDVPGYGYARVSKKEREKWGCMIEEYLTTRENLRAVVSLVDLRDVQMYEFLKYYEIPVIIVATKADKIPR----------GKWNKHESAIKKKLNFDPSD---DFILFSSVSKAGMDEAWDAILEK........ 194
40 -9.080[R] COG4136 ABC-type uncharacterized transport system, ATPase component  ali follow..  12  25......................................................................................................................................DKGDIVTLMGPSGCGKSTLFSWMIEQFSCTGELWLNEQRIDILPTAQRQIGILFQDALLFDQFSVGQNLL---------LALPATLKGNARRNAVNDALERTLSGGQRARVALLRAL---LAQPKALLLDEPFSRLDVALRDNFRQWVFSEVRALA-------IPVVQVTHDLQDVPA................. 199
41 -9.040[I] KOG0064 Peroxisomal long-chain acyl-CoA transporter, ABC superfamily  ali follow..  11  517..........................................................................................................................CDIVVPKLTLCIEPGVHLLITGPNGCGKSSLFRIL----SGLWPIYAGELHIPRPVKDVPCMFY-----------IPQRPYMSIGSLCDQIYPDTREDMKRKHITENELRSILKMVSLEHIEKQRMAIARLFYHRPRYALLDECTSAVSIDVESSIYEIAKGMGITLLTITHRKYHTHILFDGLGNWQFRKMNSDEEQKGQF..... 728

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.