current user: public

If you have questions about the server, please let us know.

Query: [R] KOG1129 TPR repeat-containing protein, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .
# Score Template Links and tools%idFirst MQCLSDSTYVDELENEDMGLAETFLDQNVIAPNARPGTSFARPKTSAKGVNPILRPTTNAGRPLSGVVRPQSSFKSGSMDQAVRTARTAKTARAVSSTSARNMRLGTASMAAGADGEFVNLARLNIDKYAADPQVNRQLFEYVFYYLNDIRVAHQIAGTASKAAGFEDYYWKNQLAKCYLRLGMLQDATKQLQSSLEQKKLIETFALLSKAYNRVDQPMAALKTYSAGLEVFPENVTMLTGMARVQEALGEYDESVKLYKRVLDAESNNIEAIACVATTYYYGGKPELAMRYYRRILQMGVSSPELFLNIGLCCMAAQQFDFALSSILRAQSTMTDDVAADVWYNIGQILVDIGDLVSAARSFRIALSHDPDHSESLVNLGILKHREGKIDEARSLYSSATSKNPYMFEGNYNLGLVSFTQGKYHECRELIEKALAAFPEHEHCKKILNHLKPLYESILast
1 -113.000[R] KOG1129 TPR repeat-containing protein  ali  100  1MQCLSDSTYVDELENEDMGLAETFLDQNVIAPNARPGTSFARPKTSAKGVNPILRPTTNAGRPLSGVVRPQSSFKSGSMDQAVRTARTAKTARAVSSTSARNMRLGTASMAAGADGEFVNLARLNIDKYAADPQVNRQLFEYVFYYLNDIRVAHQIAGTASKAAGFEDYYWKNQLAKCYLRLGMLQDATKQLQSSLEQKKLIETFALLSKAYNRVDQPMAALKTYSAGLEVFPENVTMLTGMARVQEALGEYDESVKLYKRVLDAESNNIEAIACVATTYYYGGKPELAMRYYRRILQMGVSSPELFLNIGLCCMAAQQFDFALSSILRAQSTMTDDVAADVWYNIGQILVDIGDLVSAARSFRIALSHDPDHSESLVNLGILKHREGKIDEARSLYSSATSKNPYMFEGNYNLGLVSFTQGKYHECRELIEKALAAFPEHEHCKKILNHLKPLYESI 458
2 -77.600[O] KOG0548 Molecular co-chaperone STI1  ali follow..  13...FSSGDFTTAINHFTEAIA---LAPTNHVLFSNRSAAHASLHQYAEALSDAKETILKPYWPKGYSRLGAAHLGLNQFELAVTAYKKGLDVDPTNEALKSGL--ADAEASVARSRAAPNPFGDAFQGPEMWTKLTSDPSTRGFLQFVNMMQEIQKNPSSLNLYL-KDQRVMQSLGVLLNVKFRPPPPQGDEAEVPESMGQSSSNEPEVEKKREPEPEPEPEVTEEKEKKERKEKAKKEKELGNAAYKKKDFETAIQHYSTAIEIDDEDISYLTNRAAVYLEMGKYNECIEDCNKAVERGRELRSDYKMVARALTRKGKMAKCSKDYEPAIEAFQDPKLGDEEREKGNDFFKEQKYPEAIKHYTEAIKRNPNDHKAYSNRAASYTKLGAMPEGLKDAEKCIELDPTFSKGYSRKAAVQFFLKEYDNAMETYQAGLEHDPSNQELLDGVKQINKANRGD 505
3 -72.100[R] KOG1124 FOG: TPR repeat  ali follow..  13  22....FSLSFLTPQIPENLCKS---PTKIHIGTHGISGQSFLSHPTFSSKNTYLYAVV-SSGVFSPQKESANGEGEESNTEEGVLVVRRPLLENSDKESSEEELYKAKVLARNFRYKDAEKILEKCIAYWPEDGRPYVALGKI-LSKQSKLAEARILYEKGCQSTQGENSYIWQCWAVLENRLGNVRRARELFDAATVAKKHVAAWHGWANLEIKQGNISKARNLLAKGLKFCGRNEYIYQTLALLEAKAGRYEQARYLFKQATICNSRSCASWLAWAQLEIQQERYPAARKLFEKAVQASPKNRFAWHVWGVFEAGVGNVERGRKLLKIGHALNPRD--PVLLQSLGLLEYKHSSANLARALLRRASELDPRHQPVWIAWGWMEWKEGNTTTARELYQRALSIDANTESALQAWGVLEQRAGNLSAARRLFRSSLNINSQSYVTWMTWAQLGDTERA. 531
4 -71.800[U] KOG0547 Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72  ali follow..  138...FTAKNFNEAIKYYQYAIE---LDPNEPVFYSNISACYISTGDLEKVIEFTTKALIKPDHSKALLRRASANESLGNFTDAMFDLS-VLSLNGDFDGASIEPMLERNLNKQAM-ENLSKDEGRGSQVLPSNTSLASFFGIFSVNTSSNYDTAYALLSDALQRLYSADEGYLVANDLLTKSTDMYHSLLSANTVDDPLENAALALCYTGIFHFLKNNLLDAQVLLQESINLHPT-PNSYIFLALTLADKENSQEFFKFFQKAVDLNPEYPPTYYHRGQMYFILQDYKNAKEDFQKAQSLNPENVYPYIQLACLLYKQGKFTESEAFFNETKLKFPT--LPEVPTFFAEILTDRGDFDTAIKQYDIAKRLEEVQEKIHVGIGPLIGKEEKFNAAIKLLTKACELDPRSEQAKIGLAQLKLQMEKIDEAIELFEDSAILARTMDEKLQATTEAAKIQKRL 616
5 -71.700[DO] KOG1155 Anaphase-promoting complex (APC), Cdc23 subunit  ali follow..  12  103...FDCREYRRASHMLRDQVSEKRKEEEMIELEGPLGKSDAINRELVSLERDLSALRTGAIDSFGLYLYGVVLKEKGNESLARASLVESVNSYPWNWSAWSELQSLCTSIE-----------ILNSLNLNNHWMKEFFLGN-AYQELRMHTESLAKYEYLQGIFS-FSNYIQAQTAKAQYSLREFDQVEIMFEELLRNPYRVEDMDLYSNVLYAKEACAALSYLAHKVFLTDKYRPESCCIIGNYYSLKGQHEKAVMYFRRALKLNKKYLSAWTLMGHEYVEMKNTPAAIDAYRRAVDINPTDYRAWYGLGQAYEMMGMPFYALHYFRKSIFFLPND--SRLWIAMAKCYEQLYMLEEAIKCYKRAVNCTDTEGIALNQLAKLHQKLGRNEEAAYYFEKDLERGPNMFEALVFLATHFKNHKKFEEAEVYCTRLLDYSGPEKEKAKSLAQTGFPSMDL 574
6 -71.600[DO] KOG1174 Anaphase-promoting complex (APC), subunit 7  ali follow..  13  54...FHDKEYRNAVSKYTMALQQKQCLPSEIEVKYKMAECYTMLKQDKDAIAILDGIPSRQRTPKINMMLANLYKKAGRERPSVTSYKEVLRQCPLALDAILGL-----LSLSVKGAEVASMTMNVIQTVPNLDWLSVWIKAYAFVHTGDNSRAISTICSLEKKS-RDNVDLLGSLADLYFRAGDNKNSVLKFEQAQMLLYLIKGMDVYGYLLAREGRLEDVENLGCRLFNISDQHAEPWVVSGCHSFYSKRYSRALYLGAKAIQLNSNSVQALLLKGAALRNMGRVQEAIIHFREAIRLAPCRLDCYEGLIECYLASNSIREAMVMANNVYKTLGAN--AQTLTLLATVLEDPVTQEKAKTLLDKALTQRPDYIKAVVKKAELLSREQKYEDGIALLRNALANQSD-CVLHRILGDFLVAVNEYQEAMDQYSIALSLDPNDQKSLEGMQKMSPTDATQ 529
7 -70.500[T] KOG4162 Predicted calmodulin-binding protein  ali follow..  15  351.EVILLLLIAEALAVRDTVLSQSP--GNVTAVYDLLTLATVRWGLVQLLNESFEKALFSFGEQHVWRQYGLSLMAAEKHSHALRVLQESMKLTPSDPLPCLLAS-RLCYESLETVKQGLDYAQQALKREPSRSQLFVGIGNLKSERDACHKLALDALERAVQFDG-NDHLAEYYLSLQYALLGQLAEALVHIRFALALMEHAPCLHLFALLLTSSRRPREALGVVEDALHEFPDNLQLLHVKAHLQLHLEDAETALGTVQHMLAVWRDVYEAVSRVEQALSEAASSLSSFTQRPGPRRPWMLQIEIWLLLADVYLRIDQPNEALNCIHEASQIYPLS--HQIMFMRGQVHVYLEQWFDAKQCFLNAVAANPNHTEALRALGEAHLVLGEPRLAEKMLKDAAKLDPSCPKIWFALGKVMEILGDFHASADCFATSLQLEPSCPVLPFTSIPL....... 858
8 -68.700[DO] KOG1173 Anaphase-promoting complex (APC), Cdc16 subunit  ali follow..  28.QFIDMRRYSTALFWAEKVAV---LGGLEPRDIYYQAQCMYLLGEYHRAAHTIQHHKLEKNSSSIYLMKGKVYEALDNRGMAMDFYVQALHKSIYCFEALEALDSSSRRRSRDHDTDTLIPIAECLDRVQRSTDLMAAEAE-KCFYDCDYKQCLKILNELLKVDP-FHNTALTIQIACLVENGDFNRLFYVAHKLVDRPDKAISWYAVGCYYDMIGKSDPARRYLSKATALDRLYGPAWLAYGHSFANENEHEQAMAAYFKATQLMRGCHLPLLYIGVECGLTKNLELAEKFFLQAMNIAPLDVYVLHELGVIKYEYEFFDGAATIFQCTVDIVKQRAKSNLFINLGHSLRKVHKYEEALYNFQYALLLKPQSPTTYTSIGFIHALLGNLDPAIEAFHKSLALNRDCIVTSTILKSCIEDLMDDSATIDEICSAALRDVAKNITANSRRVLDKFNGMK 694
