current user: public

If you have questions about the server, please let us know.

Query: [T] KOG1487 GTP-binding protein DRG1 (ODN superfamily), from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .
# Score Template Links and tools%idFirst MSSTLAKIAEIEAEMARTQKNKATAHHLGLLKARLAKLRRELITPKGGGGGGPGEGFDVAKTGDARIGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPGVIRYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLILIVLDVLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSELDAETVKSILAEYKIHNADVTLRSDATADDLIDVVEGNRVYIPCIYVLNKIDQISIEELDIIYKVPHCVPISAHHRWNFDDLLEKIWDYLKLVRIYTKPKGQLPDYTSPVVLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLSVKHNPQKVGKDHTLEDEDVIQIVKKLast
1 -125.000[T] KOG1487 GTP-binding protein DRG1 (ODN superfamily)  ali  100  1MSSTLAKIAEIEAEMARTQKNKATAHHLGLLKARLAKLRRELITPKGGGGGGPGEGFDVAKTGDARIGFVGFPSVGKSTLLSNLAGVYSEVAAYEFTTLTTVPGVIRYKGAKIQLLDLPGIIEGAKDGKGRGRQVIAVARTCNLILIVLDVLKPLGHKKIIENELEGFGIRLNSKPPNIGFKKKDKGGINLTATCPQSELDAETVKSILAEYKIHNADVTLRSDATADDLIDVVEGNRVYIPCIYVLNKIDQISIEELDIIYKVPHCVPISAHHRWNFDDLLEKIWDYLKLVRIYTKPKGQLPDYTSPVVLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLSVKHNPQKVGKDHTLEDEDVIQIVKK 367
2 -118.000[R] COG1163 Predicted GTPase  ali follow..  65  1MSTTVEKIKAIEDEMARTQKNKATSFHLGQLKAKLAKLRRELTSASSGSGGGAGIGFDVARTGVASVGFVGFPSVGKSTLLSKLTGTESEAAEYEFTTLVTVPGVIRYKGAKIQMLDLPGIIDGAKDGRGRGKQVIAVARTCNLLFIILDVNKPLHHKQIIEKELEGVGIRLNKTPPDILIKKKEKGGISITNTVPLTHLGNDEIRAVMSEYRINSAEIAFRCDATVDDLIDVLEASRRYMPAIYVLNKIDSLSIEELELLYRIPNAVPISSGQDWNLDELLQVMWDRLNLVRIYTKPKGQIPDFTDPVVLRSDRCSVKDFCNQIHKSLVDDFRNALVYGSSVKHQPQYVGLSHILEDEDVVTILKK 369
3 -110.000[T] KOG1486 GTP-binding protein DRG2 (ODN superfamily)  ali follow..  57  2..GIIERIKEIEAEMARTQKNKATEYHLGQLKAKIAKLRTQLLEPPKGASGG-GEGFEVTKYGHGRVALIGFPSVGKSTLLTMLTGTHSEAASYEFTTLTCIPGVIHYNDTKIQLLDLPGIIEGASEGKGRGRQVIAVAKSSDLVLMVLDASKSEGHRQILTKELEAVGLRLNKTPPQIYFKKKKTGGISFNTTAPLTHIDEKLCYQILHEYKIHNAEVLFRENATVDDFIDVIEGNRKYIKCVYVYNKIDVVGIDDVDRLSRQPNSIVISCNLKLNLDRLLARMWDEMGLVRVYSKPQGQQPDFDEPFVLSSGGCTVEDFCNHVHRTLVKDMKYALVWGTSTRHNPQNCGLSQHLEDEDVVQIVKK 367
4 -53.800[R] COG0536 Predicted GTPase  ali follow..  15  99.NEKGETLADLTSVGMKFIAAAGGNGGLG--NAALASKARKAPGFALIGEPGEAHDLILELKSMADVGLVGFPSAGKSSLISVMSAAKPKIGDYPFTTLQPNLGVVNVGHETFTMADVPGLIPGASEGKGLGLDFLRHIERTSVLVHVVDTADPISDIEALEAELAAYQSALDEDPRLVVLNKADVPEAEELAEFLKEDIEKQFGWPVFIISAVARKGLDPLKYKLLEIVQDARKKRPKEKAESVIIKHRTKGQFQIKPDPEVQGGFIITGEKPERWILQTDFENDEAVGYLADRLAKLGIEDGLRKAGAHVGANVTIGGISFEWEPM....................................... 443
5 -45.500[J] COG0012 Predicted GTPase, probable translation factor  ali follow..  23  2.................................................................EIGVVGKPNVGKSTFFSAATLVDVEIANYPFTTIDANVGVTYAI-IPVKMIDVAGLVPGAHEGRGLGNKFLDDLRMASALIHVVDVTDPIEDIEFLEREIDYWIYGILSKGWDKFAKRIKLQRIKLESAIAEHLSGIGVTENDVWEAMHRLGLPSDPTLWSQEDLLAFAS--RINKPMIIAANKADAASEEQINRLIKGYIVVPTSAAAELTLEVINKAVFELLNLIPVYP-TDQFGNVLPHVFLMKKGS-NPRDLAFKVHTDLGRGFLYAINAKTK-----RRIGEDYELQFNDIIKIVAV 395
6 -43.300[R] KOG1489 Predicted GTP-binding protein (ODN superfamily)  ali follow..  21  284.......GLDLNQPMTKVCLLKGGQGGLG--NMHFLTNLIRNPRFSKPGRNGLEQHFLFELKSIADLGLIGLPNAGKSTILNKISNAKPKIGHWQFTTLSPTIGTVSLGFDVFTVADIPGIIQGASLDKGMGLEFLRHIERSNGWVFVLDLSNPLNDLQLLIEEVGTLE-KVKTKNILIVCNKVDIDAEKSESFAKYLQVEK..................................................................................................................................................................... 480
