current user: public

If you have questions about the server, please let us know.

Query: [K] KOG1534 Putative transcription factor FET5, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .
# Score Template Links and tools%idFirst MVKVAAFVCGVASSGKSTFCGALMSYMKSVGRSCHLVNLDPAAENFEWEPTVDIRDLISIDDVMEELDYGPNGGLIYCFEFLMENLDWLNEEIGDYDEDYLIFDMPGQIELYTHVPILPALIRHLQVTLNFRPCAVYLLESQFLVDRTKFFAGVLSAMSAMVMMEVPHINLLSKMDLLKDNNNITKAELKRFLNTDPLLLTGEINETTNPKFHELNRCIVQLIDDFNMVNFLPLESGNEESVSRVLSYIDDATQWYEDQEPKDPDRFEADDLEDDELast
1 -99.100[K] KOG1534 Putative transcription factor FET5  ali  100  1MVKVAAFVCGVASSGKSTFCGALMSYMKSVGRSCHLVNLDPAAENFEWEPTVDIRDLISIDDVMEELDYGPNGGLIYCFEFLMENLDWLNEEIGDYDEDYLIFDMPGQIELYTHVPILPALIRHLQVTLNFRPCAVYLLESQFLVDRTKFFAGVLSAMSAMVMMEVPHINLLSKMDLLKDNNNITKAELKRFLNTDPLLLTGEINETTNPKFHELNRCIVQLIDDFNMVNFLPLESGNEESVSRVLSYIDDATQWYEDQEPKDPDRFEADDLEDDE 276
2 -88.800[R] KOG1533 Predicted GTPase  ali follow..  33  31WTMYGVLVIGAPGAGKSTFCAGLTDIFSQTKRPFLTINLDPANDTMAYAPDVNITEMITVNDVMDRLGLGPNGALKYCIETLGANCNWLLQKIEANHKKYLIIDCPGQLELYKSEGELWKVIRFLEKS-GVRLCALHLADSLYCSDPSKFISVALSTLATMVTMEMPQVNCLSKADLFSEDGTYDLEFFSHLPDVNR-LLDLLNEVPGLEKYRKLNEAICGVISDFDLVSFVPLAVENKESMMKVIQMVDAANGFSLTEQGDIRELILNSKA.... 300
3 -77.200[L] KOG1532 GTPase XAB1, interacts with DNA repair protein XPA  ali follow..  21  40.KPIIIIVVGMAGSGKTSFLHRLVCHTFDSKSHGYVVNLDPAVMSLPFGANIDIRDTVKYKEVMKQYNLGPNGGILTSLNLFATKFDEVVSVIEKRADQYVLVDTPGQIEIFTWSASGAIITEAFAST--FPTVVTYVVDTPRSSSPITFMSNMLYACSILYKTRLPLVLAFNKTDVADHKFALEWMEDFEVFQAAIATLANSLSLSLYEFYRNIRSVGVSAISGAGMDGFFAIEASAEEYMETYKADLDMRKADKERLEEERKKHEMEKLRKDME 322
4 -17.600[OK] COG0378 Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase  ali follow..  14  5...LIIGVGGPVGAGKTMLIERLTRYLSTKGYSMAAITNDIYT-------KEDARILLNTSVLPADRIAGVETGGCPHTSMNFAAIEEMC--DKHPDLQLLFLESGGDNLSATFSPDLVDF-------------SIYIIDVAQGEKIPRKGGQGM---------IKSDLFIINKVDLAPYVGA------------------------------NVEVMKADTLKSRGNKDFFVTNLKTDEGLKSVADWIEKRLQLALLEE................ 206
5 -16.700[R] KOG2486 Predicted GTPase  ali follow..  14  138.....FALVGRSNVGKSSLLNSLVR-----RKRLALTSKKPGK-----------TQCINHFRI---------------------------------NDKWYLVDLPG-----ELKQDWNKFTKDYFLNRSTLVSVFLLVDASIPVKPID-----LEYASWLGQNQVPMTLIFTKCDKRKK------------------------KKNGGKKPEANIKEFQDLIQGFTTPPWIMTSSVTNQGRDEILLHMAQLRNYWLKH................. 318
6 -16.600[D] COG2894 Septum formation inhibitor-activating ATPase  ali follow..  14  1MARIIVVTSGKGGVGKTTSSAAIATGLAQKGKKTVVIDFDIGLRNLDLIMGCERRVVYDFVNVIQNLYILPASQTRDKDALTREGVAKVLDDLKAMDFEFIVCDSPAGIETGALMALYFA-----------EAIITTNPEVSSVRDSDRILGIL.......................................................................................................................... 160
7 -15.300[U] KOG0090 Signal recognition particle receptor, beta subunit (small G protein superfamily)  ali follow..  14  58.....VLLSGLSGSGKTVLFYQLRDGSSHQGAVT---------------------------------SMEPNEGTF--------VLHNENNTKKGKVKPVHLIDVPGH----------SRLISKLEEYLPRAAAVVFVVDALEFLPNIRAASEYLYDIASVIKNKTPVLLCCNKTDKVTAHTKEFIRKQMEKEIDKLRVSAISTADIANDFTLGIEGEVFSFSHCHNKVTVAEASGLTGE-TDQVQEFIREHVK...................... 259
8 -14.900[R] COG1084 Predicted GTPase  ali follow..  11  165.....VVIAGFPNVGKSTLLRTLT------------------------------------------------GAEPEVADYPFTTKGIQIGHLERKWKRIQVIDTPGLLD--PVEDMNNIELQAMVALENIADVIMFIFDAS--TCGYTLESQYSLYLGIRSVFDIPVVTVFNKMDLAENVKYLEEYINMVE-------------------------------------DPLKVSAFEGRGVSKIIKKLEGLYEKETREAHDN............. 335
