current user: public

If you have questions about the server, please let us know.

Query: [O] KOG0801 Predicted E3 ubiquitin ligase, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .
# Score Template Links and tools%idFirst MGGKQSTAARSRGPFPGVSTDDSAVPPPGGAPHFGHYRTGGGAMGLRSRSVSSVAGMGMDPSTAGGVPFGLYTPASRGTGDSERAPGGGGSASDSTYAHGNGYQETGGGHHRDGMLYLGSRASLADALPLHIAPRWFSSHSGFKCPICSKSVASDEMEMHFIMCLSKPRLSYNDDVLTKDAGECVICLEELLQGDTIARLPCLCIYHKSCIDSWFEVNRSCPEHPADLast
1 -59.500[O] KOG0801 Predicted E3 ubiquitin ligase  ali  100  1MGGKQSTAARSRGPFPGVSTDDSAVPPPGGAPHFGHYRTGGGAMGLRSRSVSSVAGMGMDPSTAGGVPFGLYTPASRGTGDSERAPGGGGSASDSTYAHGNGYQETGGGHHRDGMLYLGSRASLADALPLHIAPRWFSSHSGFKCPICSKSVASDEMEMHFIMCLSKPRLSYNDDVLTKDAGECVICLEELLQGDTIARLPCLCIYHKSCIDSWFEVNRSCPEHPAD 227
2 -39.900[O] COG5540 RING-finger-containing ubiquitin ligase  ali follow..  27  287....................................................................................................................................................GFYSEEEEIENSTQNGELVPLMDESTRRATFGV-ECVICLESFTKGDKVVALPCKHEFHRPCIAKWIDYRHACPTCNTE 365
3 -36.700[O] KOG0800 FOG: Predicted E3 ubiquitin ligase  ali follow..  21  66....................................................................................................................................................GNSLSTIELGLSKELREMLPIVVFKESF-TVMDSQCSVCLGDYQPNDKLQQIPCKHTFHMDCIDLWLTSHTTCPLCRLA 144
4 -36.600[O] KOG4628 Predicted E3 ubiquitin ligase  ali follow..  30  199...................................................................................................................................................IREQRRLRRHRLPKSMLKKLPVLRYTKNNANNKYDTCVICLEDFIEDDKLRVLPCSHPYHTHCIDPWLTENRVCPICKRK 279
5 -34.500[O] KOG0827 Predicted E3 ubiquitin ligase  ali follow..  27  3....................................................................................................................................................................................NLNCVICAELFGQADEVFATVCGHMFHHNCLNQWLDRSKTCPQCRNK 49
6 -34.100[O] COG5243 HRD ubiquitin ligase complex, ER membrane component  ali follow..  22  294......................................................................................................................RMPMMLLKDVVWDILALYQSGTSLWKIWRNNKQLDD-----------TLVTVTVEQQNSANDDNICIICMDELIHSPNPKRLPCGHILHLSCLKNWMERSQTCPICRLP 402
7 -32.400[O] KOG0828 Predicted E3 ubiquitin ligase  ali follow..  22  680....................................................................................................................................................................LSNEYISEHGGGTAEHTVDCAICMSDVPIYQHSYMVPCNHVFHTSCLENWMNYKLQCPVCRSP 754
8 -27.600[O] KOG0802 E3 ubiquitin ligase  ali follow..  22  325...................................................................................................................................................ILKRIKGYIKLRIALGALHAALPDATSEELRAYDDECAICREPM---AKAKRLHCNHLFHLGCLRSWLDQGYSCPTCRKP 405
9 -27.400[O] KOG3970 Predicted E3 ubiquitin ligase  ali follow..  32  47.................................................................................................................................................................................QDYDPNCSLCKTTLAEGDTIR-LNCLHLLHWKCFDEWAANFPRCPCCSQE 103
10 -26.400[O] KOG1645 RING-finger-containing E3 ubiquitin ligase  ali follow..  3.................................................................................PRRSYPFSGHGGTIARFIEFGEAFGHYGEEEDEEEEDEEEAYVDYGEVQEEDEEEEEEEDSERQTREYIDVLDSPVRVSQNESEGIENQNRRMSNGNKVTLRDCLVLSVWKFGPAVANTKSGILDSIVFPVDTCMSTSGFSSDEVE 152
11 -24.700[S] KOG4445 Uncharacterized conserved protein, contains RWD domain  ali follow..  24  58....................................................................................................................................................PRGLDDARLEAIRSACNAKIKESIGFPVVNLPSGQCVVCLYGFADGDEFTRTECFHYLHSYCLARHLNALRLCPVCREH 173
12 -24.600[O] KOG1734 Predicted RING-containing E3 ubiquitin ligase  ali follow..  12  261..................................................................................................................................VLGRDFAHICTARMASRIGYYTPEGLPKKHLEDGVCAVCGGRLDDSEHVHDADAVVTTKMVEDEEKLYKLSCGHVFHEFCIRGWVVKLQTCPYCKER 360
