current user: public

If you have questions about the server, please let us know.

Query: [R] KOG1533 Predicted GTPase, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300
# Score Template Links and tools%idFirst MQMNLNEKKQLLRVRVYATSEKGENLGSTHWTMYGVLVIGAPGAGKSTFCAGLTDIFSQTKRPFLTINLDPANDTMAYAPDVNITEMITVNDVMDRLGLGPNGALKYCIETLGANCNWLLQKIEANHKKYLIIDCPGQLELYKSEGELWKVIRFLEKSGVRLCALHLADSLYCSDPSKFISVALSTLATMVTMEMPQVNCLSKADLFSEDGTYDLEFFSHLPDVNRLLDLLNEVPGLEKYRKLNEAICGVISDFDLVSFVPLAVENKESMMKVIQMVDAANGFSLTEQGDIRELILNSKALast
1 -98.100[R] KOG1533 Predicted GTPase  ali  100  1MQMNLNEKKQLLRVRVYATSEKGENLGSTHWTMYGVLVIGAPGAGKSTFCAGLTDIFSQTKRPFLTINLDPANDTMAYAPDVNITEMITVNDVMDRLGLGPNGALKYCIETLGANCNWLLQKIEANHKKYLIIDCPGQLELYKSEGELWKVIRFLEKSGVRLCALHLADSLYCSDPSKFISVALSTLATMVTMEMPQVNCLSKADLFSEDGTYDLEFFSHLPDVNRLLDLLNEVPGLEKYRKLNEAICGVISDFDLVSFVPLAVENKESMMKVIQMVDAANGFSLTEQGDIRELILNSKA 300
2 -88.800[K] KOG1534 Putative transcription factor FET5  ali follow..  33  1..............................MVKVAAFVCGVASSGKSTFCGALMSYMKSVGRSCHLVNLDPAAENFEWEPTVDIRDLISIDDVMEELDYGPNGGLIYCFEFLMENLDWLNEEIGDYDEDYLIFDMPGQIELYTHVPILPALIRHLQVTNFRPCAVYLLESQFLVDRTKFFAGVLSAMSAMVMMEVPHINLLSKMDLLKDNNNITKAELKRFLNTDPLLTGEINETTNPKFHELNRCIVQLIDDFNMVNFLPLESGNEESVSRVLSYIDDATQWYEDQEPKDPDRFEADDL 272
3 -76.500[L] KOG1532 GTPase XAB1, interacts with DNA repair protein XPA  ali follow..  17  10.QDIVEESQKLVDSLDKLRVSAASSSSNFKKKPIIIIVVGMAGSGKTSFLHRLVCHTFDSKSHGYVVNLDPAVMSLPFGANIDIRDTVKYKEVMKQYNLGPNGGILTSLNLFATKFDEVVSVIEKRADQYVLVDTPGQIEIFTWSASGAIITEAFAS-TFPTVVTYVVDTPRSSSPITFMSNMLYACSILYKTRLPLVLAFNKTDVADHKFALEWMEDFEVFQAAIQSDNSYTATLYEFYRNIRSVGVSAISGAGMDGFFAIEASAEEYMETYKADLDMRKADKERLEEERKKHEMEK.. 316
4 -17.800[OK] COG0378 Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase  ali follow..  14  2..............................KRPLIIGVGGPVGAGKTMLIERLTRYLSTKGYSMAAITNDIYT---KEDARILLNTSVLPADRIAGVETGPHTAIREDASMNFAAIEEMC--DKHPDLQLLFLESGGDNLSATFSPDLVDF------------SIYIIDVAQGEKIPRKGGQGMIKSDLF---------IINKVDLAPYVGA-----------------------------NVEVMKADTLKSRGNKDFFVTNLKTDEGLKSVADWIEKRLQLALLEE............ 206
5 -17.600[R] KOG2486 Predicted GTPase  ali follow..  11  105..VLSKYARDAQVVQADYVKSSVKTEDCPADGLPEFALVGRSNVGKSSLLNSLVR-----RKRLALTSKKPGK-----------TQCINHFRI---------------------------------NDKWYLVDLPGSAPHELKQDWNKFTKDYFLNRSTLVSVFLLVDASIPVKPID-----LEYASWLGQNQVPMTLIFTKCDKRKK-----------------------KKNGGKKPEANIKEFQDLIQGFTTPPWIMTSSVTNQGRDEILLHMAQLRNYWLKH............. 318
6 -15.900[D] COG2894 Septum formation inhibitor-activating ATPase  ali follow..  13  1..............................MARIIVVTSGKGGVGKTTSSAAIATGLAQKGKKTVVIDFDIGLRNLDLIMGCERRVVYDFVNVIQNLYILPASQTRDKDALTREGVAKVLDDLKAMDFEFIVCDSPAGIE--------TGALMALYFAD-EAIITTNPEVSSVRDSDRILGIL..................................................................................................................... 160
7 -15.800[R] COG1341 Predicted GTPase or GTP-binding protein  ali follow..  12  2..MRMASNKAMFTNDVPQDRLLAVEKIESLRKPAKVMIIGDVDTGKTTLTIYLANELLSRGFRVAIIDSDIGQKGILPPATISLAFVLDDLKAFSHYFIGPNQYFGEMVVGVMKLSELAMK-----FSDVVLIDTTGMIY-----GSGVELKRMKIEAVKPNLILALERNNELAPILKGYEDITIRLEV............................................................................................................... 187
8 -15.100[R] COG1084 Predicted GTPase  ali follow..  15  132..SSVIKRIEGDLDFLDFAKNKLRNMPTVDLDAFTVVIAGFPNVGKSTLLRTLT------------------------------------------------GAEPEVADYPFTTKGIQIGHLERKWKRIQVIDTPGLLDRPVEDMNNIELQAMVALENIADVIMFIFDAS--TCGYTLESQYSLYLGIRSVFDIPVVTVFNKMDLAENVKYLEEYIN------------------------------------MVEDPLKVSAFEGRGVSKIIKKLEGLYE.................. 326