9 -67.200[B] KOG1156 N-terminal acetyltransferase  ali follow..  11  1MPAVSHKQYRNGLKFCKQILSNPK-FAEHGETLAMKGLTLNCLGKKEEAYELVRRGLNDLKSHVCWHVYGLLQRSDKKYDEAIKCYRNALKWDKDNLQILRDL--SLLQIQMRDLEGYRETRYQLLQLRPAQRASWIGYA-IAYHLLEDYEKILEEFRKTQQTSPYEYSELLLYQNQVLREAGLYREALEHLCTYEKQCDKLAVEETKGELLLQLCRLEDAADVYRGLQERNPENWAYYKGLEKAL-KPANMLERLKIYEEAWTKYPRGLVPR-RLPLNFLSGEKFKECLDKFLRMNKGCPPVFNTLRSLYKDKEKVAIIEELVVGYETSLKSEPPTTLLWVQYYLAQHYDKIGQPSIALEYINTAIESTPTLIELFLVKAKIYKHAGNIKEAARWMDEAQALDTADRFINSKCAKYMLKANLIKEAEEMCSKFTREGTSAVENLNEMQAMNKFGEAL 505
10 -65.900[D] KOG1126 DNA-binding cell division cycle control protein  ali follow..  12  11.YCIDNQNYDNSIFYSERLHA---IEDSN-ESLYLLAYSHFLNLDYNIVYDLLDRVIGHPDASCMLDVLGTMYKKAGFLKKATDCFVEAVSINPYNFSAFQNLTKWFDRVDASELPGSEKERHQSLKLQSQ-SQTSKNLLAFNDAQKADSNNRDTSLKSHFVEPRTQALRPGARLTYKLREARSSKRGESTPQSFREEDNNLLKLFGKGVYLLAQYKLREALNCFQSLPIEQQNTPFVLAKLGITYFELVDYEKSEEVFQKLRDLSPSRVKDMEVFSTALWHLQKSVPLSYLAHETLETNPYSPESWCILANCFSLQREHSQALKCINRAIQLDPT--FEYAYTLQGHEHSANEEYEKSKTSFRKAIRVNVRHYNAWYGLGMVYLKTGRNDQADFHFQRAAEINPNNSVLITCIGMIYERCKDYKKALDFYD.......................... 557
11 -64.400[V] KOG0624 dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains  ali follow..  3...IYQHLLILWSSLFASTFA---GTAEEVAKHLELGSQFLARAQFADALTQYHAAILDPKSYQAIYRRATTYLAMGRGKAAIVDLERVLELKPDFYGAR--IQRGNILLKQGELEAAEADFNIVLNHDSSNNDVQEKTALISAYAGGDCATVEEYINHIIEIQV-WDASLYRMRAKCLEERGELKKAIHDMRIVSKLTDSTDTMFETSKLLYTVGDLEESLNVIRECLKLNPDHKSCYPFYKKLKVENSDWMACLEEGQKTMKFDPTPLNVFRITNRCQREAGHISEAIAECNEILNDDPSDADILCERAEAHILDEDYDSAIEDYQKATEVNPDH--REAKEGLEHA--KRLKTQAGKRDYYKILGVKRNASKREITKAYRKLAQKWHPDNFSDEEEKKKAEKKFIDIAAAKEVLQEKRRQFDQGVDPLDPEAQRQGGGHHGGFGHG......... 468
12 -62.500[S] KOG4648 Uncharacterized conserved protein, contains LRR repeats  ali follow..  11  1............MTSANKAIE---LQLQVKQNAEELQDFMRDLENWEKDIKQKDMELNFRKKKKGKAKESSKKTREENTKNRIKSYDYEAWAKLDVDRILDELDKDDS--THESLSQESESEEDGIHVDSQKALVLKEKGN-KYFKQGKYDEAIDCYTKGMDADP-YNPVLPTNRASAYFRLKKFAVAESDCNLAVALRSYTKAYSRRGAARFALQKLEEAKKDYERVLELEPNNFEATNELRKISQALASKSTEGERKQIEAQQNKQQAISEKDRGNGFFKEGKYERAIECYTRGIAADGANALLPANRAMAYLKIQKYEEAEKDCTQAILLDGS--YSKAFARRGTARTFLGKLNEAKQDFETVLLLEPGNKQAVTELSKIKKELIEKGHQRQNVVKPIDNPPHPGSTKPLKKVIIEETGNLIQTIDVPDSTTAAAPENNPINLANVGTTSKKNSS 481
13 -62.100[R] KOG1125 TPR repeat-containing protein  ali follow..  12  178....................DDVKFHGDRNTKGHPMAERKSSSSRTGSKELLWSSEH--RSQPELSGGKSALNSESASELELVAPTQARLTKEHRWGSALLSRNHSL----EEEFERAKAAVESDTEFWDKMQAEWEEMARRNWISENQEAQNQVTISASEKGNPFKDWPGAFEEGLKRLKEGDLPVTILFMEAAILQPGDAEAWQFLGITQAENENEQAAIVALQRCLELQPNNLKALMALAVSYTNTGHQQDACDALKNWIKQNPKYKYLVKSKKGSPGLTRRMSKSPVDSSVLEGVKELDPDLQTGLGVLFHLSGEFNRAIDAFNAALTVRPED--YSLWNRLGATLANGDRSEEAVEAYTRALEIQPGFIRSRYNLGISCINLGAYREAVSNFLTALSLQRKSRNQWAALRIALSLMDQPEGDLDVLLRAFNLDP................... 626
14 -61.600[O] KOG0550 Molecular chaperone (DnaJ superfamily)  ali follow..  13  2.....TEVETTHMNAGTESQQ---EPAELAEKQKAIGNAFYKEKKYAEAIKAYTEAILGSDSALAYSNRAATYMQIGEFELALCDAKQSDRIKPDVPKTQSRIRQAYEGLSIGLALNALDRLQRRIDSTTQPPMSWMYLKAQVYIFQNDMDRAQKIAHDVLRLNP-KNVEALVLRGKVMYYSGENAKAITHFQEALKLDPDLENTKNQGNDLFRQGNYQDAYEKYSEALQIDPDNAKLYMNRATVLLRLKRPEEALSDSDNALAIDSSYLKGLKVRAKAHEALEKWEEAVRDVQSAIELDASDANLRQELRRLQLELKKSKRKDHYKILGVSKEATDIEKKAYRKLALVY-----HPDKNAGNLEAEARFKEVGEAYTILS---------PESRRRFDSGVDLEPGMEGGAYQAGGSFPGGGFPGGGFPGGSYNSQGFGMGGGFPGFTS......... 472
15 -55.600[S] KOG4340 Uncharacterized conserved protein  ali follow..  20.RLIRDARYAEAVQLLGQ------LHPELEQYRLYQAQALYKACLYPEATRVAFLLLNPAYHSRVLRLQAAIKYSEGDLPGSRSLVEQLLSGGDNETDGQVNL--GCLLYKEGQYEAACSKFSATLQASGYQPDLSYNLA-LAYYSSRQYASALKHIAEIIERGIRQHVEAFNLKAAIEYQLRNYEVAQETLTDMPPREEELDPVTLHNQALMNMARPTEGFEKLQFLLQQNPFPPETFGNLLLLYCKYEYFDLAADVLAENAHLTYKFLTPYDFLDALITCQTAPEEAFIKLDGLAETMEKYIPVLMAQAKIYWNLENYPMVEKVFRKSVEFCNDH--DVWKLNVAVLFMQENKYKEAIGFYEPIVKKHYDNAIVLANLCVSYIMTSQNEEAEELMRKIEKEEYHLCIVNLVIGTLYCAKGNYEFGISRVIKSLEPYNKKLGT.............. 543
16 -55.600[R] KOG1128 Uncharacterized conserved protein, contains TPR repeats  ali follow..  10  294....HDVLVHERCSPVLDTVIAAELERGRVRQVDRQGVDDPVLIKDRLLRTSYILASGLTPFWQSSVLLAGILNSLGCTSEALLILEKLEMWD----------GVIDCYKQLGQMDKAETLIRRLIEQKPNDSMLHVYL--------GDITRNLEYFTKAIELSDDRNARAHRSLGHLLLMDKKFEEAYKHLRRSLELPIQLGTWFNAGYCAWKLENFKESTQCYHRCVSLQPDHFEAWNNLSAAYIRHGQKPKAWKLLQEALKYNYEHPNVWENYMLLSVDVGEFSQAIQAYHRLLDMNKRGADDEVLELIAQTLLRR--EAEISMDESEDKAQNEAENKTLRVYALLKKPSVLSSETRTEFEKYVRLLEKSLAAANGKLTWPKEEKLALEVVETAVRLAEDRLELAKFIASDTSVKEASAKVRLSLRGILTRLDKDSGSRVSGDETEKLQEIVEVA 778
17 -55.300[U] COG5010 Flp pilus assembly protein TadD, contains TPR repeats  ali follow..  17  2..................................................................................................................................................................................................TMQDNFSFSLRRLATGVAVAMVALSLSACAGQQGRKELTTGSIPKLTRPVQSMNATELAAAAERIGQAYERNPKDREAGLNYANLLRMTGRNEQALAVMQQVAIYHPADREVLGAYGKAQAAAGQLEQALATISRAQTPDRPD--WKLKSAEGAILDQLGRSAEARLRYREALDLKPNEPSVLSNLGMSYLLTKDLRTAETYLKSAASQPDAGSSVRQNLALAVGLQGRFQEAETIAGQELTSEQAEANVAYLLSQQGAWKQLA 266
18 -54.600[NU] COG3063 Tfp pilus assembly protein PilF  ali follow..  15  4...........................................................................................................................................................................................................KPSKRISLLLVLALGACSTSYRPSRAEKANQVSNIKTQLAMEYMRGQDYRQATASIEDALKSDPKNELAWLVRAEIYQYLKVNDKAQESFRQALSIKPDSAEINNNYGWFLGRLNRPAESMAYFDKALADPTYPTPYIANLNKGICSAKQGQFGLAEAYLKRSLAAQPQFPPAFKELARTKMLAGQLGDADYYFKKYQSRVEVLQADDLLLGWKIAKALGNAQAAYEYEAQLQANPYSEELQTVLTG........ 252
