current user: public

If you have questions about the server, please let us know.

Query: [O] KOG0728 26S proteasome regulatory complex, ATPase RPT6, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .
# Score Template Links and tools%idFirst MTVTNRMEIESAYHKGEGFRSYYIQKIEELQLVVAEKHQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDLDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWKLast
1 -113.000[O] KOG0728 26S proteasome regulatory complex, ATPase RPT6  ali  100  1MTVTNRMEIESAYHKGEGFRSYYIQKIEELQLVVAEKHQNLRRLQAQRNELNAKVRMLREELQLLQEQGSYVGEVVKPMDKKKVLVKVHPEGKFVVDLDKNIDINDVTPNCRVALRNESYTLHKILPNKVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFDALGIAQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSELVQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSSRIESGSGGDSEVQRTMLELLNQLDGFEATKNIKVIMATNRIDILDPALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAELMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVAKVMQKDSEKNMSIKKLWK 405
2 -102.000[O] KOG0651 26S proteasome regulatory complex, ATPase RPT4  ali follow..  43  9MVEPTGPAIVEDERTKALNSYRRKLAERDIEQKLKDLRKKESEMTKQFDK-------SENDIKSLQSVGQIVGEVLKQLSEEKFIVKATNGPRYVVGCRRSINKEELKQGTRVSLDMTTLTIMRQLPREVDPLVYKMSHEDPGNISYSDVGGLAEQIRELREVVELPLINPELFKRVGITPPKGCLLFGPPGTGKTLLARAVASQLDCNFLKVVSSAIVDKYIGESARMIREMFNYARDHQPCIVFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQLDGFDSLGKVKVIMATNRPDTLDPALLRPGRLDRKIEIGLPNEQSRLEILKIHSNKITKHGEIDFEAVVKLSDGFSAADLRNVCTEAGMFAIRAEREFVIDEDFMKAVRKVGDAKRLETKLDYKPV. 406
3 -100.000[O] COG1222 ATP-dependent 26S proteasome regulatory subunit  ali follow..  41  1.MSLEELEAMDQS--NPGEFL------ERVREKIRMLNSETRILQSRVNTINASIAENMERIRLNKQLPYLVGNVVEVLDEHSGVVNASTRMSSYLPITGLIPNSELRPGDLVALHKDTNIVFEKLPPDYDMKVGVLKSDAKPDETYEDIGGLERQIEELNEAIVLSLTHPERFEKLNIKPPKGVLMYGPPGTGKTLMARACASKTNATFLKLAGPQLVQMYIGDGARLVRDAFALAKERKPTIIFIDEIDAIGAKRSDSDQTGDREVQRTMLELLNQLDGFSSSEEVKIIAATNRVDILDPALLRSGRLDRKIEFPLPNTLGRKRILQIHARKMSVRDDVNFDELARSTEGFNGAQCKAVCVEAGMAALRKEKTEISQNDFMDGIQEVLSRKKSKLLYFT.... 401
4 -94.400[O] KOG0652 26S proteasome regulatory complex, ATPase RPT5  ali follow..  44  26.......................TRATRLLDNEIRILKEDAQRTNLECDSYKEKIKENQEKIKLNKQLPYLVGNIVEILEMKCVVLKTSTRQTIFLPVVGLVDPDSLKPGDLVGVNKDSYLILDTLPSEYDSRVKAMEVDEKPTEDYNDIGGLEKQIQELVEAIVLPMTHKERFEKLGVRPPKGVLLYGPPGTGKTLMARACAAQTNATFLKLAGPQLVQMFIGDGAKLVRDAFQLAKEKAPCIIFIDEIDAIGTKRFDSEVSGDREVQRTMLELLNQLDGFSSDERIKVIAATNRADILDPALMRSGRLDRKIEFPHPTEEARARILQIHSRKMNVHPDVNFEELARSTDDFNGAQLKAVCVEAGMLALRRDATEVNHEDFNEGIIQVQAKKKASL........ 420
5 -92.900[O] KOG0727 26S proteasome regulatory complex, ATPase RPT3  ali follow..  39  19LMDLSTADE-EDLYGRLKSLE------RQLEFTDIQEEYVKDEQKNLKRELLRAQ----EEVKRIQSVPLVIGQFMEMVDQNNGIVGSTTGSNYYVRILSTINRELLKPSASVALHRHSNALVDVLPPEADSSISLLSQSEKPDVSYNDIGGCDIQKQEIREAVELPLTHHELYKQIGIDPPRGVLLYGPPGTGKTMLAKAVANHTTAAFIRVVGSEFVQKYLGEGPRMVRDVFRLAKENAPAIIFIDEVDAIATARFDAQTGADREVQRILMELLNQMDGFDQTVNVKVIMATNRADTLDPALLRPGRLDRKIEFPLPDRRQKRLVFQVCTSKMNLSDEVDLEDYVSRPDKISAAEIAAICQEAGMHAVRKNRYVILPKDFEKGYRANVKKPDTDF........ 404
6 -91.200[O] KOG0726 26S proteasome regulatory complex, ATPase RPT2  ali follow..  48  90.....................................................KNEEERSKVDDLRGTPMSVGNLEEIIDDNHAIVSTSVGSEHYVSILSFVDKDQLEPGCSVLLNHKVHAVVGVLSDDTDPMVTVMKLEKAPQETYADIGGLDTQIQEIKESVELPLTHPEYYEEMGIKPPKGVILYGPPGTGKTLLAKAVANQTSATFLRVVGSELIQKYLGDGPKLVRELFRVAEEHAPSIVFIDEIDAVGTKRYDSNSGGEREIQRTMLELLNQLDGFDSRGDVKVIMATNRIETLDPALIRPGRIDRKIEFPLPDEKTKRRIFTIHTSRMTLAEDVNLSELIMAKDDLSGADIKAICTEAGLMALRERRMKVTNEDFKKSKESVLYRKKEGTPEGL.... 437
7 -89.000[O] KOG0729 26S proteasome regulatory complex, ATPase RPT1  ali follow..  48  43........................RQIKQVEDDIQQLLKKINELTGIKESPPALWDLAADKQTLQSEQPLQVARCTKIINAPKYIINVKQFAKFVVDLSDQVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGGCKEQIEKLREVVETPLLHPERFVNLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIRVIGSELVQKYVGEGARMVRELFEMARTKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTMLELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKIEFSLPDLEGRTHIFKIHARSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKIATEKDFLEAVNKVIKSYAKFSAT...... 426
8 -79.400[O] KOG0733 Nuclear AAA ATPase (VCP subfamily)  ali follow..  29  318IGATNRPDSLDSALRRAGRFD------REICLTVPSQDAREKILRTMAKGLKLSGDFDFRQL--AKQTPGYVGADLKALTAAAGIIAIKRIFNEISPLNKLDLNSDPRSPEELEPLAICPQDFIEALAKVQPSSKREGFATVPGVSWNNIGALKSIRVELQMAIVQPIKRPELYQSVGISAPTGVLLWGPPGCGKTLLAKAVANESKANFISIRGPELLNKYVGESERAVRQVFLRARASSPCVIFFDELDAMVPRRDDSLSEAS---SRVVNTLLTELDGLSDRSGVYVIAATNRPDIIDPAMLRPGRLDKTLLVDLPDAHERVEILKTLTKQTPLHEEVNLDVLGERCSNFSGADLAALVREAAVTALRSEPIRVTNADFELAFKNIKPSVSDRDRQKYQRLA 767