7 -42.300[R] KOG1490 GTP-binding protein CRFG/NOG1 (ODN superfamily)  ali follow..  11  108.KISKDYVKLLKYGDSLYRCKCLKVAALGRMCTVLKRITPSLAYLE--QIRQHMARLPSIDPNTRTVLICGYPNVGKSSFMNKVTRADVDVQPYAFTTKSLFVGHTDYKYLRYQVIDTPGILDRPFEDRNCSITALAHLRAAVLFFLDIS-GSCGYTIAQQAALFHSIKSLFMNKPLVIVCNKTDLMPMENISEEDRKLIEEMKSEAMKTAMGASEEQVLLKMSTLTDEACERLLDQRVEAKMKSKKINDHLNRFHVAIPKPRDSIERLPCIPQVVLEAKAKEAAAMEKRKTEKDLEEENGGAGVYSASLKKNYILQHDEWKEDIMPEILDGHNVADFIDPDILQRLAELEREEGIREA........ 474
8 -38.100[R] KOG1491 Predicted GTP-binding protein (ODN superfamily)  ali follow..  18  4...............................................KKQVEEKKVLLGRPGNNLKAGIVGLANVGKSTFFQAITRCPGNPANYPFATIDPEEARVIVPSAHLTVYDIAGLTKGASAGEGLGNAFLSHIRSVDSIYQVVRC-DPVRDLEIINQELRLKDIEFAQKALEGAEKIAKRGGQSLEVKQKKEEMDSKEVEIINSMFLLTAKPCIYLINLSERDYIRKKNKHLLRIKEWVDKYSPGSLEERLSHMSPEDAEEELKKLQTISALPKIITTMRQKLDLISFFT----CGPDEVREWTIRRGT-KAPQAAGVIHNDLMNTFILAQVMKSAIKAAGMQKGKDYVVEDGDIIYF... 387
9 -36.900[R] COG1084 Predicted GTPase  ali follow..  19  94LNWAVGILNQLESDYMARIKRSKPSDAFGRISSVIKRIEGDLDFLDFAKN--KLRNMPTVDLDAFTVVIAGFPNVGKSTLLRTLTGAEPEVADYPFTTKGIQIGHLERKWKRIQVIDTPGLLDRPVEDMN--QAMVALENIADVIMFIFDASETCGYTLESQYSLYLGIRSVFDIPVVTVFNKMDLAENVKYLEEYINMVED..................................................................................................................................................................... 302
10 -23.700[R] COG1159 GTPase  ali follow..  13  8...............................................................CGFIAIVGRPNVGKSTLLNKLLGQKISISRKAQTTRHRIVGIHTEGPYQAIYVDTPGLHMEEKRNRLMNKAASSSIGDVELVIFVVEGTRWTPDDEMVLNKLRD-----GKAPVILAVNKVDNVQEKVDLLPHLQFLASQMNFLDIVPISAETGM-------NVDTIAGIVRKHLPEAIHHFPEDYTDRSQRFMASEIIREKLMRFLGAELPYSVTVEIERFVTNERGGYDINGLILVEREGQKKMVIGNKGAKIKTIGIEARKDMQEMFKVKSGWADDERA--RSLGYVDDL........... 301
11 -23.300[R] COG3596 Predicted GTPase  ali follow..  15  4..KNFEVLQPLQNSLSGLPL---------WVSERILQQINQLTHYE------------------PVIGIMGKTGAGKSSLCNALFAGESPVSDVAACTRDPLRFRLQIGEHFMTIVDLPGVGESGVRDTEYAALYREQLPRLDLILWLIKADDRALATD--EHFYRQVIGEAYRHKMLFVISQSDK..................................................................................................................................................................................... 159
12 -19.500[P] COG0370 Fe2+ transport system protein B  ali follow..  16  5.................................................................TYCILGNPNTGKTSLFNALTGSYEYVGNWSGVTVEKKVG--TLRSKTGKLIDLPGILNPISRDETVVTRFL-LEEKFDCMLNIVDSSQIERNLNLTVQLLE------YGAPVVMGLNMIDVAAGRGIHLNIQNLAKKLRIPILPVVARSGKGTEDILSTLS............................................................................................................................................. 158
13 -19.100[R] COG2262 GTPases  ali follow..  18  126LAQLRHLATRLVRGWTHLERQKGGIGLRGLLRNRIVQIQSRLERVEKQREQGRQSR---IKADVPTVSLVGYTNAGKSTLFNRITEARVYAADQLFATLDPTLRRIDVDVGETVLADTVGFIRHLPHD----KATLQETRQATLLLHVIDAADVQENIEAVNTVLEEID--AHEIPTLLVMNKIDM..................................................................................................................................................................................... 321