9 -14.700[E] COG4917 Ethanolamine utilization protein  ali follow..  19  4.....IAFVGSVGAGKTTLFNALQGNYTLARKTQAVEFNDKG-----------------------------------------------------------DIDTPGEY-------NHPRWYHALITTLQDVDMLIYVHGAN---------ESRLPAGLLDIGVSKRQIAVISKTDMPDA---------------------------------DVAATRKLLLETGFEEPMFELNSHDPQSVQQLVDYLASLTKQEEAGEKTHHSE.......... 159
10 -14.700[D] COG3640 CO dehydrogenase maturation factor  ali follow..  10  9.....LIISGRGGSGKSTLVTLIAHTLKEQKKRVLVVDSDESNIGLSGILGIEFREKFDLESLSQEFVCWVGSLGLMQIGKIDHATRDFLNHVRLEEDQWVLVDTEAGVE-----HFGRGIVEGADA-------VVMVVDPSSDA-----VLLAEKAAKLTHEADKRFGVILNKIDEETEPILTE........................................................................................... 215
11 -14.000[R] KOG1490 GTP-binding protein CRFG/NOG1 (ODN superfamily)  ali follow..  13  171.....VLICGYPNVGKSSFMNKVT-------------RADVDVQPYAFTT--------------KSLFVG---------------------HTDYKYLRYQVIDTPGILD--PFEDRNIIEMCSITALAHLRAAVLFFLDISGSCGYTIAQQAALFHSIKSLFMNKPLVIVCNKTDLMPME--------------------NISEEDRKLIEEMKSEAMKTAMGASEEQVLLKMSTLTDEGVMSVKNAACERLLDQRVEAKMKSKKINDHLNR... 369
12 -14.000[P] COG1348 Nitrogenase subunit NifH (ATPase)  ali follow..  13  4.....VAIYGKGGIGKSTTTQNLTSGLAELGKKIMVVGCDPKADSTRLDTLREEGEDVDLDTIMKTIKCVESGGPEPGVGCAGRGIITSINMLEQLGADYVFYDVLGDVEMMAMYAANNISISKFANTGGVRLGGI-ICNSRKVKNEKELLEAFAKELGTQLIYFVPRSHEVQKAEINKQTVIQ--------------------FNPKDEQADEYRALAKAIDGNDMYVVPKPMAQDKLEAILMEYGLLE.......................... 272
13 -14.000[R] COG1341 Predicted GTPase or GTP-binding protein  ali follow..  14  35.....VMIIGDVDTGKTTLTIYLANELLSRGFRVAIIDSDIGQKGILPPATISLAFVLDDLKAFSHYFIGPNQYFGEMVVGVMKLSELAMK-----FSDVVLIDTTGMIY-----GSGVELKRMKIEAVKPNLILAL........................................................................................................................................... 165
14 -14.000[A] KOG2749 mRNA cleavage and polyadenylation factor IA/II complex, subunit CLP1  ali follow..  19  116.....VIIVGDIDSGKSTLAKMLLNWAVKDGWKPTFVDLNVGQSSITIPGTIAAAPIKM-LDKALIHYFGPSVNYRTLVEELARELKEEFSANAESRASGMVIDTMGFIV-----REGYALLLHAIRTFNASLVIVV........................................................................................................................................... 256
15 -13.900[E] COG1703 Putative periplasmic protein kinase ArgK and related GTPases of G3E family  ali follow..  15  59.......VTGTPGAGKSTFLEAFGMLLIREGLKVAVIAVDPSS---PVTGGSILGDKTRMNDLARAEAAGHLGGA-------SQRARELMLLCEAAGYDVVIVET-GQSET-----------------------VARMVDCFISLQIAGGGDDLQGIKKGL--MEVADLIVINKDDGDNHTNVAIARHMYESALHILRRKYDE------------------------QPRVLTCSALEKRGIDEIWHAIIDFKTALTASGRLQQVRQQQSVE.... 276
16 -13.500[A] COG5623 Pre-mRNA cleavage and polyadenylation factor IA/II complex, subunit CLP1  ali follow..  16  126.....VVIVGGSQTGKTSLSRTLCSYLKFNAYQPLYINLDPQQPIFTVPGCISATPILLHNKQPMVKNFGLERIYLECISQLGQVVGQRLHLDPQVRRSGCIVDTPSISQLDENLAELHHIIEKLNVN------IMLVLCSETDPLWEKVKKTFGPELGNNNIFFIPKLDGVSAVD.................................................................................................... 317
17 -13.500[R] COG2229 Predicted GTPase  ali follow..  16  1MRENKIIFTGPVGVGKTTAIAAISD-----------------------------EALVQTDASASDMTLDRKRNTTVAMDYGAISLDE--------DTKVHLYGTPGQ-ERF------NFMWEILSQGSMGLVLLLDNARTNPLKDLEFFLHSFRGLLE-----KAPVVVGITKMDIRSQ--------------------------------PGIDVYHKYLAKHNLNVPVFEIDARKEDDVKQLVSAM........................... 168