9 -75.300[O] KOG0730 AAA+-type ATPase  ali follow..  30  380MGATNRPNSIDPALRRFGRFD------REIDIGVPDEIGRLEVLRIHTKNMKLAEDVDLERI--SKDTHGYVGADLAALCTEAALQCIREKMD-VIDLEDDSIDAEILNSMAVSNEHFHTALGNS-----NPSALRETVVEVPNVSWEDIGGLENVKRELQETVQYPVEHPEKFEKFGMSPSKGVLFYGPPGCGKTLLAKAIANECQANFISVKGPELLTMWFGESEANVREIFDKARQSAPCVLFFDELDSIATQRGNSAGDAGGAADRVLNQLLTEMDGMNAKKTVFIIGATNRPDIIDSALLRPGRLDQLIYIPLPDEDSRLNIFKACLRKSPVAKDVDVTALAKYTQGFSGADITEICQRACKYAIREEVSEIRAAHFEESMKYARRSVSDADIRKYQAFA 796
10 -72.100[O] COG0464 ATPases of the AAA+ class  ali follow..  32  356IGATNRPEALDIALRRPGRFD------REIELRVPDTEGRLEIFQIHTRGMPLADNVNLMDF--AQITYGFVGADIAALCREAAMSALRRILPKINLNEPEISKEI-LDALQVTREDFENALKDV-----QPSAIREILIEVPNVSWEDVGGLERVKELLKEVVEWPLKNPESYRDIGVEAPKGVLLYGPPGTGKTLLAKAIAHESDANFITAKGSDLLSKWYGESEKRIAEVFTRARQVAPSIIFLDELDSLAPIRGTSVGEPQVT-ARILNQLLSEMDGLEELRAVVVIGATNRPDIIDPALLRPGRFDELILVPVPDEGARREIFRVHTKNMALAEDVDIEKLVSFTDQYTGADIAAVCKKAGRHALREHAKKVRQKHFLQAIEETGPSVTPDTMKYYEAIK 747
11 -70.800[R] COG1223 Predicted ATPase (AAA+ superfamily)  ali follow..  32  88..................................................................................................................................ESDPRVIETEIVRDITLDDVVGQEEAKRKAKVILEY-LRNPEKF---GKWAPKNVLFYGPPGTGKTMMAKALSNEAKTPFLSVKSTKLIGEHVGDGARRVHELYERARQLAPCIVFLDEFDAIALDR--GYQEIRGDVSEIVNALLTELDGTNSNEGICTIAATNRVELLDASI--RSRFEEEIEFRLPSYEERLEILRRNLEEFPVPVKARLELVAAASEGFSGRDLVEKVIKASLHAIAEGKDKIETEDLLTAAEKVKMPSRQPPKQ...... 349
12 -68.600[O] KOG0737 AAA+-type ATPase  ali follow..  23  263...........................YNIEIRPPEDENQLMSWKFEDDMKVIQFQDNKNHIAEVLAANDLECDDLGSICHADTMFLSSHIEEIVVGLNILQEGQGCFEDSLKLDTNIDSKEVAPDNEFEKRIRPEVIPANEIGVTFADIGSLDETKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMMAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQR--TRVGEHEAMRKIKNEFMTHWDGLMSNDRILVLAATNRPFDLDEAIIR--RFERRIMVGLPSVESREKILRTLLSKEKT-ENLDFQELAQMTDGYSGSDLKNFCTTAAYRPVRETLRPLSMEDMKVAKSQVAASFAAEGAGMNELKQ 706
13 -65.000[O] KOG0741 AAA+-type ATPase  ali follow..  28  144..............................................................LFGLLVKDIESMDPSILKGEPATGKRQK-----------IEVGLVVGNSQVAFEKAENSSLNLIGKAKTKENRQSIINPDWNFEKMGIGGLDKEFSDIRRAFAFRVFPPEIVEQMGCIHVKGILLYGPPGCGKTLLARQIGKMLNAREPKVNGPEILNKYVGESEANIRKLFADAEESGLHIIIFDEIDAICKQR-GSMAGSTGVHDTVVNQLLSKIDGVEQLNNILVIGMTNRPDLIDEALLRPGRLEVKMEIGLPDEKGRLQILHIHTARMRLSADVDIKELAVETKNFSGAELEGLVRAAQSTAMNRESLQVTRGDFLASLENDIKPAFGTNQEDYASYI 503
14 -61.900[O] KOG0736 Peroxisome assembly factor 2 containing the AAA+-type ATPase domain  ali follow..  26  542IASAESTEGISPTIRRC----------HEIRMGSLNDEQRSEMLSQSLQGVSQFLNISSDE-GLVGQTSGFLPRDLQALVADAGANLYISQESETKKINSLSDHQASQIDNSTEKLTAKEDFTKALDRSKKRNASALGAPKVPNVKWDDVGGLEDVKTSILDTVQLPLLHKDLFSS-GLRKRSGVLLYGPPGTGKTLLAKAVATECSLNFLSVKGPELINMYIGESEKNVRDIFEKARSARPCVIFFDELDSLAPARGASGDSGG-VMDRVVSQMLAEIDGLDSSQDLFIIGASNRPDLIDPALLRPGRFDKLLYVGVADASYRERVLKALTRKFKLSEDVSLYSVAKKCSTFTGADMYALCADAWFQAAKRDSVVVEYVDFIKAMDQLSPSLSITELKKYEMLR 965
15 -61.600[O] KOG0739 AAA+-type ATPase  ali follow..  32  107...............................................................................................................................KKLQEQLMGAVVMEKPNIRWNDVAGLEGAKEALKEAVILPIKFPHLFT--GKRTPRGILLFGPPGTGKSYLAKAVATEANSTFFSVSSSDLMSKWLGESEKLVKNLFELARQHKPSIIFIDEVDSLCGSRNENE---SEAARRIKTEFLVQMQGVNNNDGTLVLGATNIPWVLDSAIRR--RFEKRIYIPLPEEAARAQMFRLHLGSTPHNTDANIHELARKTEGYSGADISIIVRDSLMQPVRKLEPVVCMSDMLRSLATTRPTVNADDLLKVKK.. 428
16 -60.600[O] COG0465 ATP-dependent Zn proteases  ali follow..  40  139......................................................................................................................................ARMLTEDQIKTSFADVAGCDEAKEEVSELVDY-LREPSRFQKLGGKIPKGVLMVGPPGTGKTLLAKAIAGEAKVPFFTISGSDFVEMFVGVGASRVRDMFEQAKKAAPCIIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEMDGFEGNEGIIVIAATNRPDVLDPALLRPGRFDRQVVVGLPDVRGREQILKVHMRRVPLDTDIDASVIARGTPGFSGADLANLVNEAALFAARGNKRVVSMVEFEKAKDKIMMGAERRSMVMTEAQK 408
17 -53.300[O] KOG0731 AAA+-type ATPase containing the peptidase M41 domain  ali follow..  41  303..................................................................................................................................KATITRADKHSKNKIYFKDVAGCDEAKQEIMEFVHF-LKNPKKYEDLGAKIPKGALLVGPPGTGKTLLAKATAGESGVPFLSISGSDFMEMFVGVGPSRVRHLFQEARQAAPSIIFIDEIDAIGRARGRGGLGGNDERESTLNQLLVEMDGFGTTAGVVVLAGTNRPDILDKALLRPGRFDRQITIDKPDIKGRDQIFKIYLKKIKLDHEYYSQRLAALTPGFAGADIANVCNEAALIAARHEGATVTMAHFESAIDRVIGGLEKKNRVISKLER 578
18 -52.000[O] KOG0740 AAA+-type ATPase  ali follow..  32  379.............................................................................................................................LEPKMIELIMNEIMDHGPPVNWEDIAGVEFAKATIKEIVVWPMLRPDIFTGL--GPPKGILLFGPPGTGKTLIGKCIASQSGATFFSISASSLTSKWVGEGEKMVRALFAVARCQQPAVIFIDEIDSLLSQRGDGE---HESSRRIKTEFLVQLDGASSEDRILVVGATNRPQEIDEAARR--RLVKRLYIPLPEASARKQIVINLMSKEQCLSEEEIEQIVQQSDAFSGADMTQLCRGASLGPIRSQVRPIAYIDFENAFRTVRPSVSPKDLELYEN.. 665