13 -24.500[O] KOG0320 Predicted E3 ubiquitin ligase  ali follow..  15  231....................................................................................................................................................RRSAENDPVVDLDVASPPKRVNRDIDESQKEELYKCPICMDSVSKREPVS-TKCGHVFCRECIETAIRATHKCPICNKK 308
14 -23.200[OD] COG5194 Component of SCF ubiquitin ligase and anaphase-promoting complex  ali follow..  15  1...............................................................................................................................MSNEVDRMDVDEDESQNIAQSSNQSAPVETKKKRFEIKKWTAVAFWSWDIAVD--NCAICRNHIDNECVAAWGVCNHAFHLHCINKWIKTRDACPLDNQP 113
15 -22.800[O] KOG0823 Predicted E3 ubiquitin ligase  ali follow..  16  81....................................................................................................................................................RSRERLVENGENKTYLIAKALNMEKTSSVPGGFFDCNICLEKAE--DPILTC-CGHLFCWGCFYQLPLIYLECPVCDGE 159
16 -22.700[DO] KOG1493 Anaphase-promoting complex (APC), subunit 11  ali follow..  28  66.................................................................................................................................................................................QGGEDTCGICRMEFESACNMCKFPCRHAFHRHCIDKWIAAPTQCPLCRQD 130
17 -22.200[O] KOG3800 Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor  ali follow..  22  1.....................................................................................................................................................................................KECKKCKSNEYTNKQLVMMECGHPLCKNCVDNIFALNSNCHVCN.. 47
18 -22.000[O] KOG2930 SCF ubiquitin ligase, Rbx1 component  ali follow..  14  37....................................................................................................................................................................IVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGCNHAFHFHCISRWLKTRQVCPLDNRE 100
19 -21.400[T] COG5432 RING-finger-containing E3 ubiquitin ligase  ali follow..  21  23..................................................................................................................................................................................DTLLRCHICKDFLK--VPVL-TPCGHTFCSLCIRTHLNNQPNCPLCLFE 68
20 -21.400[L] KOG0287 Postreplication repair protein RAD18  ali follow..  21  23..................................................................................................................................................................................DTLLRCHICKDFLK--VPVL-TPCGHTFCSLCIRTHLNNQPNCPLCLFE 68
21 -21.000[O] KOG0978 E3 ubiquitin ligase involved in syntaxin degradation  ali follow..  11  810....................................................................................................................................................EELMELNKELEELGSESVEAAIVRLQEEVKNNILKCGVCFDRPK--EVV--VKCYHLFCQQCIQRSLERHRKCPGCG.. 886
22 -20.900[O] KOG4265 Predicted E3 ubiquitin ligase  ali follow..  26  244.....................................................................................................................................................DRVSYLLQEIYGIENKNNQETKPSDDENSDNSNECVVCLSD----DTL--LPCRHL--TSCADTLRYQANNCPICRLF 319
23 -20.800[O] KOG1813 Predicted E3 ubiquitin ligase  ali follow..  19  266............................................................................................................................................................................SDEDENALPFACFICREPFV--DPVV-TKCKHYFCEHCALKHHTKNKKCFVCNQP 317
24 -20.800[R] COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers  ali follow..  19  243............................................................................................................................................................................KNEKKEDIPFVCLICKKDYR--SPIA-TTCGHHFCEQCAITRYRKTPTCIQCGAD 294