14 -18.600[R] KOG2486 Predicted GTPase  ali follow..  23  129.........................................................DCPADGLPEFALVGRSNVGKSSLLNSLVRRKALTSKKPGKTQC-----INH-NDKWYLVDLPGY-ELKQDWNKFTKDYFLNRSTLVSVFLLVDASIPVKPIDLEYASW----LGQNQVPMTLIFTKCDK..................................................................................................................................................................................... 258
15 -17.800[E] COG4917 Ethanolamine utilization protein  ali follow..  20  1...............................................................MKRIAFVGSVGAGKTTLFNALQGNYTLARK-----------TQAVEFNDKGDIDTPGEY---FNHPRWYHALITTLQDVDMLIYVHGANDPESRLPAGLLDIGV------SKRQIAVISKTDMPDADV................................................................................................................................................................................ 108
16 -16.900[R] KOG0410 Predicted GTP binding protein  ali follow..  19  233.AALQVALAQMEYQLPRLTERQSGGQVKGILRTQIGVLKKELESVRKHRKQYRSRR---VAIPVPVVSLVGYTNAGKSTLLNQLTGANVLAENRLFATLDPTTRRVQMNGKEFLLTDTVGFIQKLPTT----RATLEEIAESSLLVHVVDISHPEQQIEAVEKVMSELD--VSSIPKLVVWNKVDR..................................................................................................................................................................................... 433
17 -16.800[R] COG0218 Predicted GTPase  ali follow..  14  19.........................................................HYPQDELPEIALAGRSNVGKSSFINTMLNRKARTSGKPGKTQLLNFFNI---DDKMRFVDVPGY-KEREKWGCMIEEYLTTRENLRAVVSLVDLRHDPSADDVQMYEF----LKYYEIPVIIVATKADK..................................................................................................................................................................................... 148
18 -16.600[U] KOG0090 Signal recognition particle receptor, beta subunit (small G protein superfamily)  ali follow..  19  51...........................................................RRTKSNTVLLSGLSGSGKTVLFYQLRDGSSHQGAV--TSMEPNEGTFKGKVKPVHLIDVPG-------HSRLISKLEEYLPRAAAVVFVVDALEFLPNIRAASEYLYDISVIKNKTPVLLCCNKTDKVTA.................................................................................................................................................................................. 184
19 -15.700[R] KOG0075 GTP-binding ADP-ribosylation factor-like protein  ali follow..  18  14.........................................................SIFWKEEMELTLVGLQFSGKTTFVNVIASGQFAEDMIP--TVGFNMRKITRGNVTIKVWDIGG-------QPRFRSMWERYCRGVNAIVYMVDAADL-DKLEASRNELHSLKPQLAGIPVLVLGNKRDLPGA.................................................................................................................................................................................. 137
20 -15.600[R] COG1160 Predicted GTPases  ali follow..  21  6..................................................................VALVGRPNVGKSTLFNRLTRTRDAVADFPGLTRDRKYGHAHIAGYDFIVIDTGGIDGTEEGEEKMAEQSLLAIDEADIVLFLVDARAGLTAAD---IGIANYLRQRQNKITVVVANKTD...................................................................................................................................................................................... 123
