current user: public

If you have questions about the server, please let us know.

Query: [O] KOG0714 Molecular chaperone (DnaJ superfamily), from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .
# Score Template Links and tools%idFirst MGVDFYKVLEVDRSANDDELKKAYRKLAMKWHPDKNPNNKKEAEAKFKQISEAYDVLSDPQKRAIYEQYGEEGLNQAPPPGAGGGYPGGSDAGASFRFNPRSADDIFSEFFGFTRPSFGTGSDSRAGPSGFRYGDDIFASFRAATTGGEASIPSRKSAPIERQLPCSLEDLYKGVSKKMKISRDVLDSSGRPTPVEEILTIEIKPGWKKGTKITFLEKGNEHRGVIPSDLVFIVDEKPHPVFKRDGNDLVVMQKISLVDALTGYTAQVTTLDGRTLTVPVNNVISPSYEEVVKGEGMPIPKDPSRKGNLRIRFIIKFPSKLTTEQKSGIKRMLSPLast
1 -137.000[O] KOG0714 Molecular chaperone (DnaJ superfamily)  ali  100  1MGVDFYKVLEVDRSANDDELKKAYRKLAMKWHPDKNPNNKKEAEAKFKQISEAYDVLSDPQKRAIYEQYGEEGLNQAPPPGAGGGYPGGSDAGASFRFNPRSADDIFSEFFGFTRPSFGTGSDSRAGPSGFRYGDDIFASFRAATTGGEASIPSRKSAPIERQLPCSLEDLYKGVSKKMKISRDVLDSSGRPTPVEEILTIEIKPGWKKGTKITFLEKGNEHRGVIPSDLVFIVDEKPHPVFKRDGNDLVVMQKISLVDALTGYTAQVTTLDGRTLTVPVNNVISPSYEEVVKGEGMPIPKDPSRKGNLRIRFIIKFPSKLTTEQKSGIKRMLSP 335
2 -95.500[O] COG2214 DnaJ-class molecular chaperone  ali follow..  26  4..KDYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSKE--PDAEARFKEVAEAWEVLSDEQRRAEYDQMWQHRNDPQFNRQFHH--------GDGQSFNAEDFDDIFSSIFGQHA-------------------------------RQSRQRPATRGHDIEIEVAVFLEETLTEHKRTISYNLPVYNAFGMEQEIPKTLNVKIPAGVGNGQRIRLKGQGTPGENGGPGDLWLVIHIAPHPLFDIVGQDLEIVVPVSPWEAALGAKVTVPTLKES-ILLTIPPGSQAGQRLRVKGKGLV---SKKQTGDLYAVLKIVMPPKPDENTAALWQQLAD. 292
3 -91.400[O] COG0484 DnaJ-class molecular chaperone with C-terminal Zn finger domain  ali follow..  28  4..QDFYATLGVARTATDDEIKKAYRKLAMKYHPDRNPDNK-EAEEKFKEVQKAYETLSDKEKRAMYDQYGHAAFEGGGQGGFGGFGGFGGGGGSGRAQPDYQGEDVLEEAAKGVKKRINIPTYEACDVCNGSGAKPGTSPETCPTCKGSGTVHIQQ----AIFRMQQTCPTCHGAGKHIKEPCVKCRGAGRN-KAVKTVEVNIPAGIDDGQRIRLSGEGGPGMGAPAGDLYVTVRIRAHKIFQRDGLDLHCELPISFATAALGGELEVPTLDGK-VKLTVPKETQTGRRMRVKGKGVKSLRSSA-TGDLYCHIVVETPVNLTDRQKELLEEFER. 349
4 -90.500[O] KOG0715 Molecular chaperone (DnaJ superfamily)  ali follow..  22  46.ARNYYDVLGVSPKATREEIKKSFHELAKKFHPDTNRNN-PSAKRKFQEIREAYETLGNSERREEYDKLQYRNSDYVNNDGGDSESDTFHKIFSEIFENNQIKPDILSEAAEGCTKRLSFDAYVFCDSCDGLGHPSDAAMSICPTCRGVGRVTIPP--------FTASCQTCKGTGHIIKEYCMSCRGSGIV-EGTKTAELVIPGGVESEATITIVGAGNVSSTSQPGNLYIKLKVANDSTFTRDGSDIYVDANISFTQAILGGKVVVPTLSGK-IQLDIPKGTQPDQLLVLRGKGLPKQGFFVDHGDQYVRFRVNFPTEVNERQRAILEEFAK. 385
5 -89.400[O] KOG0712 Molecular chaperone (DnaJ superfamily)  ali follow..  31  5..TKLYEVLNVDVTASQAELKKAYRKLALKYHPDKNPN----AGDKFKEISRAYEILADEEKRATYDRFGEEGLQGGGADGGMSADDLFASFFGGGMFGGGMPRGTLEDLYRGKTTKLALQKKVICPKCSGRGGKEGS-VKSCASCNGSGVKFITRAMGPMIQRMQMTCPDCNGAGETIEDRCKECDGAKVI-SQRKILTVHVEKGMHNGQKIVFKEEGEQAPGIIPGDVIFVIDQKEHPRFKRSGDHLFYEAHVDLLTALAGGQIVVEHLDDRWLTIPIIECIRPNELKVLPGQGMLSQR-HHQPGNLYIRFHVDFPEPATPEQLALLEKALPP 349