9 -15.100[D] COG3640 CO dehydrogenase maturation factor  ali follow..  11  9...................................LIISGRGGSGKSTLVTLIAHTLKEQKKRVLVVDSDESNIGLSGILGIEFREKFDLESLSQEFVCWVGSLGLMQIGKIDHATRDFLNHVRLEEDQWVLVDTEAGVE-----HFGRGIVEGADA------VVMVVDPSSDA-----VLLAEKAAKLTHEADKRFGVILNKIDEETEPILTE...................................................................................... 215
10 -14.900[A] COG5623 Pre-mRNA cleavage and polyadenylation factor IA/II complex, subunit CLP1  ali follow..  17  94TITVKPNHTMKYIYNLHFMLEKIRMSNFEGPR---VVIVGGSQTGKTSLSRTLCSYLKFNAYQPLYINLDPQQPIFTVPGCISATPILLHNKQPMVKNFGLER-YLECISQLGQVVGQRLHLDPQVRRSGCIVDTPSISQLDENLAELHHIIEKL-----NVNIMLVLCSETDPLWEKVKKTFGPELGNNNIFFIPKLDGVSAVD............................................................................................... 317
11 -14.800[E] COG4917 Ethanolamine utilization protein  ali follow..  14  4...................................IAFVGSVGAGKTTLFNALQGNYTLARKTQAVEFNDKG-----------------------------------------------------------DIDTPG--EYFNHPRWYHALITTLQDVD---MLIYVHGAN---------ESRLPAGLLDIGVSKRQIAVISKTDMPDAD--------------------------------VAATRKLLLETGFEEPMFELNSHDPQSVQQLVDYLASLTKQEEAGEKTHHSE...... 159
12 -14.700[U] KOG0090 Signal recognition particle receptor, beta subunit (small G protein superfamily)  ali follow..  14  58...................................VLLSGLSGSGKTVLFYQLRDGSSHQGAVT---------------------------------SMEPNEGTF--------VLHNENNTKKGKVKPVHLIDVPGHSRLISKLEEYLPRAAAV---------VFVVDALEFLPNIRAASEYLYDIASVIKNKTPVLLCCNKTDKVTAHTKEFIRKQMEKEIDKLRSAISTADIANDFTLGIEGEVFSFSHCHNKVTVAEASGLTGE-TDQVQEFIREHVK.................. 259
13 -14.500[A] KOG2749 mRNA cleavage and polyadenylation factor IA/II complex, subunit CLP1  ali follow..  11  102.....................TSSTRDSASSQGPRVIIVGDIDSGKSTLAKMLLNWAVKDGWKPTFVDLNVGQSSITIPGTIAAAPIKM-LDKALIHYFGPSVNYRTLVEELARELKEEFSANAESRASGMVIDTMGFIV-----REGYALLLHAIRTFNASLVIVVGQEEKLVYDLKKNLKFKKNLQVLNLEKSEGVFSRSSDF............................................................................................... 294
14 -14.400[P] COG1348 Nitrogenase subunit NifH (ATPase)  ali follow..  13  4...................................VAIYGKGGIGKSTTTQNLTSGLAELGKKIMVVGCDPKADSTRLDTLREEGEDVDLDTIMKTGFGNESGGPEPGVGCAGRGIITSINMLEQLGADYVFYDVLGDVEMMAMYAANNISISKFANTGGVRLGGIICNSRKVKNEKELLEAFAKELGTQLIYFVPRSHEVQKAEINKQTVIQFNPKDEQADEYRALAKAIDGNDMYVVPKPMADKLEAILMEYGLLE.......................................... 272
15 -14.300[E] COG1703 Putative periplasmic protein kinase ArgK and related GTPases of G3E family  ali follow..  14  22LAQAMTLVESRHPRHQALSTQLLDAIMPYCGNTLRLGVTGTPGAGKSTFLEAFGMLLIREGLKVAVIAVDPSS---PVTGGSILGDKTRMNDLARAEAAGHLGGA-------SQRARELMLLCEAAGYDVVIVET-GQSETEVARMVDCFISLQIAGGGDDLQGI---------------------------MEVADLIVINKDD----------------------GDNHTNVAIARHMYESALHILRRKYDEWQPRVLTCSALEKRGIDEIWHAIIDFKTALTASGRLQQVRQQQSVE 276
16 -13.700[R] KOG1490 GTP-binding protein CRFG/NOG1 (ODN superfamily)  ali follow..  17  138..CTVLKRITPSLAYLEQIRQHMARLPSIDPNTRTVLICGYPNVGKSSFMNKVT-------------RADVDVQPYAFTT--------------KSLFVG---------------------HTDYKYLRYQVIDTPGILDRPFEDRNIIEMCSITALAHLRAAVLFFLDSGSCGYTIAQQAALFHSIKSLFM-NKPLVIVCNKTDLMPME-------------------NISEEDRKLIEEMKSEAMKTAMGASEEQVLLKMSTLTDEGVMSVKNAACERLLDQRVEAKMKSKKIND... 365
17 -13.700[R] COG3596 Predicted GTPase  ali follow..  14  1MVMKNFEVLQPLQNSLSGLPLWVSERILQQINQLVIGIMGKTGAGKSSLCNAL------FAGEVSPVSDVAACTR-----------------------------------------DPLRFRLQIGEHFMTIVDLPGVGE--RDTEYAALYREQLPRLD---LILWLIKA---DDRALATDEHFYRQVIGEAYRHKMLFVISQSDKAEPTSGGNILSTEQKQNISRKICLLHE------------------LFQPVHPVCAVSVRLQWGLRVMAERMIKCL................... 216