21 -15.600[R] COG0486 Predicted GTPase  ali follow..  19  135..AQAEAIADLIDASSEQAARSALKSLQGEFSNKVNQLVDSVIYLRTYVEASEAKQGSILREGM-KVVIAGRPNAGKSSLLNALAGREAAVTDIAGTTRDVLREHIHIDGMPLHIIDTAGLREATDEVERIGVRAWSEIEQADRILLMLDSTEADNQDLEKVRS-EFLTKLPSNIPVTIVRNKADL..................................................................................................................................................................................... 350
22 -15.500[J] KOG1191 Mitochondrial GTPase  ali follow..  15  262..SQAENVEKLISAKSSAAADAALEGIQGGFSSLVKSLRAQCIELLTEIEADTANYDKLLQSGL-QIAIVGRPNVGKSSLLNAWSKSERAVTEVAGTTRDVVEANVTVRGVPITLLDTAGIRETNDIVEKIGERSETAAKVADVIIMAVSAVEGWTEEDTELLRKLFGGLLYLKQPMILVMNKIDCAPPGSCDQL-----------------------------------------------------------EDQRKKEEVFHKSVFTSAVTGQGIEELEDAILEILGLDRVPTGGHQWTVNQRQCEQLVRTKEALVRLREAIEDEIPIDFWTIEL-REAALSLAQISGQ---DVSEEVLS.... 603
23 -15.300[TU] KOG1954 Endocytosis/signaling protein EHD1  ali follow..  17  31..KTRSMFSWLGGDSSKKKNKEVLETVSEGLRKIYKQKLLPLEEFHKFHDFHSPALDDPDFDAKPMILLVGQYSTGKTTFIRYLLESDPEPTTDRFIAVMQFRALSGFGNASVTIVDTPGILSGEKQRIDRGYDFTGVLERVDRIILLFDAHKL-DEFKRCIEALAGNEDKIR-----IVLNKSDMVDHQQLMRV............................................................................................................................................................................ 266
24 -15.200[U] KOG0077 Vesicle coat complex COPII, GTPase subunit SAR1  ali follow..  20  18.............................................................QKEAKILFLGLDNAGKTTLLHMLKDERLVQHQ---PTQHPTSEELSIGKIKFKAFDLGG-------HQIARRVWKDYYAKVDAVVYLVDAYDK-ERFAESKRELDALDEALATVPFLILGNKIDIPYA.................................................................................................................................................................................. 136
25 -14.600[R] KOG0074 GTP-binding ADP-ribosylation factor-like protein ARL3  ali follow..  21  15.............................................................DQEVRILLLGLDNAGKTTLLKQLASED-------ISHITPTQGFVQSQGFKLNVWDIGG-------QRKIRPYWKNYFENTDILIYVIDSADR-KRFEETGQELAELEEKLSCVPVLIFANKQDLLTA.................................................................................................................................................................................. 133
26 -14.500[U] KOG0070 GTP-binding ADP-ribosylation factor Arf1  ali follow..  18  15.............................................................KKEMRILMVGLDAAGKTTILYKLKLGE-------IVTTIPTIGFVEYKNISFTVWDVGG-------QDKIRPLWRHYFQNTQGLIFVVDSNDR-DRVVEARDELHRMEDELRDAVLLVFANKQDLPNA.................................................................................................................................................................................. 133
27 -14.500[UZ] KOG0073 GTP-binding ADP-ribosylation factor-like protein ARL2  ali follow..  20  14.............................................................ERELRLLMLGLDNAGKTTILKKFNGED-------IDTISPTLGFLEHRGFKLNIWDVGG-------QKSLRSYWRNYFESTDGLIWVVDSADR-QRMQDCQRELQSLEERLAGATLLIFANKQDLPGA.................................................................................................................................................................................. 132