19 -54.300[R] COG4785 Lipoprotein NlpI, contains TPR repeats  ali follow..  14  2.................................................................................................................................................KPFLRWCFVATALTLAGCSN-TSWRKSEVLAVPLQPTLQQEVILARMEQILASDERAQLLYERGVLYDSLGLRALARNDFSQALAIRPDMPEVFNYLGIYLTQAGNFDAAYEAFDSVLELDPTYNYAHLNRGIALYYGGRDKLAQDDLLAFYQDDPNDPFRSLWLYLAEQKLDEKQAKEVLKQHFEKSDKEQGWNIVEFYLGNI-SEQTLMERLKADATDNTSLAEHLSETNFYLGKYYLSLGDLDSATALFKLAVANNVHNFVEHRYALLELSLLGQDQDDLAESDQQ........................ 294
20 -52.900[S] KOG3060 Uncharacterized conserved protein  ali follow..  13  2................................................................................................................................................................................SLDYEKMSWSDVRDQFRTWREETRHSEEVVQLWVAV-----------LEDKVHKTGNERHLILEQVIIAALDTARFDIATKCTKQLSLEFPGSLRVMKFKAMRYEALEQYDEADEVLDAIIAKDETNAAPRKRKIAILKARGRRLEAIKELNEYLKKFMSD--QEAWHELCNMYLAEGEFGKAAFCMEEVLLHNPHSHLIHQRLAEIRYTMGNMESARTYYSQALKLNPHNLRALYGIYLCCNHLDNSRAVSSKRKELQKLSQWALEQLLTKQTIVPLEAAF 274
21 -52.200[G] COG2956 Predicted N-acetylglucosaminyl transferase  ali follow..  11  3................................................................ELLFLLLPVAAAYGWYMGRRSAQQNKQDEANRLSRDYVAGVN-------------------------------------FLLSNQQDKAVDLFLDMLKEDT-GTVEAHLTLGNLFRSRGEVDRAIRIHQTLMESASRLLAIQQLGRDYMAAGLYDRAEDMFNQLTDETDFRIGALQQLLQIYQATSEWQKAIDVAERLVKLGKDKAHFYCELALQHMASDDLDRAMTLLKKGAAADKNSARVSIMMGRVFMAKGEYAKAVESLQRVISQDRE-LVSETLEMLQTCYQQLGKTAEWAEFLQRAVEENTG-ADAELMLADIIEARDGSEAAQVYITRQLQRHPTMRVFHKLMDYHLNEEGRAKESLMVLRDMVGEKVRSKPRYRCQK......... 359
22 -50.500[R] KOG0553 TPR repeat-containing protein  ali follow..  14  1.......................................MDNKKRLAYAIIQFLH--------DQLRHGGLSSDAQESLEVAIQCLETAFGVTVEDSDLALPQTLPEIFEAAATGKEMPQDLRSPARTPPSEED----------------------------------------------------------------SAEAERLKTEGNEQMKVENFEAAVHFYGKAIELNPANAVYFCNRAAAYSKLGNYAGAVQDCERAICIDPAYSKAYGRMGLALSSLNKHVEAVAYYKKALELDPDNETYKSNLKIAELKLREAPSPTGGVGSF-GLLNNPGFMSMASNLMNNPQIQQLMSGMISGGNNPLGTPGTSPSQ-NDLASLIQAGQQFAQQMQQQ------NPELIEQLRSQIRSRTPSASNDDQQE............................. 313
23 -50.400[Z] KOG1840 Kinesin light chain  ali follow..  13  72....DEGDEDEVAKPEEFDVKSNSSLEVMPRDMEKQTGKKNVTKSNVGVGGMRKKKVGGTKLRFLLNQARNLVSSGDSTHKALELTHRAAKLKPCLEWIMCLHVTAAVHCKLKEYNEAIPVLQRSVEIPVVEFAGLMQLGD-TYAMVGQLESSISCYTEGLNINDPRVGETCRYLAEALVQALRFDEAQQVCETALSIIAEAADRRLMGLICETKGDHENALEHLVLASMAESEVAFVDTSIGDSYLSLSRFDEAICAYQKSLTAHPAVGSVYIRLADLYNRTGKVREAKSYCENALRIYESHASGLTDISVICESMNEVEQAITLLQKALKIYADIMIAGIEAQMGVLYYMMGKYMESYNTFKSAISKSTFFGIALNQMGLACIQLDAIEEAVELFEEAKCIHPETLGLYSNLAGAYDAIGRLDDAIKLLGHVVGVNPVTEDEKRRLAQLGNVTGR. 630
24 -49.300[A] KOG0495 HAT repeat protein  ali follow..  11  448....ANGNIHMVEKIIDRSLTSLTVNGVNRDQWFQEAIEAEKSGAVNCCQSIVKAVIEEEDRKQTWIDDAEFCAKENAFECARAVYAHALQIFPSKKSIW--LRAAYFEKNHGTRESLEALLQRAVAHCPKSEILWLMGAKS-KWMAGDVPAARGILSLAFQANP-NSEDIWLAAVKLESENSEYERARRLLAKARGSAPTPRVMMKSARLEWALEKFDEALRLLEEAVEVFPDFPKLWMMKGQIEEQQRRTDDAAATYTLGLKKCPTSIPLWILSANLEERKGVLTKARSILERGRLRNPKVAVLWLEAIRVELRAGLKEIASTMMARALQECPNA--GELWAEAIFMETKPQRKTKSVD----ALKKCEHDPHVLLAVSKLFWSEHKFSKCRDWFNRTVKIDPDLGDAWAYFYKFELLHGTEAQQQEVLDRCISAEPTHGESWCRVSKLRAVVREL 909
25 -45.700[U] KOG3081 Vesicle coat complex COPI, epsilon subunit  ali follow..  13  6......................................................................................................................................................................AGPDHLFNLRNNFY-LGAYQTAINNSEIANLSENAVERDCLVFRSYIALGSYQLVISEIDES---AATPLQAVKLLAMYLSTPQNKESTISSLKEWLATIGNNDTLRLIAGIIFMHEEDYNETLKHTHA-----GGTMDLYALNVQIFIKMHRAEYAEKQLRVMQQIDEDHTLTQLASAWLNLAVGGSKIQEAYLIFEDFSEKYPMTCLILNGKAVCCMQMGNFDEAETLLLEALNKDAKDPETLANLVVCSLHVGK--SSSRHLSQLKLSHPEHILVKRVSSAEDNFERAV 289
26 -44.900[T] KOG1130 Predicted G-alpha GTPase interaction protein, contains GoLoco domain  ali follow..  11  29....KSGDCRAGVSFFEAAVQVGTEDKTLSAIYSQLGNAYFYLHDYAKALEYHHHDLTQLGEAKASGNLGNTLKVLGNFDEAIVCCQRHLDISREVGEARALYNLGNVYHAKGKSFGCPGPQDVG---------------EFPEEVRDALQAAVDFYEENLSLDRAAQGRAFGNLGNTHYLLGNFRDAVIAHEQRLLIAKERRAYSNLGNAYIFLGEFETASEYYKKTLLLARQEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIRIGEGRACWSLGNAYTALGNHDQAMHFAEKHLEISREELTARLNLSDLQMVLGLYSTNNSIMSENTEIDSSLPKLGRRHSMENMELMKLTPEKVQNWNSEILAKKPSAKLLFVNRLKGKKYKTNSSTKVLQDASNSIDQRKISADTIGDEGFFDLLSRFQSNRMDDQRCCLQE.................... 506
27 -43.100[S] KOG4507 Uncharacterized conserved protein, contains TPR repeats  ali follow..  11  67VILMRQEATVNYLKELEKQLVAQKIHIEE-----NEDRDTGLEQRHNKEDPDCIKAKVPLGDLDLYDGTYITLESKDISPEDYIDTESPVPPDPEQPDCTKILELPLSKRLGRSIDDIGHLIHEGLQKNTSSWVLY-NMASFYWRIKNEPYQVVECAMRALHFSSRHNKDALVNLANVLHRAHFSADAAVVVHAALDDSDFFTSYYTLGNIYAMLGEYNHSVLCYDHALQARPGFEQAIKRKHAVL--QQKLEQKLEAQHRSLQRTLNELKEYQKQHDHYL---RQQEILEKHKLIQEEQILRNIIHETQMAKEAQLGNHQICRLVNQQFHAINKPNAPIWLILNEGLYWRAVGNSTFAIACLQRALNLAPLQYQPLVNLANLLIHYGLHLDATKLLLQALAINSSEPLTFLSLGNAYLALKNISGALEAFRQALKLTTKCPECENSLKLI....... 732