19 -51.400[O] KOG0734 AAA+-type ATPase containing the peptidase M41 domain  ali follow..  36  269......................................................................................................................................SAVDPVQMKNVTFEHVKGVEEAKQELQEVVEF-LKNPQKFTILGGKLPKGILLVGPPGTGKTLLARAVAGEADVPFYYASGSEFDEMFVGVGASRIRNLFREAKANAPCVIFIDELDSVGGKR--IESPMHPYSRQTINQLLAEMDGFKPNEGVIIIGATNFPEALDNALIRPGRFDMQVTVPRPDVKGRTEILKWYLNKIKFDQSVDPEIIARGTVGFSGAELENLVNQAALKAAVDGKEMVTMKELEFSKDKILMGPERRSVEIDNKNK 536
20 -35.000[R] COG2607 Predicted ATPase (AAA+ superfamily)  ali follow..  12  49..........................................................................................................................................LPDPHTFPLVRLAGVGRQTELLVRNTEQFIVG---------RPANNVLMSGARGTGKSSLVKALLHEYADKGLRL---EVDKSDLIGLPYLLTLL---KECPEKFIVFCDDLSFESGDKTALDGGLSQRCANVLVYALMPEYFDENAGTTGMRGEIHQKEAVEEKISLSDRFGLWLSFYPFDQNDYLAAVQNWLEDFGVPYDETAQQWAQTRGSRSGRSAWQFACDWAGRLPKQRA............................... 286
21 -29.100[O] KOG0743 AAA+-type ATPase  ali follow..  23  706.............................................................................................................................................EHPSTFETLAMDPGAKKKIIDDMERFLKRREFYKRVGKAWKRGYLLYGPPGTGKSSLIAAMANYLKFDVFDLELSSI------YENAQLKSILLSTTNR--SILVIEDIDCSSAEVVDREADEYQEYEETLSGLLNFVDGLWSSDERIIVFTTNHKERLDPALLRPGRMDMHINMSYCTGLGFRTLVSNY-----LGLGGLNHPLCE--------EIEALIDSTEVTPAELAEELMQEDDTDVVLRGVVSFVENR......... 947
22 -27.300[K] COG1224 DNA helicase TIP49, TBP-interacting protein  ali follow..  12  27.............................................................................................................................................DENLRAKDVADGLVGQKRAREAAGVIVR----LIKSGKMAGRGILMAGPPGTGKTAIAVAISKELGIPFVQVSASEFYSAEMKKTEALIQAMRKAVRIRETRTVLEGEVVGLDYNMVPNPYNPTQKIPESATLTLKDEKRTFSVGGRLAMQFFTQGIEVGDVIVI--DKETGRIGKLGRSEKAKKKYDLGDDEVVPVPSGKVEKEKEFTYVVTLHDLDEA-RTSIFSLFSPPSREIDNEVREAVDEQVKRLVEEGRAELVPGV. 291
23 -19.900[L] COG2255 Holliday junction resolvasome, helicase subunit  ali follow..  18  27.................................................................................................................................................LLTEYVGQPHVREQMEIFIQAAKQRGDALDH--------VLIFGPPGLGKTTLANIIANEMGVNLRTTSGP--VLEKAGDLAAMLTNL------EPHDVLFIDEIHRLSPVVEEI----DYQLDIMIGEGPAARSIKLDLPPFTLIGATTRAGSLTSPLR--DRFGIVQRLEFYQVADLEHIVSRSAKCLGLELTPEAHQLARRSRG-TPRITNRLLRRVRDFAEVRADGAINGEVAMKALDMLN............... 255
24 -16.300[LO] COG1474 Cdc6-related protein, AAA superfamily ATPase  ali follow..  18  40...................................................................................................................................................DLLLHRNEQINSLATILVSALRG---------ETPSNVLIYGKTGTGKTAVTRYVGKELFCSVVYINCEVIDTQY-GWPTDQVFMKFKEAARDQVIIIILDEIDKLIKKGDD------------VLYNLSRINTDLRKAKVSMIGVSNDLKFTEFLDPR----EEELIFPPYDAEQISDILKQRAKMAYNDGVLGIPLCAAFAAQEHG-DARDLLRVSGEIAERENQPQVLEEHVRRAQEKIEIDRVVEVVRTLPTQS 310
25 -15.600[O] COG1219 ATP-dependent protease Clp, ATPase subunit  ali follow..  16  79.....................................................................................................................................................VIGQERAKKVLAVAVYNHYKRLNQRDKKD-LGKSNILMIGPTGSGKTLLAETLARLLNVPFTIADATTLTEAYVGEDENIIQKLLQKCEKAQMGIVYIDEIDKISRKSDNPSITRDVSGEGVQQALLKLIEGVDTRNILFICGGAEPEDLVKFGLIPEGRLPVIATLDELDEAALMQILTEPKNAL----------TKQYAKLFEMEGVDLEFRPDALKAVARKA--LERKTGARGLRSILEGILLDTMYEIP... 388
26 -15.600[L] COG0470 ATPase involved in DNA replication  ali follow..  20  23.................................................................................................................................................TLDEVYGQNEVITTVRKFVD--LPH--------------LLFYGPPGTGKTSTIVALAREISNMVLELNASD------DRGIDVVRNQIKDFASTRQILIILDEADAMTNAAQNA--------------LRRVIE--RYTKNTRFCVLANYAHKLTPALLRCTRFRFQ---PLPQEAIERRIANVLVHEKLKLSPNAEKALIELSNG---RRVLNVLQSCKATLDNPDEDEISDDVIYECCGAPRPSDLKAVL....... 248
27 -14.700[LD] KOG2227 Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase  ali follow..  17  124...................................................................................................................................................STILCREDEQIRIFEFVKGCIDQ---------QKAGSLYICGCPGTGKSLSMEKVVQQVPVDTLSVNCTSLSKTT-SSPLQHLQNLFSQSSSSRMMLIIADEMDYLITKD-----------RGVLYDLFMLTT--LPFSRCILIGVANAIDLADPKLKSLNCKPMVITFRAYSKDQILRILQERLRVLVAFQPKALELCARKVAAASG-DMRCVCRSALEILEIETRGSVRMDHMAAALSKTFKSPVVETIQSLP... 408
28 -14.600[L] KOG0990 Replication factor C, subunit RFC5  ali follow..  20  42..........................................................................................................................................VEKYRPQSLDDVAAHRDIIDTIDRLTN--LPH--------------LLLYGPPGTGKTSTILAVARKLRNMILELNASD------DRGIDVVRQQIQDFASTQSKLVLLDEADAMTKDAQFA--------------LRRVIE--KYTKSTRFALIGNHVNKIIPALQRCTRFRFA---PLDGVHMSQRLKHVIEAERLVVSDCGLAALVRLSNGDMRKALNILTHMASKEITEEESKQITEEDVYLCTGNPLPKDIEQIS....... 279