6 -79.300[O] KOG0713 Molecular chaperone (DnaJ superfamily)  ali follow..  17  16..RDPYEVLCVSKDANDQEIKSAYRKLALKYHPDKNANN-PDASELFKEVAFSYSILSDPEKRRHYDNAGFEALDADGMDMEIDLSNLGTSKLGVPIKTTVSANVLVTVRPLPIGTSVSGKVEKQCAHFFGVT--------ISEQQAESGVVVRVTSTAQSKFKLLYFEQDSSGGYGLALQEEREKTGKVTS-AGMYFLHFQVYRMDTTVNALAAAKDPESALEGLQPCEVSELKAGTH-IFAVYGDNFFKTASYTIEALCAKTYEDTTE-----------KLKEIEAQILRKRNELRQFETEYRKALARFQEVTNRYTQEKQTVDELLKQR... 343
7 -64.600[O] KOG0716 Molecular chaperone (DnaJ superfamily)  ali follow..  15  49..FDLYDLLGIDRSSDKSQIKSAYRALQKRCHPDIAGDP---GHDMAIILNEAYQLLSDPISRQAYDKEQAKLEELRGYTGKPIYSVWCGPETEQRAA-ESKIKEAIEACPVDCISMVERSDLAPLEFLMSKQPRGNVRIGVGNTVGE-------RVSNVFVDVKKFQERYAKAMSRTTKETSQREVQISAV-EAIRSISNWLYWRSSPYTKPLSPESNMSLFTKRKKAVDPDIRKLQDVVAAMKQADQSGRTKEKGSAYLLGEDYWSPSNAALP-SSGNNNGSKASSNPQVTRKTFPSEEKPSRRENRRQFRIKKFPIGTAIVAVFLVQY.... 405
8 -53.500[O] KOG0691 Molecular chaperone (DnaJ superfamily)  ali follow..  19  5..TEFYDVLGVSPTATEAEIKKAYYIKARQVHPDKNPND-PQAAHNFQALGEAYQVLSDPGQRQAYDTSGKSGISTEIIDPAAIFAMLF-------------GSELFEEYIGNKDEFTSNAEAEVTRLSNAAYGVEMLNTIGYIYVRQAAKELGKKAIYLGVP---FVAEWFRTKGHFIKSQVTAATGAYALFQLQEEM-KRQLSAEGNYTEKELEEYMKTHKKLNVADIESTISRVCEQVLQDPTAKREELRARAKGLKTLGKIFQ.................................................................... 329
9 -49.500[O] KOG0718 Molecular chaperone (DnaJ superfamily)  ali follow..  18  12.NEDYYSLLNVRREASSEELKAAYRRLCMLYHPDKHRDPKSQAERLFNLVHQAYEVLSDPQTRAIYDIYGKRGLEMEGWEVVERRRTPAEIREEFERLQREREERDATDLFDRYDEEYEDVSGSSFPQIEINKMHISQSIEAPLTATDTAILSGSLSTQNGNGGGSINFALRRVTSAKGWGELEFGAGDLQ----GPLFGLKLFRNLTPRCFVTTNCALQFSSRGIRPGLTTVLARN------LDKNTMGYLQWRWGIQSAMNTSIVRDTKTSH-FTVALQLGIPHSFALIIYQHKFQRVKGSLKAGFFGTVVEYGAERKISRHSVLGAAVSVG. 356
10 -46.700[O] KOG1150 Predicted molecular chaperone (DnaJ superfamily)  ali follow..  27  65FNLNPFEVLQIDPEVTDEEIKKRFRQLSILVHPDKNQDDADRAQKAFEAVDKAYKLLLDQEQKKRALDVIQAGKEY................................................................................................................................................................................................................................................................... 140
11 -45.900[O] KOG0719 Molecular chaperone (DnaJ superfamily)  ali follow..  36  28MDIDPYSVLGVEKDASDELIRRAYRKKALQHHPDRIHDEKVEARIEFDKVAIAYGVLSDKKRRKHYDKTGQLRETDADIDFD............................................................................................................................................................................................................................................................. 111
12 -42.700[O] KOG0717 Molecular chaperone (DnaJ superfamily)  ali follow..  36  25TMKCHYEVLEVERDADDDKIKKNYRKLALKWHPDKNPDRIEECTQQFRLLQAAYDVLSDPREREFYDRHRESILKGKNTDFEEQSTDLFPYFTASCYQGYENDKNGFFTVYR............................................................................................................................................................................................................................... 136