28 -41.500[U] KOG2376 Signal recognition particle, subunit Srp72  ali follow..  10  25.KHIKDTKYEEAVKVADQVLS---IVPTDEDAIRCKVVALIKDDKFDDYLIKDVKIVINSFPIDLGFHKAYCLYRENKLDEALVCLKGL----ERESKTLL---EAQILNCLGKVDACVDVYQKLNKSGIKLIEVNLV---AALIRAGKASQVLE----SLKIRPTTTYQLAYNTACSLIENSNYVDAEQLLLTAMRITQLAPISVQLAYVQQVLGQTQESKSSYVDIIKRNLADESLALAVNNLLKGSKDISDGLRKFDLLKDKDSQNFQLYANRVLLLLHANKMDQARELCATLPGMFPESVIPTLLQAAVLVRENKAAKAEELLGQCAENFPEKS-KLVLLARAQIAASASHPHVAAESLSKIPDIQHL-PATVATIVALRERAGDNDGATAVLDSAIRWSNMLRILMPVAAAFKLRHGQEEEASRLYEEIVKNHNSTTLARVNVEKAEAYEKQL 517
29 -40.500[S] KOG2796 Uncharacterized conserved protein  ali follow..  11  1.......................................................................MLRFLGEKAAAKRQVLNADSVEQSFVGLKQLISCR-----------------------------WRAAVDLCGRLLTAHGQGYGKSGLLTSHTT-DSLQLWFVRLALLVKLGLFQNAEMEFEPFGNLDQ--SMRILHAELQQYLGNPQESLDRLHKVKTVCSKILANL-EQGLAEDGGMSSVTQEGRQASIRLWRSRLGRVMYSMANCLLLMKDYVLAVDAYHSVIKYYPEQPQLLSGIGRISLQIGDIKTAEKYFQDVEKVTQKQGKIMVLMNSAFLHLGQNNFAEAHRFFTEILRMDPRNAVANNNAAVCLLYLGKLKDSLRQLEAMVQQDPRHYLHEFNLTTMYESSRSMQKKQALLEAVAGKEGDSFNTQ............. 374
30 -40.500[OT] KOG1308 Hsp70-interacting protein Hip/Transient component of progesterone receptor complexes and an Hsp70-binding protein  ali follow..  2...........................................................................DPCKVNELRAFVKMCKQDPSVLHTEEM--------------RFLREWVESMGGKVPPATQKAKSEE-NTKEEKPDSKKVEEDLKADEPST-EESDLEIDKEGVIEPDTDAPQEMGDENVEIEMMDQANDKKVAAIEVLNDGELQKAIDLFTDAIKLNPRLAILYAKRASVFVKLQKPNAAIQDCDRAIEINPDSAQPYKWRGKAHRLLGHWEEAAHDLAFACKLDYDEDASAMLKEVQ-----PRAQKIAEHWRKYERKHEE--REIKERIERVKKAQEEQERAQREEEARRQSGAHYGPF----GFPGGMPGNFPGGMPGMGGDMPGMAGMPGLNEILSDPEALAAMQDPEVMVAFQDVAQNPANMSKYQSMNLISKLSAKF 365
31 -40.000[D] KOG1915 Cell cycle control protein (crooked neck)  ali follow..  10  1MASGYMTRKDAELKLPRMTQV---KNKTPAPIQITAEQILREARERQE-----------AEFRPPNQTITDSAELSDYRLRRRKEFEDQIRRARLNTQVW--VKYADFEMKNKSVNEARNVWDRAVSLLPRVDQLWYKFIHM-EEKLGNIAGARQILERWIHCSP--DQQAWLCFIKFELKYNEIECARSIYERFVLCHPKVSAYIRYAKFEMKHGQVELAMKVFERAKKELADDEEAEILFVAFAEFEEQYKFALDQYEDEVRKNPLNYDSWFDFVRLEETVGNKDRIREIYERAVANVPPPEAQEKRYWQRYIYLEDVESTRDVYRACLKLIPHSKFAKIWLLAAQHEIRQLNLTGARQILGNAIGKAPKD-KIFKKYIEIELQLRNIDRCRKLYERYLEWSPGNCYAWRKYAEFEMSLAETERTRAIFELAISQPATYIDFEISEGELERYERLL 510
32 -39.600[O] COG4235 Cytochrome c biogenesis factor  ali follow..  11  1..................................................................................................................................................................................................................VPEAFPEQSVPEGKRAGYVVYLPGIVVALIVAGVSYYQTGNY-QQVKIWQQATAQAPALLDRALDPKADPLNEEEMSRLALGMRTQLQKNPGDIEGWIMLGRVGMALGNASIATDAYATAYRLDPKN--SDAALGYAEALTRSSDNRLGGELLRQLVRTDHSNIRVLSMYAFNAFEQQRFGEAVAAWEMMLKLLPANDTRRAVIERSIAQAMQHLSPQES............................ 220
33 -38.400[S] KOG4555 TPR repeat-containing protein  ali follow..  11  1......................................................................................................................................................................................................................MPQANLTLSPHDQQVLDSIFNP--LELSSLQTNNLIPAESDLKDEEPDTQ-AIKASRELELKAIALSESGELDGALELFQQSLNL-AQRASVLNNRAQTLRLAKRDEEALDDLNKALELANDQTKCHAHCQRGVLYRKLDNLEAARADFEAAAQLGSKFAREQLVEINPYAALCNLRQAFDQLK............................................................ 185
34 -38.200[S] COG3898 Uncharacterized membrane-bound protein  ali follow..  12  62.......................................IRSLWNSPYTISRYFRVR-RRDRGYQALSTGMIAAGAGDGALARKKTKEAAKLIRSDQEPLIHL-----------------------------------------------------------------------EAQASLLEGDHEGARQKFESMLDDPERLLGLRGLYLEAERLGDRNAARHYAGRAAAVAPQLAWAAESTLEELTARGDWDGALKLVDAQKSTRQIERDAANRRRAVLLADSDPNAARTAALEANKLQPDFAPAAVAAAAALFKQNDVRKGSKILETAWRAEPHPEIAELYTHA----RPGDAVLDRLNRAKKLQEMKKNHAESSMTVARAALDAQDFSTARSEAEAAIRMDRREGAYLLLADIEEAETGDQGKVRQLLSKAVRAPRD.................. 395
35 -37.500[R] COG0457 FOG: TPR repeat  ali follow..  15  403....DDKGKCSMHQLMRKSLKDYQVHNFMLDFYSNQLKDIDIKEITPEHEIALTEAFYAEDLLKWFISVSDPFNRAAFWQLITPMYEEMLQIHKDIVTTLNIL--DVLYYKMGEYKKALQFSERALAIG----------------------------ETILGVQHPDVATSLDNLAGLYESMGNYKQALQLSERALEIRDVAITLDNLAGLYESMGEYEKALIFYQRTIEIHSNFATSLDNLAVLYRQMGEYEKALQLSQRALEIHPDIATTLNNIALLYDSMGDYQKTLPLYQRALEIYLGIATTLNNLAGFYRRVGDYEKALSLSQRSLEIDQHPDVARTLNSLALIYENIGDYEKALAFYQRSLDIHPDVGRTLNNLARLYEIMGDHEKALTLYQRTIEIHPDVATILNNLAGLHYRIGEYKKALPLYQRALDIQPNSVVIKNNYNRLSENEKK. 914
36 -35.600[S] COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats  ali follow..  24..........................................................................................................................................................................................................RYWIFIIFCFPVIGCVAYFVIVMLPETGADRH----GHTLLMRLQDKLNPERHLRKLTEELAIAET-NQNHYALANELARLGRYHEAVPHYQQALSGIFHEAAMMLSLAQAQFAIQEFAACQQTLEDVMRYNPDFQSADGHLLFARTLAAQEKYADAESEFEVLISYYPG-PQARIYYAEMLAKMSRLREANEQYVAVVDTAKRSRPHYRKHHREWIKTANERLKQSVVQ.......................... 248
37 -34.500[O] KOG0530 Protein farnesyltransferase, alpha subunit/protein geranylgeranyltransferase type I, alpha subunit  ali follow..  1................................................................................................................................................................MSDSDIPSSTLYKDNVDWKDITPIYPSKEEEVAVKIAVEDFTDAFAYFRAILIKNEKSDRVMALLEDCIRLNPANYTVWQYRRVCLTELGWLKKEMRYLSDIIQESPKNYQVWHHRRFIVETIGEVNDELHFCSEVIRDENKNYHAWQHRQWVVRTFKVPLEKELTFALHM-LLLDNRNNSAYNYRYFLMTLYDKLDIEINLAKKFIENIPNNESAWNYLAGLLITVTSNSDVVSFVEDLYETTPEEKRSPFLLAFIASAEESAGRAKKLYKDLQSIDPVRVNYYRHAQTMLIKAQTK 324