29 -14.400[S] COG4916 Uncharacterized protein containing a TIR (Toll-Interleukin 1-resistance) domain  ali follow..  10  9......................................................................................................................................DVFKTVGLPPYTYVKPKHFGEVRADISQ------------------VGKHLLIEGPSGIGKTCVVFKVFEELQWSQRDFTYVGCRDQNAEQIIDDFLKNAAAGNALSPCVLVIDDFHLL-----------SQAKRMEIGSTLKRLSDRAEPAKVILIGIPTAGVSLAYDLG--PRL-GSYALTRASDVEIDKLISEGEQALAVLFE-DRDVLLAESAGNFWL-AQYVCNKVCAIE-TQDDAKILTFDILGIRGRLMAELTQR......... 247
30 -14.400[L] KOG0991 Replication factor C, subunit RFC2  ali follow..  15  39..........................................................................................................................................VEKYRPVKLNEIVGNEDTVSRLEVFAR--VPN--------------IIIAGPPGTGKTTSILCLARALKDAMLELNASN------DRGIDVVRNKIKMFAQQKVTIIILDEADSMTDGAQQA--------------LRRTME--IYSKTTRFALACNASDKIIEPIQRCAVLRYT---KLTDAQILTRLMNVIEKERVPYTDDGLEAIIFTAQG----DMRQALN---LQSTFSGFGFINSENVFKVCDEPHPLLVKEMI....... 267
31 -14.000[L] COG2256 ATPase related to the helicase subunit of the Holliday junction resolvase  ali follow..  22  25.................................................................................................................................................TVEQYIGQQHILGPLRRALE--------------GHIHSMILWGPPGTGKTTLAEVAANYANAEVERVSAVT-------SGVKEIRAAIEKARENRRTILFVDEVHRFNKSQQDA--------------FLPHIE--DGTVTFIGATTENPSFELNNALLSRARV---YKLTSLNQQEILQALHQAIADTERGADNVLDRLAELVNGDARMSLNYL--ELLYDMAREDRKQIDLPLLAEVAGE................. 244
32 -13.900[L] KOG1968 Replication factor C, subunit RFC1 (large subunit)  ali follow..  15  362..........................................................................................................................................TSKYAPTSLKDICGNKGVVQKLQKWLQ--KSNFNKPGPDGLGLYKAVLLSGPPGIGKTTAAHLVAKLEGYDVLELNASD-------RSKRLLDEQLFGVMAKSRLVLIMDEIDGM--------SSGDRGGVGQLNMII-------KKSMIPIICICN--DRAHPKLRPLDRTTFDLRFRRPDANSMRSRIMSIAYREGLKLSPQVDQLVQGTQS----DMRQIINL--LSTYKLSCSEMTPQNSQAVIKNSEKHIVMKPWDICSRY. 621
33 -13.900[R] COG0714 MoxR-like ATPases  ali follow..  20  1........................................................................................................................................................MREQISVLTQNLSQTIVGKDEAIRVALLSGGHALLEDVPGVGKTLLAKSLARSINGKFQRVQGTNIWNPSSREFEFLPGPAFAN-------ILLADEINRATPRTQAALLEVMEEKQVTVDGETRLVP-----HPFFVIATQNPIEYQGTFPLPEAQLDRSLSLGYPSEAEELKMLQRQVRQVKLTEDL-LLRLVRASRGVSPRGTTALQRATQAFAFLEERDYAIDDDVKFVAPHV................ 277
34 -13.600[L] KOG1514 Origin recognition complex, subunit 1, and related proteins  ali follow..  18  394...................................................................................................................................................KSLPCRSKEMEEITAFIKGSISDDQ-------CLGRCMYIHGVPGTGKTISVLSVMKNLPYCFVEINGSVIYEGLSGHRVGSLNERFAEKENEKPCILLIDELDVLVTRN-----------QSVLYNILDWPT--KPNSKLVVLGIANTMDLPEKLLPRSSRMGQRLCFGPYNHRQLQEIISTRLEGINAFEKTAIEFASRKVAAISG-DAREICRRAAEVADYRLKKSVIMADVEVAIQEMFQAPHIQVMKSVS... 671
35 -13.600[L] COG1484 DNA replication protein  ali follow..  13  80...............................................................................................................................................QLGFKEF--TEGKPQAIKDAFECTKEYVADYEQIKDCRKNSIALLGQPGSGKTHLLTAAANE----LMRTCYVPVIYFPFVEGFTDLKNDFALLEAKQADVLFIDDL-------FKPVNGKPRATDWQLEQMYSVLNYRYLNHKPILLSSELTIEGLEALGTKIYEMCSDYLVIIKGAAYELN............................................................................... 259
36 -13.600[L] KOG2028 ATPase related to the helicase subunit of the Holliday junction resolvase  ali follow..  18  111.................................................................................................................................................TLDDVVGQDHLLSPLRSAVE-----------------PSIVFWGPPGTGKTSIAKSLINSSKDPFVSLSAVT-------SGVKDVRDAVESAKRRKRTVLFMDEVHRFNKSQQDT--------------FLPVIE--DGSILFIGATTENPSFHLITPLL--SR--RVLTLNPLKPNHVETLLRRAVDDSERGDDSVIEFLANNCDGDARVALNAL--EISATMATTRDAVVSIDDAKEALQC................. 334
37 -13.300[H] COG1239 Mg-chelatase subunit ChlI  ali follow..  13  43......................................................................................................................................NLTRKLRSGEELFPGVVGYDDTVIPQ----------------NALLARQNFILLGLRGQAKSRILRAITELLDPEVPVIDGVDM-ADLIGDPIKAARLGTSLGDTRS-GIFAVNELADLSP--------------KVQVALFNILKGYPIRLDVMLVFSANPEDKIVTPLK--DRIGSEIRTHYPDVQLGMDITAQEAVKEEAREDGRIDKLSGVSQRLPISLMELACANAERRSL-TGKMELEYEGELKGADNVAKDLIRKAAGAAYA.. 389