13 -39.700[O] KOG0724 Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains  ali follow..  42  123..QDHYALLGLSNLATEDQIRKSYREAALKHHPDKLAKKKDEIESRFKAIQEAYEVLMDPTRRRIFDSTDEF....................................................................................................................................................................................................................................................................... 199
14 -37.700[JO] COG5269 Ribosome-associated chaperone zuotin  ali follow..  31  96..ADLYAAMGLSKRATESQIIKAHRKQVVKYHPDKQSAGSLDQDGFFKIIQKAFETLTDSNKRAQYDSCDFV....................................................................................................................................................................................................................................................................... 170
15 -37.400[U] COG5407 Preprotein translocase subunit Sec63  ali follow..  13  97..WDPYEILGIAKGTSVDDVRRHYKRLSIKFHPDKVRNTREEVEKHYIEITNAYRALTDDKTRENYALYGTPDVPQHISVGIALPKWISE------SENSIYILGFYGLVFGIVLPYAVGKWWYGSRTYTASSKELTSLVPNEKNPKEYILKLLFDHLNRKKTNNFNTHQILSQSDVVLNALLSVATAFGFANPVDNVLKLWIVQAIPLDAP--------------------PLLQLPH--LLMEDVKNLSIRNISSIPQFLSLSEELPNYSKNQLK-EMREIANGIPRISVVAAKVLVDDDEYITVGAIANLILDLKCSYGTEVVP........ 433
16 -37.400[O] KOG0721 Molecular chaperone (DnaJ superfamily)  ali follow..  13  97..WDPYEILGIAKGTSVDDVRRHYKRLSIKFHPDKVRNTREEVEKHYIEITNAYRALTDDKTRENYALYGTPDVPQHISVGIALPKWISE------SENSIYILGFYGLVFGIVLPYAVGKWWYGSRTYTASSKELTSLVPNEKNPKEYILKLLFDHLNRKKTNNFNTHQILSQSDVVLNALLSVATAFGFANPVDNVLKLWIVQAIPLDAP--------------------PLLQLPH--LLMEDVKNLSIRNISSIPQFLSLSEELPNYSKNQLK-EMREIANGIPRISVVAAKVLVDDDEYITVGAIANLILDLKCSYGTEVVP........ 433
17 -35.000[O] KOG0720 Molecular chaperone (DnaJ superfamily)  ali follow..  14  407..PDHYSALGLARNVDMAYLKREYRKKAMLVHPDKNMGN-ERAAEAFKKLQNAYEVLLDSVKQKSYDDELKREELLNYFRRFQNSSQKDTRGHGFSGSGFGSSEGEGEEAFRECRTKKSKSTARWCQDCKEFHQAKDGDGWVEQASQHVLFGLFQK-------VDMPRAYVCADSKIYEASQWYICQGMR-CPANTHKPSFHVNMNATAAKRGTSGSSGQKGNQRMPTNPDETMTEEEF--YEWLQNAVQSGMFDNARENPSSATASSTSSSSSKKK.......................................................... 688
18 -31.800[O] KOG0723 Molecular chaperone (DnaJ superfamily)  ali follow..  28  95..REAGLILGVSPSAGKAKIRTAHRRVMILNHPDKG-----GSPYVAAKINEAKDLLETTTKH................................................................................................................................................................................................................................................................................ 150
19 -18.700[O] COG1076 DnaJ-domain-containing proteins 1  ali follow..  29  2..SQYFTLFRIEPDIDTENLEQTYRALAARFHPDKSAFEQKQAVMMSSTINDAYRTLKNPIDRAAY............................................................................................................................................................................................................................................................................. 71