38 -33.400[O] COG3914 Predicted O-linked N-acetylglucosamine transferase, SPINDLY family  ali follow..  13  2...............................................................................................................................................................................................................PQDVMTANHVSPSNDAAAPSALDLARNQRLSLLSVSEALNAAGQQAAAAELYKTWVAFNPTIHLAYFNYAVMLNQLGDRAGAVQAFRACLKANPEFAPGHINLGRALEDAGLIGHAVEQWSHYAEVTKNGHRHMTLQNMGRVLEGAGKLEEAETALLQAFELRPELPEAGQHWASLRQRQCKWPVLAPSNHISPRKMLDAMSSLTLSCYADDPMFQLAKAYRLSKTLIGARPDLSRF.............. 250
39 -32.700[O] COG5536 Protein prenyltransferase, alpha subunit  ali follow..  6......................................................................................................................................................................PELNEILDFTEYGPLTPIPQDDGENPLAKICYTGYEQGMAYFRAIMAKKEYSLRALNLTGFLIMNNPAHYTVWAYRFQILNHTPSIDNELEWLDEIAEDFQKNYQVWHHRQKILSLTKNYERELEFTKKMFEIDSKNYHVWSYRVWILQNFNDYSQELKLTNELLEKDIYNN--SAWNHRFYVLFETSKLEEELNYLKDKILFAPDNQSAWNYLCGVLDKSGKLDNLIANLRKNLPALHKPLLEFLAMYEPSSSEEIYQKL------ANEVDVPHAALWTWMSQR....... 291
40 -32.700[S] COG1747 Uncharacterized N-terminal domain of the transcription elongation factor GreA  ali follow..  2....................................................................................DTRDLTAYSAEKFKELDRI--IAEAKRQSILDVLKGICDEHLAHSKNSIIALYISGIISLSKQLLDDSCLV------------------TLLTIFGDNHKNQIVEHLCTRVLEYGESKLALRALGECYKTSGN-EQLYDVWERLVRIDYEEAEITRVLADKYEQEGNKEKATEFYKKALYR--------------FIARRQNAAIKEVWTKLVALIPDDVEFFYREQKKISEKLGEGRGSVLMQ----------------DVYVYYKENEDWTTCINILKHILEHDEKDVWARKEIIENFRCKYRGHSQLEEYLKISNISQS--------------WRNVFEAINDFEKHISFDEGSFVFHRTWG......... 301
41 -31.500[O] KOG3696 Aspartyl beta-hydroxylase  ali follow..  10  62...........ALLGVWTSVAVVWFDVDYEEVLGKLG-IYDADGDGDFDVDDAKVLLGLKERS----TSEPAVPPEEAEPHTEPEEQVPVEAEPQNIEDEAKEQIDDEFLMATDVDDRFETLEPEVS-HEETEHSYHVEETVSQDCNQDMEEMMSEQENPDSSEPVEDERLHHDTDDVTYQVYEEQAVYEPLENEGEITEVTAPPEDNPVEDSQVIVEEVSIFPVEEQQEVPPETNRKTDDPEQKAKVKKKKPKLLNKFDKTIKAELDAAEK-------LRKRGKIEEAVNAFKELVRKYPQSPRARYGKAQCEDDLAELRGAIETYQEVASLPDVDLLKLSLKRRSDRQQFLGHMRGSLLTLQRLVQLFPNDTSLKNDLGVGYLLIGDNDNAKKVYEEVLSVTPNDGFAKVHYGFILKAQNKIAESIPYLKEGIESGDPGTDDGRFYFHLGDAMQRV 538
42 -31.100[A] KOG2047 mRNA splicing factor  ali follow..  359LARLEELMNRRPALANSVLLRQNPHNVEQWHRRVKIGNAAKQILTYTEAVRTVDPMKAVGKPHTLWVAFAKLYENHKDLVNTRVIFDKAVQVNYKTVDHLASVEWAEMELRHKNFKGALELMRRATAVPTVEVRRRVAADGNLEESLGTLESTRAVYEKILDLRI-ATPQIIMNYAFLLEENKYFEDAFKVYERGVKIFKYPHTYLTKFVKRYGKTKLERARELFEHAVSMAPSDRTLYLQYAKLEEDYGLAKRAMKVYEEATKKVPEGQKMYEIYISRAAEIFGVPRTREIYEQAIESGLPHKDMCIKFAELERSLGEIDRARALYKYSSQFADPRSDPEFWNKWHEFEVQHGNEDTYREMLRIKRSVSPENMMQKDKLLDVEDAKGELKRAGLPEDEMAALERQLLSTTTPTEPAKDGGRRVGFVSAGVISQSGENEGKPVT.............. 847
43 -30.900[H] COG3071 Uncharacterized enzyme of heme biosynthesis  ali follow..  12  91............................................................................................................................................ALIKLAEGDFLQVEKLLTRNADHAEQP---NYLLAAEAAQQRGDEFRTNQYLERAAEVADGDQLPVNIVRIQLAQGHIHAARHGVDRLLDQAPRHPEVLRLAEQAYLRSGAYRSLLDILPAMSKTQIHTPEAYIGIMNQCMADEGSEGLKRWWKDQSRKVRNEIPLQVALAEHLIECDDHDVAQKIILDSLKHQYDERLALLIPRL-----KAGNPEPLEKSLRQQIKQHGATPLLNSTLGQLMLKHGEWEKASEAFKAALAQRPD-GYDYAWLADALDKLHRPEDAAQARREGLLLTLRQNGESSALTKL....... 404
44 -29.400[S] KOG4814 Uncharacterized conserved protein  ali follow..  24..........DRLFSDIANINRESMAEITDIQIEEMAVNLGGGWLVNEEQKIRLHYVA--RLIMMNMRIGKEWLDAGNFLIADECFQAAVASLEQ-----------LYVKLIQRSSPEADLTMEKITVESDHFRVLSYQAESAV-AQGDFQRASMCVLQCKDMLMRLPHHLCYNFGVETQKNNKYEESSFWLSQSYDIGKMAKVLRLLATNYLDWDDYDKALNAVNLANKEHLSSPGLFLKMKILLKGETSNEELLEAVMEILHLDMP-LDFCLNIAKLLMDHERESVGFHFLTIIHERFKSSENMLLQRKEELLAKEKIEEIFLAHQTGRQLTAESMNWNILWRQAASSFEVQNYTDALQWYYYSLRFDLDFTKLQRNMACCYLNLQQLDKAKEAVAEAERHDPRNVFTQFYIFKIAVIEGNSERALQAIITLENILTDEESEDNDLVAERGSPTML 518
45 -29.300[R] COG4976 Predicted methyltransferase (contains TPR repeat)  ali follow..  12  2................................................................................................................................................................................................................................TFNQLSSGDLIADRRADYAKMLAEAGDAPGAAELMAQALELAPDWAAGWFRLADYEEKSGRIEAAVDALRNTLRLNPEDIFGASLKLALLGATETPEQPPSVYVERLDDYAERFDHALVEKLGYSVPEKLAAVIGRVNGGGRFRHVTDLGCGTGLFGERIRDRADFLEGFDLSANMLAKAEAK-GVYDRL-----AQADLSLAPEDSGVFGALEQRRADAADVLMYLGNLEGVF 233
46 -29.100[O] KOG4642 Chaperone-dependent E3 ubiquitin protein ligase (contains TPR repeats)  ali follow..  10.........................................................................................................................................................................................GARLGAGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALRIAKKKRWNSIEERRIHQESE---LHSYLSRLIAAERERELEECQRNHEGDEDDSHVRAQQACIEAKHDKYMADMDELFSQVDEKRKKRDIPDYLCGKISFELMREPCITPSGITYDRK-QLIPNLA................ 285
47 -27.600[U] KOG1586 Protein required for fusion of vesicles in vesicular transport, alpha-SNAP  ali follow..  1..................................................................................................................................................................................MDNSGKEAEAMALLAEAERK--VKNSQSFFSGLFGGSSKIEEACEIYARA--------------ANMFKMAKNWSAAGNAFCQAAQLHLQ-ATCFVDAGNAF-KKADPQEAINCLMRAIEIYTDMAKHHISIAEIYEELVDIEKAIAHYEQSADYYKGESANKCLLKVAGYAALLEQYQKAIDIYEQVGTNAMDTAKDYFFKAALCHFCIDMLNAKLAVQKYEELFPAFSDS-LLEAHEEQNVDSYTESVKEYDSISRLDQWLTTMLLRIKKIQGDEEDL 294