18 -13.700[R] COG0218 Predicted GTPase  ali follow..  16  28...................................IALAGRSNVGKSSFINTMLN-----RKNLARTSGKPGK-----------TQLLNFFNI---------------------------------DDKMRFVDVPGRVSKKEREKWGCMIEEYLTTRENLRAVVSLVDLRHDPSADD-----VQMYEFLKYYEIPVIIVATKADKIPRG----------------------------KWNKHESAIKKKLNFDPSDDFILFSSVSKAGMDEAWDAILEKL................... 195
19 -13.500[R] COG2229 Predicted GTPase  ali follow..  14  1..............................MRENKIIFTGPVGVGKTTAIAAISD-----------------------------EALVQTDASASDMTLDRKRNTTVAMDYGAISLDE--------DTKVHLYGTPGQ-ERF------NFMWEILSQ---SMGLVLLLDNAR-TNPLKDLEFFLHSFRGLLE-KAPVVVGITKMDIRSQPGIDVYHKYLAKHNLNVPVFEIDARKEDDVKQLVSAMLFSIDPGLEV............................................ 178
20 -12.900[R] KOG2750 Uncharacterized conserved protein similar to ATP/GTP-binding protein  ali follow..  18  318...................NQLLFSTSKSDYVVPRLMVCGPKGSGKSSFSRYITNRLLQQYRHIAYLDLDPGQPEVVPSGHISLYYIMLFPTYMLRLHLGPQKDPDHYIACVTRLFAEYKDYIFNQEIS-LIINCPGWIR-----GGGAELLSSIVDICQPTEVVYMSREDMKSS............................................................................................................................. 487
21 -12.700[H] KOG2743 Cobalamin synthesis protein  ali follow..  13  11.EEDPAEEDCPELVPIETTQSEEEEKSGLGAKIPVTIITGYLGAGKTTLLNYILT--EQHSKRVAVILNESGEGSALEKSLAVSQGGELYEEWLE-----RNGCLCCSVK-GLRAIENLMQKKGKF--DDILLETTGLAD----GAVASMFWAELGSDIYLDGIITIVDSKYGLKHLTEEKPDGLINEATRQVALADIILINKTDLVPEEDVKKLRTTIRSIN............................................................................. 224
22 -12.500[TU] KOG1954 Endocytosis/signaling protein EHD1  ali follow..  16  95...................................ILLVGQYSTGKTTFI----RYLLESDFPGIRIGPEPTTDRFIAVMHGDEEGSIPGNALVVDAKK-QFRALSGFGNAFLNRFQ-CSTLPNQVLESVTIVDTPGILS-YDFTGVLEWFAERVD------RIILLFDAHKLDISDEFKRCIEALAGNEDKIRI----VLNKSDMVDHQQLMRV..................................................................................... 266
23 -12.500[R] KOG1489 Predicted GTP-binding protein (ODN superfamily)  ali follow..  17  344.....................................LIGLPNAGKSTILNKIS-------------NAKPKIGHWQFTT------------------LSPTIGTV---------------SLGFGQDVFTVADIPGIIQASLDKGMGLEFLRHIERSN---GWVFVLDLS-NKNPLNDLQLLIEEVGTLEKVTKNILIVCNKVDIDAEK---------------------------SESFAKYLQVEKFSKSQE-WDCVPISALREKT............................... 499
24 -12.500[R] COG0536 Predicted GTPase  ali follow..  14  164.....................................LVGFPSAGKSSLISVMS-------------AAKPKIGDYPFTT------------------LQPNLGVV-----------------NVGHETFTMADVPGLIPASEGKGLGLDFLRHIERTS---VLVHVVDTALEAELAAYQSALDEDTGLGDLSQRPRLVVLNKADVPEAEELA-------------------------------EFLKEDIEKQFGWPVFIISAVARKGLDPLKYKLLEIVQDARKKRPKEKAESVIIK. 358
25 -12.200[D] COG0455 ATPases involved in chromosome partitioning  ali follow..  12  9IQRDSRRRTGMTNKMIYDQASGLRRLTQPSVTKVISVTGGKGGVGKSNVTLGMAICMAKQGKKVMVLDADLGLANVDIRPKRNLGHVLELKDAIVEGPHG-TSGTQSMTELSHAQHVGLIRAFGTLEDDILLIDTAAGIS---------DMVVSFSRAAQDVVVVVCDEPTSITDAYALIKLL..................................................................................................................... 197
26 -12.200[R] COG1159 GTPase  ali follow..  13  11...................................IAIVGRPNVGKSTLLNKL------LGQKISITSRKA-----------------------------------------QTTRHRIVGIHTEGPYQAIYVDTPG-----LHMEEKRAINRLMNKAASSSLVIFVVEGTRWTPDDEMV------LNKLRDGKAPVILAVNKVDNVQEK------------------------------VDLLPHLQFLASQMNFLDIVPISAETGMNVDTIAGIVRKHLPEAIHHFPEDYITDRSQR. 191
27 -12.200[P] KOG2825 Putative arsenite-translocating ATPase  ali follow..  15  22...................................IFVGGKGGVGKTTTSCSLAIQMSKVRSSVLLISTDPA-HNLSDAFGTKFGK-VPGFDNLSAMEIDPNLSI----EMTEQADQQNPNNPLSGMMQDLAFTIPGIDEAL----AFAEILKQIKSMEFDCV---IFDTAPTGHTLRFLNVLEKALGKLGGLSSRFGPMINQMGSIMGVNANE----------------QDLFGKMESMRANISEVNKQFKNPDLTTFVCVCISEFLSLYETERMIQEL.................... 245