38 -12.900[O] KOG2004 Mitochondrial ATP-dependent protease PIM1/LON  ali follow..  15  358............................................EKAVAKLKYDINKDVEKKVQDHHRKYLLNEQLKVIKKELGI-EKDEKTTIIEKIDERIKTLAVPEYALKVINEEKTKLQFLDPHSSEFSVTRNYLEWLTSVPWEGHYGMKDVKERIMEFIAVNLLRKSIGGKI-------LCFHGPPGVGKTSIAKSIATALNREYFRFS-AEI-RTYVGAMPGKMIQCMKKVKTENP-LVLIDEVDKIGGAGFHGDPAS---------ALLELLDPEQNASRVLFICTANEISKIPGPLR--DRME--IDVSGYLAEEKVEIAHQHLIPQLRKDTSLATEQLKIEDSALEELIKHYCRESGVRNLQQHIERIFRKAALQIAEQQNEDEEPA......... 728
39 -12.700[O] COG0466 ATP-dependent Lon protease, bacterial type  ali follow..  16  205............................................QKENINFQMEMAKKVTDKISKSNREAMLREQLKMIQEELN--GGDDAASGEGGYRERIEKSTMPEEVKKKALSELKKLETGGPHNPESSVIRNYLDLMLDLPWSNHNGLEKVKERIIQHLAVMKLKKEKQGSI-------LLLTGPPGTGKTSLGKSIADALGREYVRIS-AEI-RTYIGALPGRIIQGMRKAGTKNP-VFILDEVDKLSTSYAGDPASA----------LLEVLDPEQNNSEVFFIATANSLASIPWPLL--DRME--IEISGYTKNEKLAIAKDHLLPCILEEHGLDADKLKIEDEALKGIIDKYTREAGVRGLKKQLARTARF---VSEKIVSGKTDLPYVVRADMLK 579
40 -12.500[KE] COG3283 Transcriptional regulator of aromatic amino acids metabolism  ali follow..  13  194.........................................................................................................................................NLSTQDLSAFSQIIAVSAKMKHVVEQAR-------------AMLSAPLLITGDTGTGKDLFAYACSPRSAKPYLALNCASI-SELFGHAPEGKKGFFEQANGGS---VLLDEIGEMSPRMQAK---NDGTFRRVGEDHEIHVD-------VRVICATQKVELVQKGLFREDLYYR-LTLNLPPLRDCPQLTELFVARFADEQGVPRPKLSADLYGWPGRQLKNAIYRALTQL---EGYELRPQDILLPDYDAATVAVGE......... 454
41 -12.500[R] KOG2170 ATPase of the AAA+ superfamily  ali follow..  10  75...................................................................................................................................................NLLFGQHLVKDVVVNSIKSHWYNENP------RKPLVLSFHGYTGSGKNYVAEIIANNT-VATNDFPDKNKLEEYQVELRNRILTTVQKCQR---SIFIFDEADKLPEQLLG-----------AIKPFLDTISGVDFRRSIFILLSNKGGGEIARITKEQYESGYP-QLRLEAFERELMNFSYNEKGGLQMSELISNHLIDHFVPFLPLQREHVCVGAYLRKRGRGDLVSNVDFVERVLNSLQYFPESSKAFSSSGCK 330
42 -12.400[L] COG0593 ATPase involved in DNA replication initiation  ali follow..  13  120.............................................................................................................................................NTKHLFDNVEGKSNQLARAVGQ--------KLAQAPGEPSANPFFLYGGTGLGKTHLLHAIGNGINARVLYIHANNFMQHMVKAVRDNKMDQFKKFYRSLD-ALLVDDIQFFAEK------------EKTQEEFFHIFNSLFETGRQIILTSDRYPKEIEKIEER-SRFG--TAIEPPDLETRVAILLKKAEEHNMNLPEEVAFFIAQRLRTNVRELEGALNRVKAMQ-DFKGGDIDIDFVRDTLKDILALQERLVTIE..... 365
43 -12.100[L] COG2812 DNA polymerase III, gamma/tau subunits  ali follow..  17  14.................................................................................................................................................KLQDVVGQEHITKTLQNALV--------------KFSHAYLFSGPRGTGKTSAAKIIAKAINCDVMEIDAAS------NNGVDEIRDIRDHVK--APSVYIIDEVHMLTTGAFNA--------------LLKTLE--EPPSHAIFILATTEPHKIPLTIIRCQRFDFK-RISNDALVGRMKEI-LTHEGIEAEDEA-LVLVARAAEGGM-RDSLSLLDQA----ISFADERVTVEDVLAITGAVSHEVLTQVV....... 253
44 -12.000[KT] COG3604 Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains  ali follow..  16  128...................................................................................GILTLDSLKPDAFDHLSPRSLEILAAIAAATLKMTLTFSELENQAKQTQLRLEELNQEAWSRDSVEIIGNSGPMLAMKADID-------------APSQFNILIHGETGVGKELVARTISNRKRQPLVYVN-SELFGHVKGAFTGADRAKFALADGGT---LFLDEIGELPLSAQSK---QNHEIQPVGQDRVQTVD-------VRILAATNR--DLKKEV-EAGRFRADLPIYVPPLRERKGLAGYFVEQARRKLGITQLKLHGDVYPWPGRELEHVINRAALKA.................................... 425
45 -11.900[KT] COG4650 Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain  ali follow..  18  176...........................................................................................................................................QQTLDFLKSGIATRNPHFNRMIEQIE----------KVAIKSRAPILLNGPTGAGKSFLARRIRHQFSGAFVEVN-STLFGHVKGAFTGARESREGLLRSANGGMLFLDEIGELGAD--------------EQAMLLKAIEE-QVSSDFQLIAGTVR-----RQLVAEGKFREDLTFTLPGLRQRQENLDYEVERHASLTGDSVRFNTEARATWRGRELSASVTRMATFA---TSGRITLDVVEDEINRLRYNWQES......... 450
46 -11.800[U] COG3267 Type II secretory pathway, component ExeA (predicted ATPase)  ali follow..  21  2..................................................................................................................................................YLNFFGFDELPFSIVRYLYLSQRHQEAIVHLGLGDGGGAMLTGEVGTGKTTVARAILASLPGKT-TFSDLELLEAICDE-QVLHEFLLAEHAQGIQVLLMIDEAQHLAPDVLEQ------------LRLLTNLE--TESHKLLKVLLIGQPE-LQEKLRLPQQLAQRITGPLNEEQTADYIIEQASGNPELFNRKACQWIAEQTHGI----INLVCDAALKQAYQAGEPTLSLARIKLACQEVM............... 266
47 -11.700[O] COG0542 ATPases with chaperone activity, ATP-binding subunit  ali follow..  18  168..........................................................................................................................................TARAESGKLDPVIGRDEEIRRAIQVLQ--------------RTKNNPVLIGEPGVGKTAIVEGLAQRINKRVLSLDMGALIAKYRGEFEERLKAVLNELSKEGRVILFIDEIHTM----GAGKTDGAMDAGNLLKPSL-------ARGELHCVGATTLDE--DAALER--RF-QKVFVGEPTVEDTIAILRGLKERYEIHHHVQITD------------------PAIVAAATLSHRYVSDRQLDKAIDLIDEAASS.......... 399