25 -20.700[O] KOG0824 Predicted E3 ubiquitin ligase  ali follow..  18  1................................................................................................................................................................MNASTSSPSQQLQQAINSTIDKECAVCYSEMI--LPTT-IPCGHKFCFICLKGSVSNNGDCPICRGP 66
26 -20.700[O] KOG0317 Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein  ali follow..  15  251....................................................................................................................................................SEHESIEGIPKESQLTHINLSDKNQLPFIPEASRKCILCLMNMS---DPSCAPCGHLFCWSCLMSWCKERPECPLCRQH 326
27 -20.700[O] KOG3268 Predicted E3 ubiquitin ligase  ali follow..  16  276........................................................................................................................................................PENSVLQNLKDVLEIDFPARAILEKSDFTMDCGICYAYQLDGTVCDNSQCGQPFHQICLYEWLRIFGECPYCSKP 365
28 -19.900[R] KOG4299 PHD Zn-finger protein  ali follow..  85..VKRKHVNGEGAEKGDHDTSNNGPSITKLRRKVRRTYDTKDGFVAWNTLDDDFRPIVPDQERSRKINPQKGNNNNLLKENKSLKTTAKDLSDISSSSMKKANNSSKPLFSGKLTFKANIPVPTSEVVTENNVTRNVTVYSNQKHLGNESENFNDMEGRAEDISSNELLPTPEEYPYRYNNDYCSAC----GPGNFL----CPNSFHFTCIDPWY-----CNECKHH 312
29 -19.800[O] KOG4692 Predicted E3 ubiquitin ligase  ali follow..  17  433...................................................................................................................................................FPSHVSSEEIDNVRRLIDSLRVKQTLLSDITLPSEDCPICCAK----ITAVFTPCKHQSCSDCIMQHMMNSKVCFYCKTT 511
30 -19.600[O] KOG1571 Predicted E3 ubiquitin ligase  ali follow..  16  256.....................................................................................................................................................KQEREEAKIRERLDTERRERRARSRPHTLSQDQLCVVCSTN-----EIILLPCGHV--EDCAQ---KISVTCPVCRGS 328
31 -19.400[U] KOG2066 Vacuolar assembly/sorting protein VPS41  ali follow..  11  693...................................................................................................................................LSEALDKLLVDYTNHAELQQCCYDSTLNDLNVLTQGLISAADESVSVNIVSRCSLCAQIIKKFSDIKVFKCGHIFHLACSTS--IEEGLCIACSDQ 801
32 -18.900[O] KOG0826 Predicted E3 ubiquitin ligase involved in peroxisome organization  ali follow..  14  209....................................................................................................................................................NDQRRKVGGTLINPEAMPRKQLPKEVQQSLPQRGECPVCLLSIQTPTACS--VSGYVFCWKCIVSHMKEHGTCPVTHYP 285
33 -18.800[O] KOG2164 Predicted E3 ubiquitin ligase  ali follow..  12  2LNGEKSALGEMPSNSNSSSKLNAKSPNFIPSSSNIPRSSAKTKEHSADRKPHRNSEKKTQGMPRKNQQLASSERKTKNKKRLEKQSSAIADSIGESLDDPQTVYDEHLFDILSARTNKRGQINLNHLLNFQFTPRTNSNAFSAPPRRSRGYNTYGQGSGHHPRFVVSPIGDYQSQKLDPDS-ACPFCLEEKPVAARMSR--CGHVYCFSCLLRFVETPTACPICW.. 273
34 -18.500[R] COG5219 Uncharacterized conserved protein, contains RING Zn-finger  ali follow..  16 1456....................................................................................................................IESEDFQSVGDVNVKVNRNTREISFIYNVDEHKLEMAPSVYPLQNVQVEGIERVGVNERQ--EGVEECAICYSVLSVE---RTLPCRHKFHASCLYKWFKSSSRCPLCRSS 1606
35 -18.300[R] KOG4323 Polycomb-like PHD Zn-finger protein  ali follow..  1MSQKNFFDEGKSYENGADSSLPQVSAQGVVRETDSSNFDASPVASGSGISDVGPFGADFHQLQQHVQTPYGGMTMPASSSSGATSVPPEQDPSLSVSFNRLPKSASTKTKNGRIRSSRREDDNRIPFYDLDVAEGAEDDLQEDFHVEGMKTKSGRKIQRPVAYNPNATALKRKSRKVDMVT--CSVCQRHSPLSNRI----CNSPYHQLCHHPWF-----CMKCQYR 246
36 -17.900[A] COG5183 Protein involved in mRNA turnover and stability  ali follow..  17  4....................................................................................................................................................DSDVNVSRLRDELHKVANEETDTATFNDDAPSGATCRICRGEATEDNPLFH-PCKCRYHESCLLEWVASKNICDICHYP 96
37 -17.700[S] KOG4638 Uncharacterized conserved protein  ali follow..  356.........................................................................................................................................................................SYATTEQATCVPSARRRCTPQFFFAANTCFAKSGEVFLHIAIIFVYE........... 406