28 -12.100[R] KOG0395 Ras-related GTPase  ali follow..  15  2...............MKTLSSGNCTLSVPAKNSYRMVVLGASRVGKSSIVSRFLN-------GRFEDQYTPTIEDF-HRKVYNIRDMYQLD----------------------------------------ILDTSGNHPF-------PAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSCLK-ELPMVICGNKNDHGELCRQVP-----------------------------TTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVL....................... 186
29 -12.100[D] KOG3022 Predicted ATPase, nucleotide-binding  ali follow..  11  33.....NQEACATAPKGPDPDLVAIAERMSTVKHKILVLSGKGGVGKSTFSAQLSFALAGMDHQVGLMDIDICGPSIPKMLGLEGQEIHQSNL-LGVMSIGSDEAVIWRGPRKNGLIKQFLKDVYWGEIDYLVVDAPSDEHI--------SIVQYLLPTGIDGAIIVTTPQEVS------LIDVRKEVSFCKKVGVPVLGVVENMS............................................................................................... 235
30 -11.900[U] KOG3887 Predicted small GTPase involved in nuclear protein import  ali follow..  16  65...................................ILLMGLRRSGKSSIQKVVFHKMSPNE----TLFLESTNK-------------ICREDVSNSSFV-----------------------------NFQIWDFPGQIDFFDPTFDYEMIFRGTG------ALIFVIDSQDDYMEALARLHLTVTRAYKVNTDINFEVFIHKVDGLSDDHKIETQRDIHQRANDDLADAGLEKIHHSIFEAFSKVVQKLIPQLPTLENLLNIFISNSGIEKAF.......................... 261
31 -11.700[NU] COG2874 Predicted ATPases involved in biogenesis of archaeal flagella  ali follow..  10  38...................................TLIEGENDTGKSVLCQQFVYGGLMSGHNIAYYTTENTIKSF--SLSLDVSDFYA-WGYLRVFPVHLE-GIDWSTEQMRSILNLVANHIKTIRENIAIIDSLTMFTTYSTEDDVLEFLTRLKNCDNGKTILITLHQHAFKEDTLVRIRSACDCHLFLRKEQVGDRYVSVLEVSK............................................................................................ 212
32 -11.700[P] COG0003 Oxyanion-translocating ATPase  ali follow..  14  4...................................ILMTGKGGVGKTSVAAATGLRCAELGHKTLVLSTDPA-HSLADSFDLELHEPRLVKENLWGAELDALMELEGNWGAVKRYITQVLQARGLDGQAEELAILPGMDEIF----GLVRMKRHYDEADYDVL---IIDSAPTGTALRLLS-------------LPEVWYMRRFYKPLQGMSVALRPLVEPLFRPIAGFSLPDKEVMDAPYEFYEQIEALEKDNTQTSVRLVTNPEKMVLKESLRAHAYLSLYN................ 238
33 -11.600[R] COG0523 Putative GTPases (G3E family)  ali follow..  15  7...................................TLLTGFLGAGKTTLLRHILN--QHGFKIAVIEN----------EVSVDDQLIGDRATQIKTLT---NGCICCTRS-LEDALLDLLDSRDRGDIDRLVIECTGMAD----------IIQTFFSHDVLCERYLLDGVIALVDAVHANEQMNQFTIAQSQIGYADRILLTKTDVAGDSEKLR...................................................................................... 170
34 -11.500[T] KOG3886 GTP-binding protein  ali follow..  9.TTEKENLGPRMDPPLGEPEGSLGWVLPNTAMKKKVLLMGKSGSGKTSMRSIIFANYIARDTRRLGATILDRIHSLQINSSLSTYSLVDSVGNTKTFDVEHS------------------HVRFLGNLVLNLWDCGGQ-DTFMENYFTSQRDNIFRNVE---VLIYVFDVE-LEKDMHYYQSCLEAIL-QNSPDAKIFCLVHKMDLVQEDQRDLIFKERELSRPLECSCFRTSIWDETLYKAWSSIVYQLIPNVQQLEMNLRNFAEIIEADEVL.......................... 265
35 -11.400[R] KOG2878 Predicted kinase  ali follow..  13  12...................LKFLEKQPKPEGRPFILGISGPQGSGKSTLASALDTELTRKNESVVKFSLDPLVQHRGLAGTHDVTFLN---NVLNAFVKGSDEEV--SIPFYDKSKFGGYGDRGDESQWKKANPKTTTYVIF.............................................................................................................................................................. 148
36 -11.300[P] COG2895 GTPases - Sulfate adenylate transferase subunit 1  ali follow..  14  2.......NTALAQQIANEGGVEAWMIAQQHKSLLRFLTCGSVDDGKSTLIGRLLHDTRQIYEDQLSSLHNDSKRHGTQGEKLDLALLVDGLQAEREQGI---------------TIDVAYRYFSTEKRKFIIADTPGHEQY---------TRNMATGASTCELAILLIDARKGVLDQTRRHSFISTLLGIKHL----VVAINKMDLVDYSE--------------------------ETFTRIREDYLTFAGQLPGIRFVPLSALEGDNVASLLEVLETV.................... 235
37 -11.200[J] KOG0466 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  12  7.GVTLGQPHLSRQDLTTLDVTKLTPLSHEVISRQATINIGTIGHGKSTVVKAISG-----------VHTVRFKNELERNITIKLGYANAKIYQLDDPSCPRPECYRSCGSSMPDEFP---KGNFRLVRHVSFVDCPG------HDILMATMLNGAAVMDAALLLIAGNESCPQPQTSEHLA-------AIEIMKLKHLILQNKIDLVKER----------------------------QAKEQYEQILAFVQGAEGAPIIPISAQLKYNIEVVCEYIVKKI................... 243