28 -14.500[U] KOG0072 GTP-binding ADP-ribosylation factor-like protein ARL1  ali follow..  22  12..........................................................LLGSREMRILILGLDGAGKTTILYRLQVGE-------VVTTIPTIGFVTYKNLKFQVWDLGG-------QTSIRPYWRCYYSNTDAIIYVVDSADR-DRIGISKDELLYMEEELAGAILVVLANKQDMDGC.................................................................................................................................................................................. 133
29 -14.400[U] KOG0071 GTP-binding ADP-ribosylation factor Arf6 (dArf3)  ali follow..  17  16..........................................................LFSNKEMRILMLGLDAAGKTTILYKLKLNQ-------SVVTIPTVGFVTYKNIKFNVWDVGG-------QDKIRPLWRHYFTGTKGLIFVVDSADS-NRISEARQELHRIDREMRDCLLLVLANKQDLPGA.................................................................................................................................................................................. 137
30 -14.300[R] COG1100 GTPase SAR1 and related small G proteins  ali follow..  20  15............................................................SNKELRILILGLDGAGKTTILYRLQIGE-------VVTTKPTIGFLSYKNLKLNVWDLGG-------QTSIRPYWRCYYADTAAVIFVVDSTDK-DRMSTASKELHLMEEELQDAALLVFANKQDQPGA.................................................................................................................................................................................. 134
31 -13.600[R] COG2229 Predicted GTPase  ali follow..  17  5.................................................................KIIFTGPVGVGKTTAIAAISDSDMTLDRKRNTTVAMDYGAISLEDTKVHLYGTPG----------------ILSQGSMGLVLLLDNART-NPLKDLEFFLHSFRGLLEKAPVVVGITKMDIRSQPGIDVYHKYLAKHNLNVPVFEIDARKEDDVKQLVSAMLFSIDPGLE.................................................................................................................................... 177
32 -13.400[R] KOG2485 Conserved ATP/GTP binding protein  ali follow..  22  143.................................................................LVMVVGVPNVGKSALINSIHQIAATVGPLPGVT-QDIAGFKIAHRPSIYVLDSPGVLVPSIPDIETGLKLVGEERIAQYFLAILNIRGT..................................................................................................................................................................................................................... 252
33 -13.400[U] KOG0076 GTP-binding ADP-ribosylation factor-like protein yARL3  ali follow..  16  12..........................................................WNKKEQYSILILGLDNAGKTTFLETLKKEYSLAFK-ALEKIQPTVGQIPVDSKQLKFWDVGG-------QESLRSMWSEYYSLCHGIIFIVDSSDR-ERLDECSTTLQSVDEEIEGVPILMLANKQDRQDR.................................................................................................................................................................................. 140
34 -13.100[U] KOG3887 Predicted small GTPase involved in nuclear protein import  ali follow..  12  1MSQVLGKPQPQDEDDAEEEEEEDELVGLADYGDGPDSSDADPDSGTEEGVLDFSDPFSTEVK--PRILLMGLRRSGKSSIQKVVFH---KMSPNETLFLESTNKVSNSSFVNFQIWDFP----GQIDFFDPTFDYEMIFRGTGALIFVIDSQDDYEALARLHLTVTRAYKVNTDINFEVFIHKVDGLSDDHKIETQRQRANDDLADAGLEKIHLSFYLTSIYDHSIFEAFSKVVQKLIPQLPTLELLNIFISNSGIEKAFLFDVVSKIYIATDSTPVDMQTYELCCDMIDVVIDISCIYGLKEDGAGTPYDKESTAILNNTTVLYLKEVTKFLALVCFVREESFERKGLIDYNFHCFRKAIHEV... 367