18 -13.400[R] COG1159 GTPase  ali follow..  12  11.....IAIVGRPNVGKSTLLNKL------LGQKISITSRKAQTTR-----------------------------------------HRIVGIHTEGPYQAIYVDTPG-LHMEEKRAINRLMNKAASSSIGDVELVIFVVEGTRWTPDDEMV------LNKLRDGKAPVILAVNKVDNVQEK-------------------------------VDLLPHLQFLASQMNFLDIVPISAETGMNVDTIAGIVRKHLPEAIHHFPEDYITDRSQRFMASE 196
19 -13.200[NU] COG2874 Predicted ATPases involved in biogenesis of archaeal flagella  ali follow..  13  38.....TLIEGENDTGKSVLCQQFVYGGLMSGHNIAYYTTENTIKSF--SLSLDVSDFYA-WGYLRVFPVHLE-GIDWSTEQMRSILNLVANHIKTIRENIAIIDSLTMFTTYSTEDDVLEFLTRLKNLCDNGKTILITLHQHAFKEDTLVRIRSACDCHLFLRKEQVGDRYVSVLEVSK................................................................................................. 212
20 -13.100[R] COG3596 Predicted GTPase  ali follow..  15  41.....IGIMGKTGAGKSSLCNAL------FAGEVSPVSDVAACTR-----------------------------------------DPLRFRLQIGEHFMTIVDLPG---VGESGVRDTEYAALYREQLPRLDLILWLIKA---DDRALATDEHFYRQVIGEAYRHKMLFVISQSDKAEP--------------------TSGGNILSTEQKQNISRKICLLHELFPVHPVCAVSVRLQWGLRVMAERMIKCL....................... 216
21 -12.400[R] COG0536 Predicted GTPase  ali follow..  13  164.......LVGFPSAGKSSLISVMS-------------AAKPKIGDYPFTT------------------LQPNLGVV-----------------NVGHETFTMADVPGLIP----ASEGKGLGLDFLRHIERTSVLVHVVDTALEAELAAYQSALDEDTGLGDLSQRPRLVVLNKADVPEA--------------------------------EELAEFLKEDIEKQFGWPVFIISAVARKGLDPLKYKLLEIVQDARKKRPKEKAESVIIKPKAVD 363
22 -12.300[R] COG0218 Predicted GTPase  ali follow..  14  28.....IALAGRSNVGKSSFINTMLN-----RKNLARTSGKPGKTQL--------------------------------LNFFNID------------DKMRFVDVPGRVSKKEREKWGCMIEEYLTTRENLRAVVS-LVDLRHDPSADD-----VQMYEFLKYYEIPVIIVATKADKIPR-----------------------------GKWNKHESAIKKKLNFDPSDDFILFSSVSKAGMDEAWDAILEKL....................... 195
23 -12.200[P] KOG2825 Putative arsenite-translocating ATPase  ali follow..  13  22.....IFVGGKGGVGKTTTSCSLAIQMSKVRSSVLLISTDPA-HNLSDAFGTKFGK-VPGFDNLSAMEIDPNLSI----EMTEQADQQNPNNPLSGMMQDLAFTIPGIDEALA--------FAEILKQIKSMEFDCVIFDTAPTGHTLRFLNVLEKALGKLGGLSSRFGPMINQMGSIMGVNAN-----------------EQDLFGKMESMRANISEVNKQFKNPDLTTFVCVCISEFLSLYETERMIQELTSYEIDTHNIVVNQLLLDPNTTCP 269
24 -12.100[TU] KOG1954 Endocytosis/signaling protein EHD1  ali follow..  14  95.....ILLVGQYSTGKTTFI----RYLLESDFPGIRIGPEPTTDRFIAVMHGDEEGSIPGNALVVDAKK-QFRALSGFGNAFLNRFQ-CSTLPNQVLESVTIVDTPGILS-YDFTGVLEWFAERVD-------RIILLFDAHKLDISDEFKRCIEALAGNEDKIRI----VLNKSDMVDHQQLMR........................................................................................... 265
25 -12.100[R] KOG1489 Predicted GTP-binding protein (ODN superfamily)  ali follow..  14  344.......LIGLPNAGKSTILNKIS-------------NAKPKIGHWQFTT------------------LSPTIGTV---------------SLGFGQDVFTVADIPGIIQASLDKGMGLEFLRHIERS-----GWVFVLDLS-NKNPLNDLQLLIEEVGTLEKVTKNILIVCNKVDIDAEK----------------------------SESFAKYLQVEKFSKSQE-WDCVPISALREKT................................... 499
26 -12.100[D] KOG3022 Predicted ATPase, nucleotide-binding  ali follow..  14  58VKHKILVLSGKGGVGKSTFSAQLSFALAGMDHQVGLMDIDICGPSIPKMLGLEGQEIHQSNL-LGVMSIGSDEAVIWRGPRKNGLIKQFLKDVYWGEIDYLVVDAPSDEHI--------SIVQYLLPTGIDGAIIVTTPQEVSLIDVRK-------EVSFCKKVGVPVLGVVENMS.................................................................................................... 235