20 -16.800[O] KOG3192 Mitochondrial J-type chaperone  ali follow..  23  85.SVDYFQIFGLEKEIDPGSLEGKYKDWQKKLHPDLSKKERDYAAEQSAKVTEACRTLTKRLSRAMY............................................................................................................................................................................................................................................................................. 155
21 -13.800[V] KOG0624 dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains  ali follow..  51  378..RDYYKILGVKRNASKREITKAYRKLAQKWHPDNDEEEKKKAEKKFIDIAAAKEVLQDEEKRRQFDQ........................................................................................................................................................................................................................................................................... 445
22 -13.700[O] KOG2813 Predicted molecular chaperone, contains DnaJ domain  ali follow..  93............QFLDEIEIRELLIDHIGHRCCWGSRPARTWKIHAVEDCNVVGTLDTFIEEREALTQTVPFTGGEFNGKKHGSEPGLWELDLRPQFPTLFVPYKETQVLVPNSETGCTGRGDVVCPTCNADGEPGFYKMMKCSTCYGRGLVAHKDGSD-------TICTNCNGKGKL---PCPTCQSRGLIKSLLTSSIAVVKWKTLSKRKVSATRGAGSVPE-------VFDRAEGVQLCNTQAYQCT-SYFLNRFSSEVISLRAEVPPTANVVCERHTISVVPVTRVTMEDRGKAFS------GGKEIYLKDYYPAR............... 405
23 -12.400[O] KOG0550 Molecular chaperone (DnaJ superfamily)  ali follow..  52  348..KDHYKILGVSKEATDIEIKKAYRKLALVYHPDK--AGNLEAEARFKEVGEAYTILSDPESRRRFDS........................................................................................................................................................................................................................................................................... 412
24 -11.300[L] COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain  ali follow..  1.....................................................................................................................MRNTMIQSCNECKGKGYR-VKSYKICSACHGTGFRSTEDIKDHLEDSHEVPCEVCRGKGEVVRETCPTCGGKGEVNICPSKGRDEYCPECQKKEKVYILHPACTMDDLEVGSIYRITRVEKYGVFVSLNSHVWGLMRGLFPDYKVGDELFVRVSQKGEVDMIPASIKGPYEVIKLKKDRIADIDTKSLGKTVRIVGEVIQIQQTSGPTIFTVSD.... 242
25 -9.170[R] KOG0431 Auxilin-like protein and related proteins containing DnaJ domain  ali follow..  25  861.....WQPVSLTDLITAASVKKVYRKATLCIHPDKVQQKGANLQQKY--IAEVFDMLKEA-----WNKFNSEEL..................................................................................................................................................................................................................................................................... 923

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 5 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.