35 -12.800[T] KOG3886 GTP-binding protein  ali follow..  12  8...............................KTTEKENLGPRMDPPLGEPEGSLGWVLPNTAMKKKVLLMGKSGSGKTSMRSIIFA---NYIARDTRRLGATILD---GNLVLNLWDCGG--QDTFMENYFTSQRDNIFRNVEVLIYVFDVESREKDMHYYQSCLEAILQNSPDAKIFCLVHKMDLVQEDQRDLIFKEREE...................................................................................................................................................................... 207
36 -11.600[R] COG1161 Predicted GTPases  ali follow..  14  116....GNDLLMVANKRDVLPKSLKVGKLTAWLREQAASRSLKPKDILVTSAQNKDDVAELYYRRGRDVYVVGVTNVGKSTLINAIIKSAITTSRFPGTTLDKI-------DEDSALIDTPGIIHRGQIAHYLEPEDLKYVSPRKEI.............................................................................................................................................................................................................................. 264
37 -11.100[O] KOG0448 Mitofusin 1 GTPase, involved in mitochondrila biogenesis  ali follow..  11  18ITAIFDQLLEFVTEGSHFVEATYKNPELDRIATEMQGYKDKLSIIGEV------------SRRHMKVAFFGRTSSGKSSVINAMLWDK-PSGIGHITNCFLSV-YLMTEGSDLVLVDSPGT----DVTTELDSWIDKFCLDADVFVLVANSESTLMNTE--KHFFHKVNEWLSKPNIFILNNRWDA..................................................................................................................................................................................... 241
38 -10.900[R] KOG1533 Predicted GTPase  ali follow..  20  36..................................................................VLVIGAPGAGKSTFCAGLTNLDPANDTMAYAPLGPNGALKEANHKKYLIIDCPGQLE-LYKSEGELWKVIRFLEKSGCALHLADSLYCSDPSKFISVALSTLATMVTMEMPQVCLSKADL..................................................................................................................................................................................... 206
39 -10.600[V] KOG1707 Predicted Ras related/Rac-GTP binding protein  ali follow..  13  12.............................................................PKPIRIVVVGEKGSGKSSLIMAAARNTFHPNIPSLLPYTNLPSEFFPDRIPATVIDTSSRPEDKGK-------VVKEVRQADAIVLTFAFDRPETLDRLSKYWLPLFRQLEVRVPIIVAGYEVDNKEAYNHFSI------EQITSALMKQYREVETSIQWSAQRLDQAKDVLYYAQKAVIDPVGPVFDQENNVLKPRCIAALKRIFLLSDHNMDGILSDEELNELQDTPLVPCEIKQMKNVMQVTFPQGVNERGLTLDGFLF-LNTRLIEEARIQTLW--------RKFGYSNDLR.......... 292
40 -10.600[K] KOG1534 Putative transcription factor FET5  ali follow..  18  6..................................................................AFVCGVASSGKSTFCGALMNLDPAAENFEWEPTVDIRDLISIDDVDYLIFDMPGQIE-LYTHVPILPALIRHLQVT-CAVYLLESQFLVDRTKFFAGVLSAMSAMVMMEVPHILLSKMDL..................................................................................................................................................................................... 177
41 -10.200[L] KOG1532 GTPase XAB1, interacts with DNA repair protein XPA  ali follow..  18  9...............................EQDIVEESQKLVDSLDKLRVSAASSSSNFKKKPIIIIVVGMAGSGKTSFLHRLVNLDPAVMSLPFGALGPNGGILT-DQLDYVLVDTPGQIE-IFTWSASGAIITEAFAST-VVTYVVDTPRSSSPITFMSNMLYACSILYKTRLPLVAFNKTDV..................................................................................................................................................................................... 215