38 -11.100[R] COG1163 Predicted GTPase  ali follow..  19  68...................................VGFVGFPSVGKSTLLSKLT-------------GTESEAAEYEFTTLVTVPGVIRYKGA-----------------------------------KIQMLDLPGIIDAKDGRGRGKQVIAVARTCN---LLFIILDVNKPLHHKQIIEKELEGVGIRLNKTPPDI-LIKKKEK.............................................................................................. 187
39 -11.000[J] KOG0458 Elongation factor 1 alpha  ali follow..  12  136.EKTVQRYYKTTVPTKPKKPHDISAFVKSALPHLSFVVLGHVDAGKSTLMGRLLYDLNIVNQS----QLRKLQRESETMGKSSFKFAWIMDQTNEERERG--------------TVSICTSHFSTHRANFTIVDAPGHRDF---------VPNAIMGISQADMAILCVDCSTNAFESGFDLDGQTKEHMLLSLGIHNLIIMNKMDNVD-----------------------SQQRFEEIKSKLLPYLVDIGFFEDNINWVPISGFSGEGVYKLMSTLENA.................... 384
40 -10.900[T] KOG1487 GTP-binding protein DRG1 (ODN superfamily)  ali follow..  20  67...................................IGFVGFPSVGKSTLLSNLA-------------GVYSEVAAYEFTT------------------LTTVPGVI-----------------RYKGAKIQLLDLPGIIEAKDGKGRGRQVIAVARTCN---LILIVLDVLKPLGHKKIIENELEGFGIRLNSKPPNI-GFKKKDK.............................................................................................. 186
41 -10.900[F] COG1618 Predicted nucleotide kinase  ali follow..  17  2........................RIEGKEKTMLRIAVTGSPGVGKSTVVAKTAEKLAEKPGFKIGGIRTAEIRKEGHREGFSIRDLATGKTGILSHVK-GSGPRLGKYHVNLDDLERIGANANALACDLVVIDEIGPMELIS-QSFVSAVEEVLESDKPVLAVL....................................................................................................................................... 142
42 -10.900[R] COG5258 GTPase  ali follow..  12  97......................RAVSREEPPPTVTVVALGNVDAGKSTLVGVLTTGRLDDGKGLARSYASRYKHEVLTGRTSAVSLRLLGFSGDKVVNHGLIDPL--------------AEVYKRSDKLVLLVDVGG------HERYLRTALRGLFSSQPDYVMLVV------AANSGVQKMTKEHLGIAVAIGIPVFVVVTRIDITPSEVFQKTVEEVVRI---LKMPGVSKIPYIIKDTNDVVLAAKAMPAGRVAPVFYVSSVTGHGLDLLLRFLSLL.................... 327
43 -10.900[P] COG0370 Fe2+ transport system protein B  ali follow..  19  1..............................MSQNTYCILGNPNTGKTSLFNALT------GSYEYVGN--SG---------------VTVEKKVGTLR----------------------------SKTGKLIDLPGIYDLNPISRDETVVTRFLLEEKFDC-MLNIVDSSQ-------IERNLNLTVQLLEYGAPVVMGLNMIDVAAGRGIH-------------------------NIQNLAKKL---------IPILPVVARSGKGTEDILSTLSEKHV.................. 162
44 -10.900[G] KOG3354 Gluconate kinase  ali follow..  11  1...................MTVTPINPTNQPYKYVFVVIGPAGSGKTTMAKAVSEKLGFEYIE----DLHPKANIEKMSQGHPLNDLHNCGGACAMELDKESIVVLTCSALKRSYRDILRSSLEHRPAILRFIYLAASRET---------LIKRTTSRKNHYMKADMVESQLAI.............................................................................................................................. 152
45 -10.900[T] KOG1486 GTP-binding protein DRG2 (ODN superfamily)  ali follow..  21  30LKAKIAKLRTQLLEPPKGASGGGEGFEVTKYGHGRVALIGFPSVGKSTLLTMLT-------------GTHSEAASYEFTTLTCIPGVIHYNDT-----------------------------------KIQLLDLPGIIEASEGKGRGRQVIAVAKSSD---LVLMVLDASKSEGHRQILTKELEAVGLRLNKTPPQI-YFKKKKT.............................................................................................. 184
46 -10.800[R] KOG0394 Ras-related GTPase  ali follow..  12  1.........................MPSRRRTLLKVIILGDSGVGKTSLMNQYVN--KFSNQYKATIGADFLTKEV---------------------------------------------QFEDRLFTLQIWDTAGQ-ERF------QSLGVAFYRGADCCVLVYVNSMKSFENLNNWREEFLIQASPSDPENFPFVLIGNKVDVDDGN----------------------------SRVVSEKKAKAWCASKGNIPYFETSAKVGTNVEEAFQCIAKDA................... 176