48 -11.600[O] KOG1051 Chaperone HSP104 and related ATP-dependent Clp proteases  ali follow..  22  179.................................................................................................................................................QLDPVIGREDEIRRTIRVLS--------------RTKNNPVLIGEPGVGKTSIAEGLARRINCKLLSLDVGSLVSKFRGEFEERIKSVLKEVEESEPIILFVDEMHLLMGA--GSGGEGGMDAANLLKPML-------ARGKLHCIGATTLAE--DAAFER--RF-QIILVKEPSIEDTISILRGLKEKYEVHHGVTISD------------------RALVTAAHLASRYLTSRRLDSAIDLVDEAAAA.......... 404
49 -11.500[S] COG4983 Uncharacterized conserved protein  ali follow..  12  469..................................................................................................................................................LAYLIPIEAERVRFEQWLAHIVQRPEELPQSAY-----LFITEETGIGRNWLSSVLV--------RVLRGYVAAGI--DIQEMLDGTFNGRLSRK-LLAVVDEAKA------GMQGYGRWSHSEKLKSMIN-GLEFVEWNCCRWLFFSNNWDAL----------------PFDASDRRFNVVANPTHRQSPDYYERIYS--------------QIANPDFISAVRKRLELLDISGFKPGAIPDMNEAKRKAL....... 677
50 -11.300[DL] KOG1970 Checkpoint RAD17-RFC complex, RAD17/RAD24 component  ali follow..  13  92..........................................................................................................................................VDKYKPETQHELAVHKKKIEEVETWLKAQVLERQ-----PKQGGSILLITGPPGCGKTTTLKILSKEHGIQVQEWINPVLPDFQKDDFKGVFKEFLLRATKTDKKIILVEDLPNQFYR-------DSHTLHEVLRKYVR-----IGRCPLIFIISDSLSGDNNQRLLFPKEI-SNISFNPVAPTIMMKFLNRIVTIEANKNGGKLELLCQGCSG----DIRSAINSLQFSSSKGEN............................... 349
51 -11.100[L] KOG2228 Origin recognition complex, subunit 4  ali follow..  13  551....................................................................................................................................................PLVGHMDEQTKLYQWVRQTIVLGE----------NSVIIVGPRGSGKSVLVDDILSRAAQEVVRLNGREISRQLFSDTLTKLLATLSHPTTSAAVIFVLEEFDLFVQHS----------RQMLLYNLFDIAQ--SRKAPILIIGLTTRYDCSESLEKR-SRFSMVIPMRPP--SSLSEFEQILKSVLYVSDEGGKDQIITC-----NQRVDELLSDTHLHKLVQHHYFASRN......................... 803
52 -11.000[H] COG3172 Predicted ATPase/kinase involved in NAD metabolism  ali follow..  14  9......................................................................................................................................................................................RTVAILGGESSGKSTLVNKLANIFNTTSAWEYGRDYVFSHLGGDEIALQQYIDFAVKYANKVAFIDTVTTQAFCKKYEGREHPFVQALIDEYRFDLVDGLRSLGSSVDRKEFQ--NLLVEMLEENN---EFVRVEEEDYDSRFLRCVELVREM...................................................................... 182
53 -11.000[KT] COG1221 Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain  ali follow..  18  212...............................................................................................................................................RYVLGDMLGQSPQMEQVRQTIL-------------ARSSAAVLIEGETGTGKELAAQAIQGKKSHPFVAVNCGAIAESFTGSRRGGRAGLFEIAHGGT---LFLDEIGEMPLPLQTR---EEKEVTRVGGHQPVPVD-------VRVISATHCEEDMRQGQFRRDLFYR-LRLQLPPLRERVAFLKVSLAALSAPFSAALRQGLQASYDWPGRELRNMMERLALFL.................................... 462
54 -10.900[KT] COG3829 Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains  ali follow..  16  261..........................................................................................................................................ANAPDEPHIEQLVGECRVMRQLKRLIS-------------APSPSSVMVVGESGTGKEVVARAISGRRNKPFIAIN-SELFGAFTGASANGKTGLIQAANTGT---LFLDEIGDMPLM--------QAKLLRAIEA-ILPIGASSPIQDIRIISATNQ-QFIAEGKFREDLFYR-IPITLPPLRERQELVHYFLHLHTRRLGSVYPGIAPDVHRWPGRELSNLMEYL--VNVVPSGEVIDSTLLPPNLLNNGTTEQSD......... 529
55 -10.700[DL] KOG2035 Replication factor C, subunit RFC3  ali follow..  16  5..........................................................................................................................................VDKYRPKDLLGKDGVDYHIEQANHL-----------KFLSADCMPHLLFCGPSGAGKKTRIKCLLRESSNYHIEMTPSDVGIYDRVVVQDLVKEMAQTSQIESTSVVVLCEADSLT--------------RDAQHGLRRTMEKYANNCKI-VLSCESLSRIIEPLQSR-----IIINVPAPTDEDVTKVLRKVIERESFLLPENLQKIVEKSEGNLRRAILMT............................................ 232
56 -10.700[QK] COG3284 Transcriptional activator of acetoin/glycerol metabolism  ali follow..  18  314...................................................................................................................................KVRAPLVSREQIPPALRRLGGDAPVIAALQAKAA-------------ARTRLPILIQGETGTGKEHLARAIGSGLEGPFVAINESELFGAFTGASAKGRKGLIEQADGGT---LFLDEIGDM---------ALQSRLLRVLAE-VLPVGGTAPRKRIRIVSASHR-----QTLVSQGAFREDLTLTLPALRDRPDFLKRHGDGELILSPAALSALKA--HDWPGRELDNVIGVAAALA---ENGVVELGDLPDQLLANADTVGGNE........ 583