42 -10.000[T] COG1217 Predicted membrane GTPase involved in stress response  ali follow..  18  2............................................................IENLRNIAIIAHVDHGKTTLVDKLLKLSGTLDR---ITILAKNTAIKWNGYNINIVDTPGHAD-------FGGEVERVMSMVDSVLLVVDAQDGPMQTRFVTQKAFKAGL-----RPIVVVNKIDRPGAR................................................................................................................................................................................. 136
43 -9.970[R] KOG2484 GTPase  ali follow..  19  197.ENLNNWIKYFRRSGPVTAFKASTQDQANRLGRRKLREMKTEKAMQGSVCIGAELLMSMGIKTSIRVGVVGIPNVGKSSIINSLTRGRSMVGSTPGVTKSMQEVEL---DSKIKLIDCPGIV------------FTSGGENSHAVL-VGDVKDPFTIAESVLKRASK........................................................................................................................................................................................................ 360
44 -9.950[J] COG4108 Peptide chain release factor RF-3  ali follow..  14  4....................................................STTPYFGEVSKRRTFAIISHPDAGKTTITEKVGRAIQVAGTVK-ISVTTSVMQFPYGDCLVNLLDTPGHEDFSED-------TYRTLTAVDSCLMVIDAAKGVERTRKLMEVTRLRDT-----PIVTFMNKLDREIRD................................................................................................................................................................................. 152
45 -9.810[R] KOG1673 Ras GTPases  ali follow..  10  103.................................................................KISLLGDCQTGKTTFVVKYVGDE-------NQSFLEMTGLVQGVTISFSIWDVGG------DEKRSKDHIPIACKDAVAILFMFDLTSR-STLNSVFGWYSQARKWNKTAIPILIGTKFDD---FVRLPPNLQWTIVTQARAYAKVMNASLFFSSATHNINVNKIFKFILAR.................................................................................................................................. 265
46 -9.800[R] KOG0395 Ras-related GTPase  ali follow..  17  2..............................................MKTLSSGNCTLSVPAKNSYRMVVLGASRVGKSSIVSRFLNGRPTIEDFHRKVYN-----IRGDMYQLDILDT----SGNHPFPAMRRLSILTGDVF-ILVFSLDNRESFDEVKRLQKQILEVKSCLKNKPMVICGNKNDHGELC................................................................................................................................................................................. 148
47 -9.770[R] KOG1424 Predicted GTP-binding protein MMR1  ali follow..  22  383............................................................KDGQLTVGLVGYPNVGKSSTINTIMGNKKSVSATPFQTL--------YVEPGLCLCDCPGLV---------------VSTKAEMTC-IDQMRDHVPPVSLVCQNI.......................................................................................................................................................................................................... 478
48 -9.710[J] KOG0462 Elongation factor-type GTP-binding protein  ali follow..  18  36.........................................................EFTPDKIRNFGIVAHVDHGKSTLADRLLEMCGAVPPGQ-ITVKAQTAALRHRGYLLNLIDTPGHVD-------FSAEVSRSLAVCDGILLLVAANQVQAQTIANFWLAFEKNIQI-----IPVINKIDLPGAD................................................................................................................................................................................. 170