48 -26.800[MOT] KOG1550 Extracellular protein SEL-1 and related proteins  ali follow..  12  400......RLMEEAVDEIEAAS-----SAGDPHAQSIMGFVYGIEKSKSKSFLHHNFA-AAGGNMQSKMALAFTYLRQDMHDKAVQLYAELAEVEPTRIHSGTEENKGALRKSRGEEDEDFQILEYQAQK--GNANAMYKIGLFYYFGLRDHTKALHWFLKAVD---KGEPRSMELLGEIYARERNYTKALEWLTLAAK-EGLYSAFNGIGYLYVKKKNYTKAREYFEKAVDN--EDPSGHYNLGVLYLKNRDVRQATKYFFVA--ANAGQPKAFYQLAKMFHTKKNLEMATSFYKLVAERG--PWSSLSRWALEAYLKGDVGKALILYSRMAEM-----YEVAQSNAAWILDKYGRHERAHSLWWRA--SEQGNEHAALLIGDAYYYERDFVRAAEAYMHAKSQS--NAQAMFNLGYMHEHPFDLHLAKRYYDESLQSDAA.................. 870
49 -25.700[DO] KOG4322 Anaphase-promoting complex (APC), subunit 5  ali follow..  12  259LNNLRVQDVFSSTHSLLHYFDRLILTGAESKSNGEEGY--------------------GRSLRYAALNLAALHCRFGHYQQAELALQEAIRIAQESNDH--QHCLSWLYVLGQKRSDSYVLLEHSVKKAVHFGLPYLASLGIQSLVQQRAFAGKTANKLMDALKDSDLLHWKHSLTAIWRLYGRSTMALQQAQMLLSMESFAVALCHLAELHAEQGCFAAASEVLKHLKERFPPNSQHAQLWMLCDQKIGKYHLADSLVTGITALNS--IEGVYRKAVVLQAQNQMSEAHKLLQKLLVHCQKVISVLLSVAELYWRSSSPTIALPMLLQALALSKEYLASETVLNLAFAQLILGIPEQALSLLHMAIEP--DKGRAMFLVAKCQVKAEALEAAIENLNEAKNY-ERIRDVVYFQARLYHTLGKTQERNRCAMLFRQLHQELPSHGVPLINH....... 754
50 -23.400[R] KOG4234 TPR repeat-containing protein  ali follow..  20  103.................................................................................................................................................................................................................................................................................................................................................AEANEAKAEGNKLFVNGLYEEALSKYAFALELVQELPESYLNRGVCFLKLGKCEETIKECTKALELNPTYNKALVRRAEAHEKLEHFEDAVTDLKKILELDPSNDQARKGIRRLEPLAAE. 229
51 -22.400[R] COG4455 Protein of avirulence locus involved in temperature-dependent protein secretion  ali follow..  10  2.......................................................................................................................................................................................................KKTDTLPATLSALIQEYSIAEGIQMAEQQVRENPAKALCRHSLFQLLCVAGDWSRALHQLQLCARMEANYTQEARLYRELV-RCEMFRHTVFQGEQRPGFLLPQPVWVESLLAALACHDDTGEVDKHRNTALEAITDDWASDSDSRLGPVLELVTGGVYIWLPFSQIRSLESPQPTRLTDL-TRYSGSESASDALRLCRETAWQDGPGETTVRALGQKVWLTSHGDISLLDMAH-CTFHAQENDG.............. 273
52 -21.500[R] COG4105 DNA uptake lipoprotein  ali follow..  15  35.........................................................................................................................................................................................SEKDIDLSKYVDQTEPADVLYNQGLANLNAGRLDEASKKFDAVDRQHPYSRKSMVMGAFADYRKGSYDEAISSAKRYLALYPSTPYAQYIIGLSYYRQKEARQTLQTMQDLVTRWPTSEYV--------------DDAKEKIRFA-----NDQLAGKEMQIGRYYLERREYIAAVKRFRTVVENYSNTREALARLTESYYAMGLTSEAQTAAAVLGTNYPDSKDSYKLLQSNGLSPRENAGSWSKAGKLIT...................... 287
53 -21.500[A] KOG1258 mRNA processing protein  ali follow..  6....IYIAEETEWDKYNRQINK---NPDDFDAWEGLVRASEHLEGGVGRNS-----------------------SKQAINTLRSVYDRFLGKYPLLFGYW--KKYADFEFFVAGAEASEHIYERGIAGIPHSVDLWTNYCAFKMETNGDANEVRELFMQGANMVGLDSHPFWDKYLEFEERQERPDNVFQLLERLIHIPHQYARYFERFVQVSQSQPIQQLLPP-EMRARIYNIHLQIFQKVQLETAKRWTFESEIKPYFHVKELDEAQLVNWRKYLDFEEVEGDFQRICHLYERCLITCALYDEFWFRYARWMSAQDHLNDVSIIYERASCIFASISRPGIRVQYALFEESQGNIASAKAIYQSILTQLPGNLEGWVGLERRNAPNYDLTNAHAVLRSIINEGKCNTGITEVLITEDIKEGDIELARNMFLQNAPALLDCRHFWISFLRFE...... 473
54 -20.100[A] COG5107 Pre-mRNA 3`-end processing (cleavage and polyadenylation) factor  ali follow..  20....PSDNIHGDELRLRERIKD---NPTNILSYFQLIQYLETQESYAKVREVYEQFHNTPFYSPAWTLQLKGELARDEFETVEKILAQCLSGKLENNDLYIRRKNNLITGGQEARAVIVKAFQLVMQKCAIFEPKSSSFWNEYLNEQQRIDMLREFYKKMLCVPFDNLEKMWNRYTQWEQEINSLTARKFIGELSAEYMKARSLYQEWLNVTNGLKRASPILQIWLNWIKWEREN-------KLMLSEDMLSQRISYVYKQGIQYMIFSAEMWYDY---SMYISENSDRQNILYTALLANPDSPSLTFKLSECYELDNDSESVSNCFDKCTQTKQREKLTFVFCVYMNTMKRISGLSAARTVFGKCRKLKRILTHDVY---LEFQNQNDYKTAFKVLELGLKYFQNDGVYINKYLDFLIFLNKDSQIKTLFETSVEIYKKMISYESKFGNLNNVYSL. 542
55 -20.100[R] KOG3807 Predicted membrane protein ST7 (tumor suppressor in humans)  ali follow..  5......GGVGEAAAVGASPASVPGLNPT-------LG--------WRERL----RAGLAGTGASLWFVAGLGLL---RLCENLAAVTVLNSLTPKFYVALTGTSSLISGLIFIFEWWYFHKHGTSFIEQVSVSHLQPLMGGTESSISEPGSPSRNRENETSRQNLSE-------------------KVWRNPLNLFRGAEYRRYTWVTGKEPLTYYDMNLSAQDHQTFFTCDTDFLRPSDTVMQKAWRERNPPARIKAAYQALELNNDCATAYVLLAE--EEATTIVDAERLFKQALKAGETLVYIKRRLAMCARKLGRIREAVKIMRDLMKEFPPLTMLNIHENLLESLLELQAYPDVQAVLAKLLKTRTVSEKFSPETASRRGLSTAEINAVEAIHRAVEFNPHVPKYLLEMKSLHILKRGDSEAIAYAFFHLQHWKRIEGALNLLQCTWE..... 464
56 -20.100[M] KOG3364 Membrane protein involved in organellar division  ali follow..  9......................................................................................................................................................................................................................................................................................................................................................TLKDAYEPLYPQQLEILRQQVVSEGGPTAT-IQSRFNYAWGLIKSTDERLGVKILTDIYKEAESRRECLYYLTIGCYKLGEYSMAKRYVDTLFEHERNNKQVGALKSMVED..... 122