27 -11.900[R] KOG2750 Uncharacterized conserved protein similar to ATP/GTP-binding protein  ali follow..  17  334.....LMVCGPKGSGKSSFSRYITNRLLQQYRHIAYLDLDPGQPEVVPSGHISLYYIMLFPTYMLRLHLGPQKDPDHYIACVTRLFAEYKDYIFNQEIS-LIINCPGWIR-----GGGAELLSSIVDICQ-PTEVVYMSREDMKSS.................................................................................................................................. 487
28 -11.800[P] COG0003 Oxyanion-translocating ATPase  ali follow..  4.....ILMTGKGGVGKTSVAAATGLRCAELGHKTLVLSTDPA-HSLADSFDLELHEPRLVKENLWGAELDALMELEGNWGAVKRYITQVLQARGLDGQAEELAILPGMDEIFG--------LVRMKRHYDEADYDVLIIDSAPTGTALRLLSLPEVGGWYMRRFYKPLQGMSVALRPLVEPLFRPIAGFSLPDKEVMDAPYEFYEQ----------EALEKVLTDNTQTSVRLVTNPEKMVLKESLRAHAYLSLYNVSTDLVIANRILPETIDDP. 257
29 -11.600[H] KOG2743 Cobalamin synthesis protein  ali follow..  11  45.....TIITGYLGAGKTTLLNYILT--EQHSKRVAVILNESGEGSALEKSLAVSQGGELYEEWLE-----RNGCLCCSVK-GLRAIENLMQKKGKF--DDILLETTGLAD------ASMFWVDAELGSDIYLDGIITIVDSKYGLKHLTEEKPDGLINEATRQVALADIILINKTDLVPEEDVKKLRTTIRSINGLGQILETQRSR...................................................................... 236
30 -11.600[U] KOG3887 Predicted small GTPase involved in nuclear protein import  ali follow..  15  65.....ILLMGLRRSGKSSIQKVVFHKMSPNE----TLFLESTNK-------------ICREDVSNSSFV-----------------------------NFQIWDFPGQIDFFDPTFDYEMIFRGTG-------ALIFVIDSQDDYMEALARLHLTVTRAYKVNTDINFEVFIHKVDGLSDDHKIETQRDIH---------------------QRANDDLADAGLEKIHLSFYLTSIYDHSIFEAFSKVVQKLI....................... 238
31 -11.500[D] COG0455 ATPases involved in chromosome partitioning  ali follow..  16  39VTKVISVTGGKGGVGKSNVTLGMAICMAKQGKKVMVLDADLGLANVDIRPKRNLGHVLELKDAIVEGPHG-TSGTQSMTELSHAQHVGLIRAFGTLEDDILLIDTAAGIS--TSITDAYALIKLLSKEHQVQRFKIVANMVRSYREGRELFAKLTLVTERFLNVSLELVACIPLDDNVRQAVKRQ........................................................................................... 257
32 -11.400[P] COG2895 GTPases - Sulfate adenylate transferase subunit 1  ali follow..  16  30.....FLTCGSVDDGKSTLIGRLLHDTRQIYEDQL--RHGTQGEKLDLALLVD--------GLQAEREQG--------------TIDVAYRYFSTEKRKFIIADTPGHEQ----------YTRNMATGASTCELAILLIDARKGVLDQTRRHSFISTLLGIKHL----VVAINKMDLVD----------------------------SEETFTRIREDYLTFAGQLPGIRFVPLSALEGDNVASLLEVLETV........................ 235
33 -11.300[R] COG0645 Predicted kinase  ali follow..  1..RFLAVTHGVSAVGKSQVAMRLVERLRSDIERKRLFGEQPEHDRGQYSSQASEATYAHLHQLAAKILQAGYPVVIDAAYLKQNQRQAACHIAEETGVPFLILDCQAPEAVIAGWDVIRTQQATREPLTAAETVQSKRVDTHDAASLDGLVDGIRQRLPGL................................................................................................................... 185
34 -11.200[T] KOG3886 GTP-binding protein  ali follow..  11  43.....VLLMGKSGSGKTSMRSIIFA--NYIARDTRRLGATILDRIHSLQINSSLSTYSLVDSVGNTKTFDVEHSHVRFLGNLVLN----------------LWDCGGQDTFME-----NYFTSQRDNIFRNVEVLIYVFDVE-LEKDMHYYQSCLEAIL-QNSPDAKIFCLVHKMDLVQEDQRDLIFKEREEDLRRLSRPLECSCFRTSIWDETLYKAWSSIVY-----QLIPNVQQLEMNLRNFAEIIE.......................... 260
35 -11.200[P] COG0370 Fe2+ transport system protein B  ali follow..  16  1MSQNTYCILGNPNTGKTSLFNALT------GSYEYVGN--SG---------------VTVEKKVGTLR----------------------------SKTGKLIDLPGIYDLNPISRDETVVTRFLLEEKF---CMLNIVDSSQ-------IERNLNLTVQLLEYGAPVVMGLNMIDVAAGRGIH--------------------------NIQNLAKKL---------IPILPVVARSGKGTEDILSTLSEKHV...................... 162
36 -11.200[R] KOG0395 Ras-related GTPase  ali follow..  15  20...YRMVVLGASRVGKSSIVSRFLN-------GRFEDQYTPTIEDF--------RKVYNIRGDMYQLD---------------------------------ILDTSGNHPF-------PAMRRLSILTGDVFILVFSLDNRESFDEVKRLQKQILEVKSCLKN-ELPMVICGNKNDHGELCRQVP------------------------------TTEAELLVSGDENCAYFEVSAKKNTNVDEMFYVLFSMAKLPHEMSPALHRKISVQYGDAFH 213