47 -10.800[R] KOG0083 GTPase Rab26/Rab37, small G protein superfamily  ali follow..  18  454..................SSSKAPEEEDEFDIMGKVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDFRNKVV----VVD-GTRVKLQ----------------------------------------IWDTAGQ-ERF------RSVTHAYYRDAHALLLLY--D---VTNKTTYIRAWLGEIREYAQEDVVIVLIGNKADCSGSERQVK-----------------------------REDGERLGREHN-VPFMETSAKTGLNVELSFTAVARQLKSRGYEHGDDGK....... 643
48 -10.700[J] COG5256 Translation elongation factor EF-1alpha (GTPase)  ali follow..  14  2........................KIMASQKPHLNLITIGHVDHGKSTLVGRLLYEHGEIPAH----IIEEYRKEAEQKGKATFEFAWVMDRFKEERERG--------------TIDLAHRKFETDKYYFTLIDAPG------HRDFVKNMITGTSQADAAILVISAREGEGVMEQTREHAFLARTLGVP-----QMVVAINKMDATSPPYSEK------------------------RYNEVKADAEKLLRSFKDISFVPISGYKGDNVTKLLQALDAF.................... 219
49 -10.700[M] COG0481 Membrane GTPase LepA  ali follow..  22  9.....................................IIAHIDHGKSTLSDRLIQTCGG------------------------LSDREMEAQVLDSMDLERERGITIKAQSVTLNYK------AKDGETYQFIDTPGHVDF------SYEVSRSLAACE----ALLVVDAGQGVEAQT-----LANCYTAIEMNLEVVPILNKIDL.............................................................................................. 135
50 -10.600[J] KOG0469 Elongation factor 2  ali follow..  16  2...............VNFTVDEIRALMDRKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAG-----SKAGETRFTDTRKD-EQERCITIKSTAISLFFELEKKDLEFVKGENQFETVEVDGKKEKYNGFLLIDSPGHVDFSSEVTAALRVTD----------ALVVVDC---------VSGVCVQTETVLR-RIKPVLFMNKMD............................................................................................... 173
51 -10.500[J] KOG0468 U5 snRNP-specific protein  ali follow..  14  99VKKLKFQIKEQDMQETTYDMEFMADLMDTPPLIRNVALVGHLHHGKTTFVDCLIRQTHPQFET-----------------EERQLRYTDTLFTEQERGCSIKATPVTLVLQDVKQKSYLLN----------IFDTPGHVNFSDEATAAMRMSD----------VVLFIDAA-----EGVMLNTERLLKHAVQERQAITVCINKIDRL............................................................................................. 265
52 -10.500[O] KOG0448 Mitofusin 1 GTPase, involved in mitochondrila biogenesis  ali follow..  10  45LDRIATEDDLVEMQGYKDKLSIIGEVLSRRH--MKVAFFGRTSSGKSSVINAM------LWDKVLPSGIGHITNCF-TEGSDEKKSVKTVNQLAHALHMDKDLKAGCLVRVFWPKAK-----CALLRDDLVLVDSPGTDVTTELDSWIDKFCLDAD------VFVLVANSTLMNTEKHFFHKVNEWLSK-------IFILNNRWDASASE.......................................................................................... 245
53 -10.400[P] COG0529 Adenylylsulfate kinase and related kinases  ali follow..  15  1..............................QKPAVLWFTGLSASGKSTIANRLEQRLHALGKHTYLLDGDNVRHGLNSDLGFNIRRVGEVARLMADAGL----TPVSFISPFREERDQVRARLPEGEFIEIFIDTPGEIKAFT............................................................................................................................................................. 135
54 -10.400[J] KOG0459 Polypeptide release factor 3  ali follow..  12  70.VHNPAKAKEKAAQEKAAKEEAEDVAEANKKRHLNVVFIGHVDAGKSTIGGQILFLSGQVDDR----QIQKYEKEAKDKSRESWYMAYIMDTNEEERLKG-------------KTVEVGRAHFETESTRFTILDAPG------HKSYVPNMISGASQADIGVLVI-EFETGYERGGQTREHVQLAKTLGVSKL----IVVVNKMDDPTVNWSKE------------------------RYDEIEQKMVPFLKASGYVVFLPISGLMGKNMDQFFEVLDSI.................... 320
55 -10.400[J] KOG0052 Translation elongation factor EF-1 alpha/Tu  ali follow..  14  2...........................GKEKVHINIVVIGHVDSGKSTTTGHLIYKCGGIDKR----TIEKFEKEAQEMGKGSFKYAWVLDKLKAERERG-------------ITIDIALWKFETAKYYITIIDAPGHRDF---------IKNMITGTSQADCAVLVVACGTGEFEAGISKNGQTREHALLAQTLQLIVACNKMDSTEPP---------------------SEARFTEITNEVSGFIKKIGYNPKAVPFVPISGFNGDNMLE............................ 203
56 -10.300[N] COG1419 Flagellar GTP-binding protein  ali follow..  14  175...................................VLFVGTTGVGKTTSLAKLARFKIDEKKRVAILTLDT----------------IAAAEQLKIY-----ADIMDIPMKIAYTPKEAEYEMMALKDDIVLVDTAGR------SHQNDLQMSELRA----SEAVKPNITFLVLSMNYKLDDMKRIVERFSAVKPTHI-ILTKMD............................................................................................... 317