38 -17.600[O] KOG4275 Predicted E3 ubiquitin ligase  ali follow..  17  619.....................................................................................................................................................KGCCEKQELLDRVSRLWKTMRECPAVEKLATDELCKICMDA-----ECVFLECGHM--TSCGKV-----NECPICR.. 688
39 -17.200[O] COG5574 RING-finger-containing E3 ubiquitin ligase  ali follow..  13  322.................................................................................................................................................FQVIESDPLLLVDNASKAICFSLSSKLFSIIPQLRDFECAICSNVA---KPVR-LGCSHVFCLHCLIILQKQKVFCPLCRAK 401
40 -16.800[O] KOG1100 Predicted E3 ubiquitin ligase  ali follow..  14  256........................................................................................................................................................SNDEGDSEEERWKLAGEAQDTKKMCRVGMSMCRSCGKG-----SVLLLPCRHM--SVC--------NTCPICKS. 323
41 -16.800[DKL] COG5220 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3  ali follow..  18  1...........................................................................................................................................................................MDDEGARKVDEKCPLCQADRYLNPNMKNPECYHKMCESCVDRIFTTGPATPGCN.. 60
42 -16.400[U] KOG2114 Vacuolar assembly/sorting protein PEP5/VPS11  ali follow..  13  789.............................................................................................................................SVIKDYIARKLEQESKIIEEDRRAVEKYQETTKN-----MRKEIEDLRTNARIFQLSKCTACTFTLDI--PAVHFMCMHSFHQRCLG---DNEKECPECAPE 880
43 -16.200[O] KOG1039 Predicted E3 ubiquitin ligase  ali follow..  21  207........................................................................................................................................................EQRKAHEKICMLTFEHEMEKAFAFQASQDKVCSICMEVIASERRFGILSCNHTYCLSCIRQWRCAKKSCPECR.. 292
44 -15.900[U] KOG2034 Vacuolar sorting protein PEP3/VPS18  ali follow..  12  790...................................................................................................................................FKEAICSSLEDYNKQIEQLKEEMNDATRGADNIRNDISALTQRYAVIDRDEECGVCYSSAGPLAPFYVFPCGHSFHAQCLITHVTIASECPFC... 952
45 -15.000[R] COG5222 Uncharacterized conserved protein, contains RING Zn-finger  ali follow..  16  286...................................................................................................................................................................................DDLKCPLTGGLLR--QPVKTSKCNIDFSKEALENALESDFVCPNCETR 333
46 -14.800[B] KOG1973 Chromatin remodeling protein, contains PHD Zn-finger  ali follow..  18  243....................................................................................................................................................KTVEVDDSEKESCHTAATHPSDVMDMPVDPNEPTYC-LC-HQVSYGEMIG--DCPI-FHFACV-KWF-----CPKCTQD 324
47 -14.700[S] KOG2660 Locus-specific chromosome binding proteins  ali follow..  21  11..................................................................................................................................................................................RACLSCSICDNILRDA---------TTISEKCIYEKITEDETCPVCNID 52
48 -14.500[O] KOG2879 Predicted E3 ubiquitin ligase  ali follow..  11  282....................................................................................................................................................MLLLLLPLLNSSAVKNILSPFAKDKSSSTKEDTVTCPICQVDPAIPFIALKELTCRRYCYYCIRTRCASAARCLRCNEP 376
49 -14.400[K] KOG1244 Predicted transcription factor Requiem/NEURO-D4  ali follow..  21  326...................................................................................................................................................................................ECKCCNICGTSENDDQLLFCDDCDRGYHMYCLTPW-----SCHLCL.. 375
50 -14.300[O] KOG2231 Predicted E3 ubiquitin ligase  ali follow..  11  1........................................................................................................................................MQNGKPRSSARPSFHRRPKDGVANTTTDNAAVKPEALESYTGNDDNACVVCFKNFSIG------DCDHPVCYECSTR-LCQQNECPICRHV 90