57 -19.300[R] COG0790 FOG: TPR repeat, SEL1 subfamily  ali follow..  10  30....DVKYAALTQKDLDALP-----VEKRASVLDELGFIHEYPMNRERALQYYKQA-CELGGNYGCYNVKYAYQYAKDSAQANKYAKKMNLDNLLIEQEYIDKFSQEIYMAKALADTDKSQRAAFISILIHALNNRPESDALFFSRIGF--NQEKTFRLATLWSQDGDPQMDYQMGRLTLNYQARPASLKWFRAAAE-KGVVEAQSLLGGIYSGKPDIQEAQKWYGQAAK--QGDSDAQIALGKIYYSRTDYAKALALFTQVEN-DGTNSRSTMPLSWMYYNAPDCDKAWSYYKKASRKNNADALPKVTLKKERIFSRGITAKPKECALIFQIGTDKIRNMANLHITLELKNATEETLMIPPFGL------------NTLGIDMQNPLVTPYDLPLYTQDFCHG--IGDIHFTLKSATATINGKNDSVRFLDK......................... 502
58 -18.200[O] KOG0543 FKBP-type peptidyl-prolyl cis-trans isomerase  ali follow..  14  166....................................................................................................................................................................................ENLDLPYDLERAIQHLEKGEHSTVYLKPSYAFGSVGKEKFQI----------PPNAELKYEL-----YLKSFEKAKESWEMISEEKLEQNTVVKEQGSVYFKEGKYKQALLQSQKAQAP----LASHLDLAMCQLKLQAFSAAIESCNKALELDSNN--EKGPFRRGEAHLAVNDFELAWADFQKVLQLYPNNKAARAQLAVCQQRIHRQLARKKFYAKMFE........................................................ 367
59 -18.000[O] KOG0551 Hsp90 co-chaperone CNS1 (contains TPR repeats)  ali follow..  11  12...................................................................................................................................................DVMDSFLEKFQSQPYRGGFHEDQWEKEFEKVPLFMSRAPSEIDIFDEERSPEEQAKTYKDEGNDYFKEKDYKKAVISYTEGLKKKCADAVLYTNRAAAQYYLGNFRSALNDVTAARKLKPCHLKAIIRGALCHLELKHFAEAVNWCDEGLQIDAKEKKL----------LEMRAKADKLKRIEQRDVRKANLKEKKERNQNEALLQAIKARNIRLSEAACEDEDSASEGLGELFLDGLSTENPHGARLSLDGQGRLQSDFISAFHEDSRFIDHLMVMFGETPSWDLEQKYCPDNLEVYFEDEDRAELYRV. 340
60 -17.600[R] KOG2396 HAT (Half-A-TPR) repeat-containing protein  ali follow..  11  1MADVVQYRLERMVDELDDLERREIFTRAEIAEIVKQRRKFEYR-DYEVKLDELRQLRRKSVARVTKKRKKKSVSDFAGVARIVEIYRLATMRYKGDINLWFRY---LEFCKQKRHGRMKKALAQAIRFHPKVAGVWIYAASWEFDRNLNVTAARALMLNGLRVCSNSEDLWVEYLRMELTFLNKLKALQTIYSGAVERHEMSGCISNEAGLEFANPQMQKAIQVFEEGLQTVTSSSMFEIYINFLMEAIVQISHIINVYQKADETGCLTEELADEYVSLYLKLEKTHEAQKLAEKLCEKFAGSAKLWLSRVSIEIRSADFQTVFELLSNALRKVPISESESLWLMA-KFVLETKGAHSARKIYKRFLALPGPSLVLYKGCIEIETNLIGLSNARKLYDSAVASYGQDVELWKNYYSLETKLGTSETANGVYWRARKTLNESAD............... 645
61 -17.100[S] COG1729 Uncharacterized protein conserved in bacteria  ali follow..  14  241..............................................................................................................................................................................................................................................................................................................................................PSTNDPEELYRNSYQFILSGDYGTAEQGFRDHISRFPRDADAHYWLGESLLGQQKYRDAAEVFLAASKDYPKAPDMLLKLGVSLVGLKQHDVACATFSEVGKRYPDISSALKERVKQEKALAA. 369
62 -17.100[R] COG4783 Putative Zn-dependent protease, contains TPR repeats  ali follow..  10  74INTLG-NRLVANANSVRTPFHFYLVNNDQINAFAFFGGNVVLHSALFRYTDNESELASVLAHEISHVTQRHLARAMEEQQRLAPLTWVGVLGSILLTMASPQAGMAGLSGTLAGAQQGIISFTQGNEQEADRIGIQVLQRS-FLQKLADQSRYVSKPPEMLLTHPLPD----SRLSDARNRANQMNSLTPELLDKLSKGTVREAKYGQAVQLYQAKKYDEARNLLQPLLAQQPGNIWFLDLMTDIDLGQNKSAAAIARLQNAMVKQNDEPVLQLNLANAYVQGRQPAAAIKLLHRYTFAYPNDPNGWDLLAQATATQGLRDQE-------------------LAARAESLALSGKLTQAIGLLSDASARVKLGSLEQARYDARIDQLRRLNERFRKYQKS.......................................................... 486
63 -16.700[R] KOG4197 FOG: PPR repeat  ali follow..  10  179......................................MYSLCGLMDMARGVFDR--RCKEDVFSWNLMISGYNRMKEYEESIELLVEMERVSPTSVTLLLVLS---ACSKVKDKDLCKRVHEYVSECKTEPSLRLENALVNAYAACGEMDIAVRIFRSM----KARDVISWTSIVKGYVERGNLKLARTYFDQMPV--RDRISWTIMIDGYLRAGCFNESLEIFREMQSMIPDDVVVGNALIDMYFKCGCSEKAQKVFH---DMDQRDKFTWTAMVVGLANNGQGQEAIKVFFQMQDIQPDDI-TYLGVLSACNHSGMVDQARKFFAKMRSDHRIEPSLVHYGCMVDMLGRAGLVKEAYEILRK-MPMNPNSI-VWGALLGASRLHNDEPMAELAAKKILELEPDNGAVYALLCNIYAGCKRWKDLREV-DVAIKKTPSHLQSEEIYMKLEELAQES 644
64 -16.400[A] KOG1914 mRNA cleavage and polyadenylation factor I complex, subunit RNA14  ali follow..  3.........GLSMRNPERRIET---NPFDVDAWNLL-LREHQSRPIDQERDFYESLVKQPNSGRYWKAYIEHELRSKNFENVEKLFSRCLVSVLNIDKCYIHYVFETKGQRDQYREEMAKAYDFALEKVGMDVQAYSIFTEYI-AENQRITAVRKIYQKALAT--------MHNLELIWNDYCTYEKAINITLAEKLIAERGKEYQNARRVEKDLQQMTRGLELWKNLIAWEKTNPL------QTEEYGQHARRVVYTYEQSLLCLGYYPDIWYEAAMFLQEASHTLDEKGDVKMAQVLKLETISLYERAITGLEEHKQFEAVKNIYDRLLGIEHIN-PTLTYVQLMRFIRRSEGPNNARLVFKRAREDKRTGYQVFVAAALLEYNMKDKEVAIRVFKLGLKKYENEPEFGLAYADFLSNLNEDNNTRVVFERILTIWDRFLDFESCVGDLASILKV. 492
65 -16.100[S] COG2912 Uncharacterized conserved protein  ali follow..  10  16.........................................................................................................................................................................................DDSIPLTETALSIAQDAYPDLDLQAELAAIDMLVARL---KSRIVEGTPAIQRLRVLNQFFYRELGFGPNANDYNAVLQTRRGIP---ISLAVLLMEIG----------QQIGLPLKGVSF----NHFLVRMSIPAGEVVIDPLTGQTLSKEELQEMLDPYLEKEGIEDPNSVPLGVFLQVATHREIVARMLRNLKAIYLQESRWQRLLAVQQRLVILLPESIEEVRDRGLAYANLECFRPALADLEAYVDARPDAADTPKLKERMPTLRAMS 277
66 -15.900[A] KOG0128 RNA-binding protein SART3 (RRM superfamily)  ali follow..  10  14....GMEDLDEEIQKIKQKMID---DSQSVVLANQLLILLRKNGDFDELDIKRRQFVLNPLNWKNWIEDFQNRKPEPSVAEVEEMFEKALFDENDVTIWVERAMYAYKVANDKNKKEDFKFCRDVCSKALENLGTRYDSGGHIWLIFLEYEMSYLKNSMNAPDYQRL----ADQVFALFERA-QLEDVYVLAEQFCTEFKQHHKLEELKKTYNSTMRQKEQLSKFEELIQQEETKKQGLKQFFDHEKKSGIPSRIKMAHERLVSELDDDEEAWIAYGAWADIELKLQVAVKVYSRALRHCPYSFVLHQQALLAFERDRRNEEIDALWERARSNVINSAEEGRLLRRRIHLTGSSDYSPMAEVFDEGAALLREWFSMAWD--FYASLMKNMDKCRNIWNDILASFGRFAGKWIEAVRLERQFGDKENARKYLNKALNSVSDNINEIYMYGTLAELDLVL 497
