current user: public

If you have questions about the server, please let us know.

Query: [J] KOG0900 40S ribosomal protein S20, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst MAFKDTGKTPVEPEVCADLIRGAKEKNLKVKGPVRMLTKTLRITTRKTPCGEGSKTWDRFQMRIHQRLIDLHSPSEIVKQITSISIEPGVEVEVTIAGCLSQQFLast
1 -73.000[J] KOG0900 40S ribosomal protein S20  ali  100  1MAFKDTGKTPVEPEVCADLIRGAKEKNLKVKGPVRMLTKTLRITTRKTPCGEGSKTWDRFQMRIHQRLIDLHSPSEIVKQITSISIEPGVEVEVTIAGCLSQQF 104
2 -49.400[J] COG0051 Ribosomal protein S10  ali follow..  20  6IRIRLAYDHRVLDQSAEKIVETAKRSGANVSGPIPLPTEKSVYTILRAVH-KYKDSREQFEMRTHKRLIDIVNTPQTVDALMRLDLPSGVDIEIKL........ 102
3 -46.000[J] KOG3321 Mitochondrial ribosomal protein S10  ali follow..  15  43ADIQLSYDNENLDFYSDFILRTGYYLGIPLTGPKPLPTRRERWTVIKSPF-VHAKSKENFERHTHKRLIRAWDTNQMLIAYITKHSMAGVGMKCNFFQRSEISL 150
4 -37.800[S] KOG4060 Uncharacterized conserved protein  ali follow..  19  95LNIHLAYDMTLAESYAQYVHNFCNSLSIKVEESYVMPTKTTEVLWLQDQ---GSKTFLDSVLTTHERVVHISSLSEIFLEIIQSSLPEGVRLSLKEHTEEDFK. 199
5 -6.640[S] COG2880 Uncharacterized protein conserved in archaea  ali follow..  11  3..................................................................KIIEAIYENGVFKPLQKVDLKEGERVRIKLEKVEE... 37
6 -5.330[J] KOG3499 60S ribosomal protein L38  ali follow..  17  28....................................................NTNKDVKFKLRCSKYLYTLVVADAKKAEKLRQSLPPDLTVT........... 68
7 -5.240[S] KOG4147 Uncharacterized conserved protein  ali follow..  10VRLIRSFEHRNLDQTVKEFIVFLKQ-DIPLRTNLPPPFRNYKYDALKIIHQAHKS-------KTNELVLSLEDDERLLLKEDSTLKAAGIASETEIAFFCEEDY 115
8 -4.770[P] COG2837 Predicted iron-dependent peroxidase  ali follow..  272VR-LIQFRVEFWDRTPLKEQQTIFGRDKQTGAPLGMQHEHD------VPDYASDPEGKVIALDSHIRLANPRTAESESSLMLRRGYSYSLGVTNSGQLDMGLLF 368
9 -4.370[G] KOG2772 Transaldolase  ali follow..  14  77..................FVVFGKEILKTIPGRVSTEVDARLSFDTQASIDRALGLIAQYEKEGISKLIKLASTWEGIRAAKFLESKHGIHCNMTLLFNFEQA. 164
10 -4.240[S] KOG3267 Uncharacterized conserved protein  ali follow..  12  166LNVQETLRDGVDIDDVDEDVDEDEDLDLDLETVTTVPLNNEQLNA-KVTTTTSSSSAASSALAKFNRIIDVAVDYSGLPQLSSATLQQRFNLELVNQQQQQQQ. 277

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 5 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.