57 -10.600[NU] COG2874 Predicted ATPases involved in biogenesis of archaeal flagella  ali follow..  13  7.........................................................................................................................................................DLEEEKKKNILSSGNGEIDKRLGGGIPLGSLTLIEGENDTGKSVLCQQFVYGGGHNIAYYTTENTIKSFLRQMESILNLVANHIKTIRENIAIIDSLTMFTTYSTEDD----------VLEFLTRLKNLCDNGKTILITLHQHAFKEDTLVRIRSACDCHLFLRKEQVGDRLEVSKIRGARKTTGNIVSFE............................................................. 227
58 -10.600[R] COG2842 Uncharacterized ATPase, putative transposase  ali follow..  11  94........................................................................................................................................................................................ATVYGMSGVGKTKAIQEFAKSSLSEILYEIALELGISDAPRRKGTLSRLIARKIKGTEGLLIVDEADHL--------------PYEALEELRIMQE--EAGIGLVLVGNDKVYTRMKGGISP-SRVAKNTSIQKTKKADTQAVAQAWGLETDEEALKVMQSITETGGGL--RILTQTYACRNGSK.................................... 281
59 -10.600[S] KOG4308 LRR-containing protein  ali follow..  18  193...................................................................................................................................................................................EQGETIFILGDAGVGKSMLLQRLQSLAGVKFFRLCLQDLLFKHYCYPERDPEEVFAFLLRFPHVALFTDELHSDLDLSRVPDSSCPWEPAHPLVLLANLLSGKLLKGASKLL--TARTGIEVPR------LRKKVLLRGFSPSHLRAYARRMFPERALQDRL-LSQLEANPNLCSLCSVPLFC........................................... 394
60 -10.500[F] KOG3347 Predicted nucleotide kinase/nuclear protein involved oxidative stress response  ali follow..  16  4......................................................................................................................................................................................PNILLTGTPGVGKTTLGKELASKSGLKYINVGEEQLYDGYDEEYDCPILDEDRVVDELDNVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVL-----KEEIVHQLPSNKPEELENNVDQ................................................................................................... 158
61 -10.300[F] COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases)  ali follow..  17  3........................................................................................................................................................................................IAITGTPGVGKTTVAKLLAKKLNYEYVSLKD-YFIERELKGKNAVLDGHLSHLMPVDLVVVLRAHPKLIGERLRERGYDREKIGENVEAELVDAVEAIEEHENVIEVDTTNKSDVVEEIVSRVGIVD.............................................................................................. 163
62 -10.300[U] KOG0090 Signal recognition particle receptor, beta subunit (small G protein superfamily)  ali follow..  14  58........................................................................................................................................................................................VLLSGLSGSGKTVLFYQLRDEPNEGTFVLHNENNTKKGKVKGHSRLISKLEEYLPRAAAVVFV--VDALEFLPN-------RAASEYLYDILTNAS---IKNKTPVLLCCNKTDK--VTAHTKEFIRKQMEKEI....................................................................................... 198
63 -10.200[RK] KOG2355 Predicted ABC-type transport, ATPase component/CCR4 associated factor  ali follow..  16  1................................................................................................................................................MAEKDATASGDDAIRVSGMQFAYEVEDPIFFDFNLDLPAGSRLVGANGSGKTTLLKILAGEKLIDLLDINLQWRMHKVSDGQKRRVQ--ICMGLLHPFKVLLLDELDVVARM-----------------DLLEFFKEECDQRGATIVYATHIFDGLETAYIQDGEL............................................................................................... 227
64 -9.950[L] KOG1942 DNA helicase, TBP-interacting protein  ali follow..  18  34.............................................................................................................................................IPIKLAAGFVGQLEAREAAGLVVDM---------KQKKMAGKALLLAGPPGTGKTALALGISQELGVPFCPMVGSEVYSSEVKKTEVLMENFRRALRIKETKEVYEGEVTELSPEETESLTGGYGKSISHVVITLKTVKGTKHIKEKVAVGDVIYIEANSGAVKRVGRSDAFATVPLPKGEVHKKKEIVQDVTLQDLDAANARDILSLMGQMMKPRKTEITDK-----LRQEINKVVNRYIDEGVAELVPGVL........... 302
65 -9.930[O] COG1066 Predicted ATP-dependent serine protease  ali follow..  14  33........................................................................................................................TISEVRLVSSSNSAKGDRFSGYAGETRAKIQTLAEISLQETPRFSSGFHELDRVLGGGVVPGSAILIGGHPGAGKSTLLLQVMCGLAQNMLYVTGEESLQQVAMRSETSVEQICQLADQLKPQIIVIDSIQVMHLADIQSSPGSVAQVRECASFLTRYAK--TRQVAIIMVGHVTK-HCIDCSILLEGEADSRYRT---GAVNELGVFGMTEQGLREVKNPSAIFLSRGEEQTPGSEIQALVDHSMLANPRRVAVGLEQNRLALLLAVLHRHG............ 348