67 -14.400[S] KOG4459 Membrane-associated proteoglycan Leprecan  ali follow..  11  8.............................................................................................................................................LLTTLLAVVAAASQAEVESEAGWGMVTPDLLFAEGTAAYARGDWPGVVLSMERALRRALRLRCRTQCAADFPWELDPDWSPSPAQASGAAALRDLSFFGGLLRRAACLRR-PPAAHSLSEEMELEFRKRSPYNYLQVAYFKINKLEKAVAAAHTFFVGNPEHMEMQQNLDYYQTMSGVKEADF--------KDLETQPHMQEFRLGVRLYSEEQPQEAVPHLEAALQ-NADLFQAITDIQVLNCKQNCVTELASHPSREKPFEDFLPSHYNYLQFAYYNIGNYTQAVECAKTYLLFFPNDEVMNQNLAYYAAMLGE. 350
68 -14.300[S] COG4259 Uncharacterized protein conserved in bacteria  ali follow..  12  49.................................................................................................................................................................................................................................................................................................................................................................TSLGKQTEKMEKYFV-MNAAPGAHAHLGLLLSRSGDKEGAFRQFEEEKRLFPESGVFMDFLMKTGKGGKR................................... 123
69 -14.100[T] KOG1309 Suppressor of G2 allele of skp1  ali follow..  4.............................................................................................................................................................................................................................................................................EKDLKTAYKALYDEKEPLKALHLYDEILKGSPTNLTALIFKAACLEKLYFGFSDWH--------------------------SDATMENAKELLDKALMTASKIGLVNFRYFVHFFNIKDYELAQSYFKKAKNLGYVDDTLPLWEDRLETKLNKKNKKQKDSTNKHTIKPVESIE.............. 158
70 -14.100[R] COG5091 Suppressor of G2 allele of skp1 and related proteins  ali follow..  4.............................................................................................................................................................................................................................................................................EKDLKTAYKALYDEKEPLKALHLYDEILKGSPTNLTALIFKAACLEKLYFGFSDWH--------------------------SDATMENAKELLDKALMTASKIGLVNFRYFVHFFNIKDYELAQSYFKKAKNLGYVDDTLPLWEDRLETKLNKKNKKQKDSTNKHTIKPVESIE.............. 158
71 -14.100[ODR] KOG4151 Myosin assembly protein/sexual cycle protein and related proteins  ali follow..  15  1............................................................................................................................................................................................................................................................................................................................................MVARVQTAEEIRDEGNAAVKDQDYIKADELYTEALQLTTDEDKAYRNRAMARLKRDDFEGAQSDCTKALEFDGADVKALFRRSLAREQLGNVGPAFQDAKEALRLSPNDKGIVEVLQRLVKANND. 130
72 -14.000[O] COG5159 26S proteasome regulatory complex component  ali follow..  2......................................................................................................................................................................SLPGSKLEEARRLVNEKQYNEAEQVYLSLLDKDSSQTSILELGQLYVTMGAKDKLREFIPHSTEYMMQVKVLKTLIEKFEQVPDSLDDQIFVCEKSIEFAKREHSLSIKLATLHYQKKQYKDSLALINDLLREKPSLVDVHLLESKVYHKLRNLAKSKASLTAARTACPTQTVAELDLMSGILHCEDKDYKTAFSYFFESFEYQSRGIDAMKAVAEAYNNRSDFNTALKQYEKELMGDEKIIEPFECVEI-MILDKIFYGVLDQGNGWLYVYETYDSALELVGQLNKVVDQL 426
73 -14.000[S] COG1655 Uncharacterized protein conserved in bacteria  ali follow..  93.................................................................................................................................................................................................................................................................................................................SLKWHSKKYPDIYDINIAIERFKLSLLNAHSSKKAMNCLKIAWMYRIQQNEDMEKVFLKNALEGGMNKFSLMYLIGELHRRLGDEDKALLWFGNVITNSLAPQKLKEMARNQKDLIRENEKKLSQTQDNDSNDDDNSEATKKKGLFSKLFNN. 264
74 -13.700[S] COG3014 Uncharacterized protein conserved in bacteria  ali follow..  10  12..............................................................................................................................................................................LGISLTGCIGYRMDLEHFNTLYY-----------------EESPKKAYEYSKQFTKKKKNALLWDLQNGLSALYARDYKTSLGVLDQAEQRFDKTQSAFTRGAGYVGATMINDNVRAYYEGVL--------INYYKAIDYMLLNDSAKARVQFNRANERQRRAKE-----------FYYEEVQKAIKEIDSSKKHNINMERSRAEVSEILNNTYSNLDKYEAYQGL-----LNPAVSYLSGLFYALNGDKNKGLGYLNEAYGISQS.................. 240
75 -13.300[S] KOG2422 Uncharacterized conserved protein  ali follow..  6LKKVLQEHEDSKLQKHHEEEEEEDEEESGARSSINPFDLLNDGDEDPEEIDDETIAEKKNEDADHQSSVADHVQPVSKNKSKKKKKKKNKESGSNVPKAEMTLDETLEALGLNANSKQDKVQETKPNADSSKKASSRFVLEIDSKYLNLENELRRTYGSKAMRSFESESGSQGGRGVHHITKTVLVSPKENWDRSFSMEFLETKDGNNYFRYTHSSSYEQAQRAFQAALIHNPYHIESLITMADYFKFVGENDMAADSIGKCLYGNKLFFKTLFTHMRNMDRRGCHRSALEVCKLLLSLDTSNP-ALFCVDYFALRAEEYAWLEQFSEEYRNDNSLWLFPNFSYSLAIARVYLEKMEPTSSSEATP-------------------RDTSKQSSLDLMTQALKLHPTVLNKLVE............................................. 447

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.