51 -14.200[B] COG5034 Chromatin remodeling protein, contains PhD zinc finger  ali follow..  16  216....................................................................................................................................................VRRSESRLKQTNGEPLVKHDTLDSSDISREGEQLYC-YC-QQVSYGQMIG--NCKR-FHLPCV-IWY-----CKECEEL 297
52 -14.200[A] KOG1609 Protein involved in mRNA turnover and stability  ali follow..  14  6.........................................................................................................................................SINSAISSNSSLSLASTQVQSPEKPVRPAWLLASFSESTTSGSRRICRICQMH----EGDMVRPCDCDVHEECLTKWVNMSNKCEICKSE 98
53 -14.000[B] KOG4718 Non-SMC (structural maintenance of chromosomes) element 1 protein (NSE1)  ali follow..  22  164......................................................................................................................................................................LEMEQYIRETYPDAVKICNICHSLLIQGQSCET--CGIRMHLPCVAKYFQSNARCPHCNDY 224
54 -13.600[K] COG5175 Transcriptional repressor  ali follow..  17  1.......................................................................................................................................................MMNPHVQENLQAIHNALSNFDTSFLSEDEEDYCPLCIEPMDITDK----PCPCGYQ--CQFCY-ELNGRCPACR.. 78
55 -13.600[DR] KOG1101 Apoptosis inhibitor IAP1 and related BIR domain proteins  ali follow..  15  536....................................................................................................................................................YKNLFVDKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDK-----SVVFIPCGHLV-QECAPS-----RKCPICR.. 606
56 -13.300[R] KOG3002 Zn finger protein  ali follow..  14  1...............................................................................................................................MAPGGSALKEALESNSTGVDYEVKMAKVEANSKPTKSGSGSIGKFHSSNGVYELLECPVCTNLMYP-------PCPN--HTLCSSCKLRVQNTCPTCRYE 95
57 -13.000[O] KOG4185 Predicted E3 ubiquitin ligase  ali follow..  21  2...................................................................................................................................................................................SFIDCEICDEEFSTLTDVNILRCGHTTCHGCAEKLLRNSTLCPFCR.. 51
58 -13.000[L] COG5627 DNA repair protein MMS21  ali follow..  18  177............................................................................................................................................................................TEEQEADEDNRCPLTLQPIV--HPILSTACNHFYEKDAILSLLNPTCVCPVCE.. 237
59 -12.900[DR] KOG4739 Uncharacterized protein involved in synaptonemal complex formation  ali follow..  14  5......................................................................................................................................................................................QCNHCGIKPN-QTKLYLTACGHVFCQNCTKAA--FNSQCYLCKKP 46
60 -12.700[S] KOG4791 Uncharacterized conserved protein  ali follow..  20  1................................................................................................................................................................................MPNQGEDCSTCTK----GDS-----C---FHCEC---WQE--GRCRVCRF. 52
61 -12.400[K] KOG4218 Nuclear hormone receptor betaFTZ-F1  ali follow..  17  2.................................................................................................................................................SSNSDTGDLQESLKHGLTPIVSQFKMVNYSYDEDLEELCPVC------GDKVS---CKGFFKRNCIDK--TQRKRCPYCRFQ 98
62 -12.100[S] KOG4367 Predicted Zn-finger protein  ali follow..  12  5..................................................................................................................................................................................EEELKCPVCGSFYRE----IILPCSHNLCQACARNILVQTPQSHRAAGS 55