57 -10.300[R] COG3911 Predicted ATPase  ali follow..  10  9...................................FVLTGGPGSGKTTLIAALRRTSVVAGRGIVRDQSSIGGTALPWSDRTLFAELMLSWEMRSYQNAVEQKGPVFFDRGVPETLDHVSTAAKRFRYNPRVFIAPPWPDIFAQDEE-HALAEIYTELGYELVPL----------PLAPVETRLRFVLADAGLN.......................................................................................................... 183
58 -10.200[U] COG0552 Signal recognition particle GTPase  ali follow..  18  108....................EQISELNIQDGRLNVILLVGVNGVGKTTTIGKLAHKMKQEGKSVVLAAGDGAIEQLEV------GERTGVPVIKQTAGSDPAAVIYDAVHAAKAR-----------NADVLICDTAGRLNLMKELEKVKRVIEREVPEAPH--VLLALDATTGQNAMAQAKEFSKATNVT---------ALTKLD............................................................................................... 276
59 -10.200[R] COG0645 Predicted kinase  ali follow..  11  4...................................AVTHGVSAVGKSQVAMRLVERLRSDIERKRLFGEQPEHDRGQYSSQASEATYAHLHQLAAKILQAGYPVVIDAAYLKQNQRQAACHIAEETGVPFLILDCQAPEAVIA-SDATLDVIRTQQATAAETVQSKRVDTHDAASLDGLVDGIRQRLPGL.............................................................................................................. 185
60 -10.100[U] KOG0781 Signal recognition particle receptor, alpha subunit  ali follow..  15  397.AAMEDALVRILTPRRSIDILRDVHAAKEQRKPYVVVFVGVNGVGKSTNLAKVAYWLQQHKVSVMMAACDTAVEQLRT-------RRLQIPIFEKGYEKDPAVVAKEAIQEATRN-----------GSDVVLVDTAGRMQ----NEPLMRALSKLINLNQPDLVLFVGEALVVDQLSKFNQKLSDLSTSGNPRLIDGI-LLTKFDTIDDK.......................................................................................... 593
61 -10.100[R] COG4240 Predicted kinase  ali follow..  14  56LKIPPEQMFPVLWDLWLPLGMKIAAQHQQLKRPFIQGILGSQGTGKTTMSLVIQLILQHLGYRTLSLSLDD------YKTYSDRLVLLQQDPRLIWRGP-PG----------THDIDLGLNVLEQIRQGKSPVIVP.................................................................................................................................................................... 175
62 -10.100[T] COG1217 Predicted membrane GTPase involved in stress response  ali follow..  18  10.....................................IIAHVDHGKTTLVDKLLKLSGTLD-----------------------RKEAESERVMDSNDQEKERGI--TILAKNTAIKWNGYNIN-------IVDTPGHAD-FGGE-----VERVMSMVD----VLLVVDAQDGPMPQT-----RFVTQKAFKAGLRPIVVVNKIDRPGAR.......................................................................................... 136
63 -10.100[D] COG0489 ATPases involved in chromosome partitioning  ali follow..  61..LAVDSPRSSFAETLRNVKLTADVVIQERQCRVIGVISCLPNEGKSVVALNLAGLIASTGKRTLVVDADPGLSRLTTRQSAGLVEVVPWTQAVKVDTRTAHSSELLSSSGMRKFIDSAREAC-----DYIIVDLA-----------VVPVIDAKAFAPQVDGFVFVTEWGKTPI-----QMVQNLMANEPQIANKTLGVLNKTDM.............................................................................................. 266
64 -10.100[R] KOG3062 RNA polymerase II elongator associated protein  ali follow..  19  4...................................VVITGLPASGKSTRARQLRDHFVERGRKVHLISENEAVPKAGFGKNSHTGDSQKEKVV--------RSDLKSEASRHLNQ------------EDLVILD-----AGNYIKGYRYELYCMSKVSRTTQCTVFT..................................................................................................................................... 110
65 -10.000[G] COG3265 Gluconate kinase  ali follow..  14  1..............................MSGKCIIVMGVSGTGKSCVGQALALAL-----GAKFIDGDPRANIQKMAAGQPLNDLERLSDVAYSLQQKNEVGFLVCSALKKQY----RDRLREGNEGIRFLWLTGDYDL---------VLHRMQQRAGHFMPESLLKSQFAT.............................................................................................................................. 135