37 -11.000[R] COG0523 Putative GTPases (G3E family)  ali follow..  17  1MTPIAVTLLGFLGAGKTTLLRHILN--QHGFKIAVIEN----------EVSVDDQLIGDRATQIKTLT---NGCICCTRS-LEDALLDLLDSRDRGDIDRLVIECTGMAD----GPIIQTFFSHDVLCERYLLGVIALVDA------VHANEQMNQFTIAQSQIGYADRILLTKTDVAGDSEKLR........................................................................................... 170
38 -10.800[R] COG1163 Predicted GTPase  ali follow..  18  68.....VGFVGFPSVGKSTLLSKLT-------------GTESEAAEYEFTTLVTVPGVIRYKGA-----------------------------------KIQMLDLPGIIDAKDGRGRGKQVIAVARTC-----LLFIILDVNKPLHHKQIIEKELEGVGIRLNKTPPDI-LIKKKEK................................................................................................... 187
39 -10.700[R] KOG0394 Ras-related GTPase  ali follow..  10  9...LKVIILGDSGVGKTSLMNQYVN--KFSNQYKATIGADFLTKEV---------------------------------------------QFEDRLFTLQIWDTAGQ-ERF------QSLGVAFYRGADCCVLVYDVNSMKSFENLNNWREEFLIQASPSDPENFPFVLIGNKVDVDDGNSRV-------------------------------EKKAKAWCASKGNIPYFETSAKVGTNVEEAFQCIAKDALKSGEEEELYLPDTIDVGTSNQQ 199
40 -10.700[R] KOG2878 Predicted kinase  ali follow..  18  25..PFILGISGPQGSGKSTLASALDTELTRKNESVVKFSLDPLVQHRGLAGTHDVTFLN---NVLNAFVKGSDEEV--SIPFYDKSKFGGYGDRGDESQWKKANPKTTTYVIF.................................................................................................................................................................... 148
41 -10.600[M] COG0481 Membrane GTPase LepA  ali follow..  16  9.......IIAHIDHGKSTLSDRLIQTCGG------------------------LSDREMEAQVLDSMDLERERGITIKAQSVTLNYK------AKDGETYQFIDTPGHVD----------FSYEVSRSLAACEGALLVVDAGQGVEAQT-----LANCYTAIEMNLEVVPILNKIDLPAADPERVAEEIEDIVGIDAMEAVRCSAKTGVGIEDVLEEIVHKI...................................................... 180
42 -10.600[T] KOG1487 GTP-binding protein DRG1 (ODN superfamily)  ali follow..  18  67.....IGFVGFPSVGKSTLLSNLA-------------GVYSEVAAYEFTTLTTVPGVIRYKGA-----------------------------------KIQLLDLPGIIEAKDGKGRGRQVIAVARTC-----LILIVLDVLKPLGHKKIIENELEGFGIRLNSKPPNI-GFKKKDK................................................................................................... 186
43 -10.600[G] COG3265 Gluconate kinase  ali follow..  14  1MSGKCIIVMGVSGTGKSCVGQALALAL-----GAKFIDGDPRANIQKMAAGQPLNDLERLSDVAYSLQQKNEVGFLVCSALKKQY----RDRLREGNEGIRFLWLTGDYDL---------VLHRMQQRAGHFMPESLLKSQFATLEAPGSDEPDVIPIDISSSIADVVEHCIAALS.................................................................................................... 167
44 -10.600[R] KOG3062 RNA polymerase II elongator associated protein  ali follow..  19  4.....VVITGLPASGKSTRARQLRDHFVERGRKVHLISENEAVPKAGFGKNSHTGDSQKEKVV--------RSDLKSEASRHLNQ------------EDLVILDA-------NYIKGYRYELYCMSKVSRTTQCTVFT.......................................................................................................................................... 110
45 -10.500[T] KOG1486 GTP-binding protein DRG2 (ODN superfamily)  ali follow..  20  65.....VALIGFPSVGKSTLLTMLT-------------GTHSEAASYEFTTLTCIPGVIHYNDT-----------------------------------KIQLLDLPGIIEASEGKGRGRQVIAVAKSS-----LVLMVLDASKSEGHRQILTKELEAVGLRLNKTPPQI-YFKKKKT................................................................................................... 184