66 -9.700[R] COG3911 Predicted ATPase  ali follow..  16  1................................................................................................................................................................................MQNDFDRVFVLTGGPGSGKTTLIAALR-RAGFATSVVAGRGIVRDQSSIGGTALEMRSYQNAVEQKGPVFFDRPETLGYLRLSGLPVADHVSTAAKRFRYNPRVFIAPPWPDIFAQDEERKQTPDEAKCTYHALAEIVPLPLAPVETRLRFVLADAG........................................................................ 181
67 -9.660[U] KOG0076 GTP-binding ADP-ribosylation factor-like protein yARL3  ali follow..  16  8............................................................................................................................................................................LYNNWNKKEQYSILILGLDNAGKTTFLETLKKEYNVATIPVDSKQILKFWDVGGQESLRSMWSEYYSLCHGIIFI--VDSSDRERLD-------ECSTTLQSVVMD----EEIEGVPILMLANKQDR--QDRMEVQDIKEVFNKIAEHISAR................................................................................. 160
68 -9.560[P] COG4559 ABC-type hemin transport system, ATPase component  ali follow..  14  11.................................................................................................................................................................TDLSYSVAGRELLSKLKFHLQSGLAVLGRNGAGKSTLLKHLTGELGKSGVELFGQPLRDIKPAEAAKRRAVLPQQTPLSFAYEV-----DVVLLGRIPHGQRETVQDRAIAAACLERVG--------LSGYETRDVLTLSGGEQQRVHFARTLAQLHGVIGERVLLLDEPTASLDLAHQHATLRLARELCR-EGVGVLAVLHDLNLAAQYADRVLMLAEGHVIACDHPAVALTPESIRTA.... 239
69 -9.540[T] COG2204 Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains  ali follow..  15  128............................................................................................................................................ATDDSWRNAIVTRSPLMLRLLEQAR-------------AQSDVSVLINGQSGTGKEIFAQAISPRSNKPFVAIN-SELFGHARGAFTGAVSNREGLFQAAEGGTLFLDEIGDMPAPLQVK---QERKVRPLGSNRDIDID-------VRIISATHRPKAMARGEFREDLYYR-VSLKIPALAERTELANHLLRQSAQRHKPFVRAFSTDAASWPGRQLVNVIEQCVALT---SSPVISDALVEQALEG................. 384
70 -9.520[F] COG2019 Archaeal adenylate kinase  ali follow..  12  3........................................................................................................................................................................................SVITGVAGVGKTTVLDIVARESGIPVVNYG-----------------TLMFEVAKRRGLVENRDQIRKLSRET-------QVDLQKLAGEEIGKMENAIVDTHMSIKTPFGYLPGLPEWVLRSINASVFVIIEADPAIIKRRRDNDPTRARDDEGVDSIREHQE-------MNRYFAAAYSIFSGATVKIVKNEEGKPEQAADEIV............... 177
71 -9.280[U] KOG0077 Vesicle coat complex COPII, GTPase subunit SAR1  ali follow..  18  23........................................................................................................................................................................................ILFLGLDNAGKTTLLHMLKDERLVQHQPTQHPTSEELSIGKGHQIARRVWKDYYAKVDAVVYL--VDAYDKERFA-------ESKRELDALLSD----EALATVPFLILGNKIDI--PYAASEDELRYHLGL......................................................................................... 148
72 -9.250[S] COG5324 Uncharacterized conserved protein  ali follow..  394........................................................................................................................................................................................IFPISVIGCGKTTTSQTLVNLFPDSWGHIQNDDITGK---DKSQLMKKSLELLSKKEIKCVIVDRNNHQFRERKQPYDKLSEIRDITLQRVIKRGNNHQSIKW-IMNGFLKRYQPVNLDKSPDNMFDLMIELDFGQADSSLTNAKQILNEIEIPKDDEIETAFRRSLDYKPTVRKIVGKGNNNQQKTPKLIKPTYISAKIENYDEIIELVKRCIASDAELT 656
73 -9.180[R] COG0645 Predicted kinase  ali follow..  10  4........................................................................................................................................................................................AVTHGVSAVGKSQVAMRLVEALGAVRL-------------RSDIERKRLFGEQPEHD-------------RGQFAAGIYSSQASEATYAHLHQLAAKILQAGYPVVIDAANQRQAACHIAEETGVPFLILDCQAPEAVIAGWLAQRQAEGKDPS-DATLDVIRTQQATREPLTAAETVQSKRVDTHDAASLDGLVDGIRQRLPGL................ 185
74 -9.170[F] KOG3079 Uridylate kinase/adenylate kinase  ali follow..  13  35.....................................................................................................................................................................................PLVVFVLGGPGAGKGTQCARIVEKYG--YTHLSAGELLRDERKNPDSQYGELIEKYIKEG-KIVPVEITISLLKREMDQTMAANAQKNKFL------IDGFPRN--------QDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLE---GKSSGRSDDNRESLEKRIQTYLQSTKPIIDLYEEMGKVKKIDASKSVDEVFDEVVQIFDK............. 226
75 -9.040[E] COG4917 Ethanolamine utilization protein  ali follow..  12  2......................................................................................................................................................................................KRIAFVGSVGAGKTTLFNALQGNRKTQAVEFNDKGDIDT--GENHPRWYHALITTLQDVDMLIYV--HGANDPESRLPAGLLDIGVSKRQIAVISKTD-----------MPDADVAATRKLLLETGFEEPMFELNSHDPQSVQQLVDYLASLTKQEE.................................................................. 150

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.