66 -9.990[F] COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases)  ali follow..  13  3...................................IAITGTPGVGKTTVAKLLAKKL-----NYEYVSLKDFALEKGCGRRVNDEVEVEIDELAYFIERELKGKNAVLVVVLRAHPKLIGERLRERGYDREKIGENVEAEL---------VDAVLIEAIEEHENVIEVDTT--KSPEDVVEEIVSLINSGIKKRVGIVDWSEVYD............................................................................................... 169
67 -9.910[C] COG3954 Phosphoribulokinase  ali follow..  15  2.............................SAKHPVIAVTGSSGAGTTTTSLAFRKIFAQLNLHAAEVEGDPEANDFSLLEH-TFIEYGQTGKGQWQPLPEPTDVLF--YEGLHGGVVTPQHDVARHVDLLVGVVPIVNLEWI------QKLIRDTSERGHSREAVMDSVVRSMDDYINYITPQFSRTHINFQ............................................................................................................ 206
68 -9.910[F] COG0572 Uridine kinase  ali follow..  12  2..........................TDKAHQCVIIGIAGASASGKSLIASTLYRELREQDQHIGVIPEDGYYKDQSHLSNYDHPSAMDHNLLLEHLQALKAGKPVELPLYSYTEHTRKKETVHLEPKKVIILE--GNFSIFVDTPLDICLMRRMKR............................................................................................................................................... 152
69 -9.860[U] KOG0096 GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily  ali follow..  12  1.....................MSAPAANGEVPTFKLVLVGDGGTGKTTFVKRHLT--EFEKKYIATIGVEVHPLSF---------------------------------------------YTNFGEIKFDVWDTAGQ-EKF------GGLRDGYYINAQCAIIMFVTSRITYKNVPNWHRDLVRVCE-----NIPIVLCGNKVDVKERKVKAKTITFHRKKN---------------------------------LQYYDISAKSNYNFEKPFLWLARKL................... 170
70 -9.780[R] COG4639 Predicted kinase  ali follow..  19  11...................................VVLIGASGAGKSTFARKHFQ-------PFEVISSD------------FCRGLVSNDENSQSAS-----------DAFDVLHYITTKRLAAGKL--TVIDATN-----VQPEDRKTLLQMAKQYHCFTVAIVF..................................................................................................................................... 106
71 -9.770[R] COG1160 Predicted GTPases  ali follow..  14  203....................ALDEELEEEQDKNIKIAIVGRPNVGKSTLTNRI------LGEDRVVVFDMPGTTR-----------------------------------------DSIYIPMERDGQQYTLIDTAGAVEKFSVIKTLQAIQDA--------VVLLTIDARENISDQD-----LSLLGFILNAGRSLVIVVNKWDGLDQD----------------------------VKDRVKSELDRRLDFIDFARVHFISALHGSGVGNLFDSIKEAYA.................. 386
72 -9.730[J] KOG0462 Elongation factor-type GTP-binding protein  ali follow..  17  47.....................................IVAHVDHGKSTLADRLLEMCGAVPPG---------------------------KQMLDKLQVERERGITVKAQTAALRHRGYL-----------LIDTPGHVDF------SAEVSRSLAVCD----ILLLVAANQGVQAQT-----IANFWLAFEKNIQIIPVINKIDL.............................................................................................. 166
73 -9.720[C] COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain  ali follow..  14  1...............................MKQVAVISGKGGTGKTTFSATIHALEGGV-----VADCDVDAPNLHILLKPQILKAEDFIASKKAEGCAPERAIEMTGRLVTEVKNRAKEIAEESNAEFLIVDSAPGVG---------PVMASLTGVDAAIIV---------TEPTVSLSDMLRILELCEHFRIRPFVVVNKFDL.............................................................................................. 224
74 -9.710[U] KOG0780 Signal recognition particle, subunit Srp54  ali follow..  13  89....................PGKPAFAPKKAKPSVVMFVGLQGAGKTTTCTKYAYYHQKKGYKAALVCADGAFDQLKQ-----NATKAKIPFYGSYTESDPVKIAVEGVDRFKKE-----------KCDLIIVDTSGRHKQ---AASLFEEMRQVAEATEPDLVIFVMDSSIGQAAFEQAEAFKETVSV----------IITKMD............................................................................................... 251
75 -9.680[R] KOG1673 Ras GTPases  ali follow..  12  72...DIFDGDDDTTTEPTVSGRRFGSSSDSDLVSLKISLLGDCQTGKTTFVVKYVG--DENQSFLEMTGLNLMDKTF---------------------------------------------YVQGVTISFSIWDVGGDEKRS------KDHIPIACKDAVAILFMFLTSRSTLNSVFGWYSQA------KWNKTAIPILIGTKFDDFVR------------------LPPNLQWTIVTQARAYAKVM---------ASLFFSSATHNINVNKIFKFILARL................... 266

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.