63 -12.100[O] KOG1814 Predicted E3 ubiquitin ligase  ali follow..  10  138...................................................................................................................................................LPTEMVFPGGFDDLKKEILAFDKNAKLLEFQIRKFQCNVCFDEFNGTDCFQLTRCGHVSCQSCLRDYYTMC-KCI-CG.. 225
64 -12.000[R] KOG2979 Protein involved in DNA repair  ali follow..  23  248......................................................................................................................................................................................TCPLSGKPVTE-DPVRSMDCRHVYEKSVILHYIVNNPNCPVCR.. 295
65 -11.800[K] KOG2169 Zn-finger transcription factor  ali follow..  16  387.....................................................................................................................................................NQNVSRHRSLEVTKQEVIKKLSGGEDDIAMDRLNDPLCKTRMTT--PSRCQDCT---HLQCFDTW-----QCPVCSSN 470
66 -11.800[S] KOG3899 Uncharacterized conserved protein  ali follow..  13  253.................................................................................................................................RNLENRVRRPIAIPSNIQLHRNVIDRFVDVFKAQVAQNPIFPDDA-----TTEKCFACMLN-ANGACCSNCYCRPMWCVECLEVWLEQKCTCPMCRA. 376
67 -11.700[T] KOG0297 TNF receptor-associated factor  ali follow..  17  29..................................................................................................................................................................................EAKYLCSACRNVLR---RPFQAQCGHRYCSFCLASILSSGPNCAACVHE 75
68 -11.700[O] COG3058 Uncharacterized protein involved in formate dehydrogenase formation  ali follow..  15  171....................................................................................................................................................................MANLIPGKARAEYGEQRQYCPVCSSMVQIGTTLRYLHC-----NLCETEWHVVRVKCSNCEQS 235
69 -11.700[O] KOG4159 Predicted E3 ubiquitin ligase  ali follow..  18  6..................................................................................................................................................................................................EPVT-TPCGHSFCKNCLERCLDHAPYCPLCKES 37
70 -11.600[R] COG5236 Uncharacterized conserved protein, contains RING Zn-finger  ali follow..  14  29....................................................................................................................................................NDRKNFRRKQKKNNLSAEPNLTTSSADDTDEENELCVICARKL---TYVSLTPCHHKTCHICGFRQLYNKKSCLICRTE 106
71 -11.200[T] KOG3575 FOG: Hormone receptors  ali follow..  11  2.....................................................................................................................................................SPLKMHVNMLQSDHALIMSSFPEPSPSSKRPTENCKVC------GDRPN---CTVFFRRNCISC--TYRNACRYCRFQ 94
72 -11.200[R] KOG3138 Predicted N-acetyltransferase  ali follow..  20  3............................................................................................................................................................................RPSNWDDPQGPCRYCESPVEDDNYLECQECRRMVHIKCLDVFFE---TCVKCVLD 66
73 -11.200[K] KOG2068 MOT2 transcription factor  ali follow..  27  3.................................................................................................................................................................................DYGEKTCPLCAEEMDLTDQ---KPCKCGYQ--CVWCW-QSEGRCPACR.. 57
74 -11.100[O] KOG2817 Predicted E3 ubiquitin ligase  ali follow..  11  326........................................................................................................................................................................EIFLPSSYHFHSVFTCPVSKEQATEENPPMMMSCGHVIVKESLRQLSRNGSKCPYCPNE 387
75 -11.100[R] COG5109 Uncharacterized conserved protein, contains RING Zn-finger  ali follow..  11  326........................................................................................................................................................................EIFLPSSYHFHSVFTCPVSKEQATEENPPMMMSCGHVIVKESLRQLSRNGSKCPYCPNE 387

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 6 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.