46 -10.500[R] COG5258 GTPase  ali follow..  13  105PPTVTVVALGNVDAGKSTLVGVLTTGRLDDGKGLARSYASRYKHEVLTGRTSAVSLRLLGFSGDKVVNHGLIDPL--------------AEVYKRSDKLVLLVDVGG------HERYLRTALRGLFSSQPDYVMLVVAANSGVQKMTKEHLG-------IAVAIGIPVFVVVTRIDITPSEVFQKTVEEVVRILKMPGVSKIPYIIKDTNDVVLAAKAMPA-----RVAPVFYVSSVTGHGLDLLLRFLSLL........................ 327
47 -10.500[F] COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases)  ali follow..  12  3.....IAITGTPGVGKTTVAKLLAKKL-----NYEYVSLKDFALEKGCGRRVNDEVEVEIDELAYFIERELKGKNAVLVVVLRAHPKLIGERLRERGYDREKIGENVEAE----------LVDAVLIEAIEEHENVIEVDTT--KSPEDVVEEIVSLINSGIKKRVGIVDWSEVYD.................................................................................................... 169
48 -10.400[F] COG1618 Predicted nucleotide kinase  ali follow..  14  13.....IAVTGSPGVGKSTVVAKTAEKLAEKPGFKIGGIRTAEIRKEGHREGFSIRDLATGKTGILSHVK-GSGPRLGKYHVNLDDLERIGANANALACDLVVIDEIGPMEL-----ISQSFVSAVEEVLESDKPVLAVLHHSSRHP---------LAQRFRKGFEVLTVDKGNRDELPEK................................................................................................ 174
49 -10.400[J] KOG0469 Elongation factor 2  ali follow..  12  24.......VIAHVDHGKSTLTDSLVSKAGIIAG-----SKAGETRFTDTRKD-EQERCITIKSTAISLFFELEKKDLEFVKGENQFETVEVDGKKEKYNGFLLIDSPGHVDFSSEVTAALRVTD-----------ALVVVDCV-----SGVCVQTETVLRQAIAERIKPVLFMNKMD.................................................................................................... 173
50 -10.400[P] COG0529 Adenylylsulfate kinase and related kinases  ali follow..  18  4...AVLWFTGLSASGKSTIANRLEQRLHALGKHTYLLDGDNVRHGLNSDLGFNIRRVGEVARLMADAGL----TPVSFISPFREERDQVRARLPEGEFIEIFIDTPGEIKAFT................................................................................................................................................................... 135
51 -10.300[R] KOG0083 GTPase Rab26/Rab37, small G protein superfamily  ali follow..  13  469...GKVIMLGDSGVGKTSLLIRFRDGRYVPSYFLSTVGIDFRNKVV----VVD-GTRVKLQ----------------------------------------IWDTAGQ-ERF------RSVTHAYYRDAH---ALLLLYD---VTNKTTYIRAWLGEIREYAQEDVVIVLIGNKADCSGSERQVK------------------------------REDGERLGREHN-VPFMETSAKTGLNVELSFTAVARQLKSRGYEHGDDGKFNVHDFVRDNT 654
52 -10.300[R] COG4240 Predicted kinase  ali follow..  10  88..PFIQGILGSQGTGKTTMSLVIQLILQHLGYRTLSLSLDD------YKTYSDRLVLLQQDPRLIWRGP-PG----------THDIDLGLNVLEQIRQGKSPVIVP------RFDKSAHAGAGDRTKPDVITGVDILIFEG-----------FVGVRPIDPSLFNFPPSPILTDEDKAFARDMNLRLNHYLPLWEKLDSLILLYPTDYRCSLEWRKQAEQKMIAAGK-------TGMSNTQIEEFVNYFWRSLH...................... 300
53 -10.200[U] COG0552 Signal recognition particle GTPase  ali follow..  18  120..LNVILLVGVNGVGKTTTIGKLAHKMKQEGKSVVLAAGDGAIEQLEV------GERTGVPVIKQTAGSDPAAVIYDAVHAAKAR-----------NADVLICDTAGRLNLMKELEKVKRVIEREVPEAPHEVLLA--LDATTGQNAMAQAKEFSKATNVT---------ALTKLD.................................................................................................... 276
54 -10.200[O] KOG0448 Mitofusin 1 GTPase, involved in mitochondrila biogenesis  ali follow..  12  76...MKVAFFGRTSSGKSSVINAM------LWDKVLPSGIGHITNCF-TEGSDEKKSVKTVNQLAHALHMDKDLKAGCLVRVFWPKAK-----CALLRDDLVLVDSPGTDVTTELDSWIDKFCLDAD-------VFVLVANSTLMNTEKHFFHKVNEWLSK-------IFILNNRWDASASEPEY............................................................................................ 248