49 -9.550[J] KOG0468 U5 snRNP-specific protein  ali follow..  12  129.............................................................PLIRNVALVGHLHHGKTTFVDCLIRQTHPQFETMEESIKATPVTLVLQDVKLNIFDTPGHVNFSDE-------ATAAMRMSDGVVLFIDAAEGVMNTERLLKHAVQERQ-----AITVCINKIDRLILELKLP............................................................................................................................................................................. 272
50 -9.540[J] KOG0460 Mitochondrial translation elongation factor Tu  ali follow..  11  21...............................LNRISFASGLINRFTVPARTYADEKVFVRKKPHVNIGTIGHVDHGKTTLTAAITKCLSDLGQASFMTISSAHVEYETANRHYAHVDCPGYIKNMITG----------AATMDGAIIVVSATDGQMPQ---TREHLLLARQVGVKQIVVYINKVDMVEPDMIELV------EMEMRELLSEYGFDGDNTPIVSGSALCAL-EGREPEIGLNSITKLMEAVDSYITLPERKTDVPFLMAIEDVFSISGRGTV-------------------VTGRVERGTLKKGAEIEIVGY----GSHLKTTVTGIEMFKKQLDVAGDNCGLLLRSIKREQLK.... 330
51 -9.540[J] KOG0469 Elongation factor 2  ali follow..  18  10......................................................RALMDRKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAG---ITIKSTAISLFFELEKINLIDSPGHVDFSSE-------VTAALRVTDGALVVVDCVSGVCQTETVLRQAIAERI-----KPVLFMNKMDRALLELQLG............................................................................................................................................................................. 182
52 -9.510[J] COG0050 GTPases - translation elongation factors  ali follow..  14  15..................................................................VGTIGHVDHGKTTLTAAITTVLAKTYGGSARTINTSHVEYDTPARHYAHVDCPG------------KNMITGAAQMDGAILVVAATDGPMPQ---TREHILLGRQVGVPYIIVFMNKCDMVDDEELLELVEMEVRE..................................................................................................................................................................... 156
53 -9.410[J] COG0480 Translation elongation factors (GTPases)  ali follow..  14  6...........................................................PLEKVRNIGIAAHIDAGKTTTTERISGIIHKIGEVH-ITITAAAISTSWKDYQINIIDTPGHVDFTIE-------VERSMRVLDGVIAVFCSVGGVQQSETVWRQADRYKV-----PRIAFINKMDRTGANFYRVHEQMRDR-DLVRKRAYMYNNDQGTDIEETDIPADLQDQVEEYYTKLVEAVAETDDD-RSALRKGTIAGTIVPVLCGSAFKNKGVQLMLDAVVDYLPAPTEVPPIQGTLPNGDAIERRADDNEPLAALAFKIMADPYGRLTFVRVYSGVLK-KKERISRLVLMKADDRQDV... 363
54 -9.220[H] COG1763 Molybdopterin-guanine dinucleotide biosynthesis protein  ali follow..  16  4..................................................................FGITGWKNSGKTTLTEKLVAE--------LVRRGWKVSTVKHAHHDFDI-DKPG--ADSFRHRQAGATEVAIVSGNRWALMHELRGEDEPPLESILSRLAPCDIVLVEGYKRESHRKIET..................................................................................................................................................................................... 112
55 -9.180[M] COG0481 Membrane GTPase LepA  ali follow..  14  1............................................................MKNIRNFSIIAHIDHGKSTLSDRLIQTCGGLSDREMETIKAQSVTLNYETYQLNFIDTPGHVD-------FSYEVSRSLAACEGALLVVDAGQVEAQTLANCYTAIEMNLEV-----VPILNKIDLPAAD................................................................................................................................................................................. 139

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 5 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Harder T, Godzik A. JAFA: a protein function annotation meta-server. Nucleic Acids Res. 2006 Jul 1;34(Web Server issue):W379-81.