55 -10.100[R] COG3911 Predicted ATPase  ali follow..  14  9.....FVLTGGPGSGKTTLIAALRRTSVVAGRGIVRDQSSIGGTALPWSDRTLFAELMLSWEMRSYQNAVEQKGPVFFDRGVPETLDHVSTAAKRFRYNPRVFIAPPWPDIFAQDEEAKCTYHALAEIYTELGYELVPLPLAPVETRLRFVLADA......................................................................................................................... 180
56 -10.100[J] KOG0052 Translation elongation factor EF-1 alpha/Tu  ali follow..  16  8...INIVVIGHVDSGKSTTTGHLIYKCGGIDKR----TIEKFEKEAQEMGKGSFKYAWVLDKLKAERERG-------------ITIDIALWKFETAKYYITIIDAPGHRD----------FIKNMITGTSQADCAVLVVACGTGEFEAGISKNGQTREHALLAQTLQLIVACNKMDSTE----------------------PFSEARFTEITNEVSGFIKKIGYNPKAVPFVPISGFNGDNMLE................................ 203
57 -10.000[J] KOG0466 Translation initiation factor 2, gamma subunit (eIF-2gamma; GTPase)  ali follow..  12  42......INIGTIGHGKSTVVKAISG-----------VHTVRFKNELERNITIKLGYANAKIYQLDDPSCPRPECYRSCGSSMPDEFPTDIPGTKRLVRHVSFVDCPGHDIL---------MATMLNGAAVMDAALLLIAGNESCPQPQTSEHLAAIEIMKLKHI----LILQNKIDLVKER-----------------------------QAKEQYEQILAFVQGTVAAPIIPISAQLKYNIEVVCEYIVKKIP...................... 244
58 -9.950[D] COG1192 ATPases involved in chromosome partitioning  ali follow..  22  1MAKIISTVNMKGGVGKTTLTVNLATCLAKYQKRVLVLDLDSQISATNPYSKLDIFDIIPEICQIEGLELIPGDIELYDEYLVSEKLHQIKEMLAPVLEDFVILDCAPGYNLLTRSG................................................................................................................................................................ 170
59 -9.950[N] COG1419 Flagellar GTP-binding protein  ali follow..  14  175.....VLFVGTTGVGKTTSLAKLARFKIDEKKRVAILTLD------TYR--------IAAAEQLKIY-----ADIMDIPMKIAYTPKEAEYEMMALKDDIVLVDTAGRSH------------DLQMSELRALSEAVKPNITFLVLSMNYKLDDMKRIVERFSAVKPTHI-ILTKMD.................................................................................................... 317
60 -9.910[J] KOG0458 Elongation factor 1 alpha  ali follow..  15  168...LSFVVLGHVDAGKSTLMGRLLYDLNIVNQS----QLRKLQRESETMGKSSFKFAWIMDQTNEERERG-------------VTVSICTSHFSTHRANFTIVDAPGHRD----------FVPNAIMGISQADMAILCVDCSTNAFESGFDLDGQTKEHMLLSLGIHNLIIMNKMDNVD------------------------SQQRFEEIKSKLLPYLVDIGFFEDNINWVPISGFSGEGVYKLMSTLENA........................ 384
61 -9.900[J] KOG0468 U5 snRNP-specific protein  ali follow..  12  136.......LVGHLHHGKTTFVDCLIRQTHPQFET-----------------EERQLRYTDTLFTEQERGCSIKATPVTLVLQDVKQKSYLLN----------IFDTPGHVNFSDEATAAMRMSD-----------VVLFIDAA-----EGVMLNTERLLKHAVQERQAITVCINKIDRL----------------LELKLPPQDAYFKLKHIVEEVNGLLSTYGAPDDNLLVSPIL......................................... 307
62 -9.900[F] COG0572 Uridine kinase  ali follow..  14  8..CVIIGIAGASASGKSLIASTLYRELREQDQHIGVIPEDGYYKDQSHLSNYDHPSAMDHNLLLEHLQALKAGKPVELPLYSYTEHTRKKETVHLEPKKVIILE---NFSIFVDTPLDICLMRRMKRDVNER................................................................................................................................................ 157
63 -9.800[C] KOG3877 NADH:ubiquinone oxidoreductase, NDUFA10/42kDa subunit  ali follow..  85.....ICVEGPIAAGKSKFAKELAEELDMEYYPAVDLD-LIYINSY----GYDMRKLDPQSYDVRNFCLDPSHAAQFQIRMYMLRYSQYIDALQHSTGQGVVLE--------------SPYSDFVFMEAMFRQGYLSRGARSVYNELRQNTIGELLKPHLVIYLDLPVDAVKKQIKARNVDY------------------EVQSKVFSDAYLSDLEQLYKQQYLKDTHAELLIYDWTAGGETEVVVEDIERIDFNQFEADIHNKKMLDWRFPLEAE 331
64 -9.800[R] COG1855 ATPase (PilT family)  ali follow..  12  278....GILISGPPGAGKSTFAASVANFLLENGYIVKTME-SPRDLMVRDEITQYAPLEGDMSLTSDLLLVRPD----------------IYDELRRTSDFQVFADMAGVGMIGVHATRAVDAIQRMIGRVEL--MIPQVVDTVVFIDAGRIVKVYELSFTVKVPTGMTEADLARPVIEVRDFETKNLEYEIYTYGEQVVVMPIETDENLKAALEEKISKYVDDFEVEMVGRKAVIKVPEKHIPTLIIKNIEDEFKISIDVIPKEVEEEVEASVEESG 543
65 -9.790[DZ] COG5019 Septin family protein  ali follow..  14  96...FNVLVLGESGSGKSTLVNTLLN-------------YPPTQKSLTGDFGVNPEPTVMINSS--AVEIVENGISL----------------------QLNVIDTPGFGDFIDNTDCWQPVLTDIEGRYDQYLACIFFIQPT-----GHAISAMELRVMLALHEKVNIIPIIAKADTLTDDELNFTKE........................................................................................ 258
66 -9.770[F] KOG3347 Predicted nucleotide kinase/nuclear protein involved oxidative stress response  ali follow..  15  1MLLPNILLTGTPGVGKTTLGKELASKS-----GLKYINVGDLAREEQLYDGYDEEYDCPILDEMREGGVIVDYHGCDFFPVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQ--------VLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQWIK................................................................................................................. 168
67 -9.750[T] COG1217 Predicted membrane GTPase involved in stress response  ali follow..  15  10.......IIAHVDHGKTTLVDKLLKLSGTLD-----------------------RKEAESERVMDSNDQEKERGI--TILAKNTAIKWNGYNIN-------IVDTPGHAD----------FGGEVERVMSMVDSVLLVVDAQDGPMPQT-----RFVTQKAFKAGLRPIVVVNKID.................................................................................................... 131
68 -9.710[J] KOG0459 Polypeptide release factor 3  ali follow..  13  102...LNVVFIGHVDAGKSTIGGQILFLSGQVDDR----QIQKYEKEAKDKSRESWYMAYIMDTNEEERLKG-------------KTVEVGRAHFETESTRFTILDAPGHKS----------YVPNMISGASQADIGVLVISARKGEFETGYERGGQTREHVQLTLGVSKLIVVNKMDDPTVNWSKE-------------------------RYDEIEQKMVPFLKASGYVVFLPISGLMGKNMDQFFEVLDSI........................ 320
69 -9.630[R] COG4639 Predicted kinase  ali follow..  14  11.....VVLIGASGAGKSTFARKHFQ-------PFEVISSD------------FCRGLVSNDENSQSAS-----------DAFDVLHYITTKRLAAGKL--TVIDATN-------QPEDRKTLLQMAKQYHCFTVAIVF.......................................................................................................................................... 106
70 -9.600[U] KOG0781 Signal recognition particle receptor, alpha subunit  ali follow..  18  428..PYVVVFVGVNGVGKSTNLAKVAYWLQQHKVSVMMAACDTAVEQLRT-------RRLQIPIFEKGYEKDPAVVAKEAIQEATRN-----------GSDVVLVDTAGRMQ------DNEPLMRALSKNLNQPDLVLFVGEALVVDQLSKFNQKLSDLSTSGNPRLIDGI-LLTKFDTIDDK............................................................................................... 593
71 -9.580[S] COG4185 Uncharacterized protein conserved in bacteria  ali follow..  13  11.QPVFLIVAGPNGSGKSSVYANADL--ELEGRSVWIVNPDLLAGRIS-NKPLPEANLVAVQRIEAWIQSSISVHKTIGVETVLSTDKYRRLVEAAEAVGFAIW-IKLRVAKGGHDVPADKVRARYARSLDQLPWFLERADRAWIWDNSGATPKLIGEKQ..................................................................................................................... 182
72 -9.580[J] KOG0462 Elongation factor-type GTP-binding protein  ali follow..  15  47.......IVAHVDHGKSTLADRLLEMCGAVPPG---------------------------KQMLDKLQVERERGITVKAQTAALRHRGYL-----------LIDTPGHVD----------FSAEVSRSLAVCDGILLLVAANQGVQAQT-----IANFWLAFEKNIQIIPVINKIDL................................................................................................... 166
73 -9.550[J] COG5256 Translation elongation factor EF-1alpha (GTPase)  ali follow..  14  11...LNLITIGHVDHGKSTLVGRLLYEHGEIPAH----IIEEYRKEAEQKGKATFEFAWVMDRFKEERERG-------------VTIDLAHRKFETDKYYFTLIDAPGHRD----------FVKNMITGTSQADAAILVISA----REGEGVMEQTREHAFLARLGVPQMVVINKMDATSPPYSEK-------------------------RYNEVKADAEKLLRSFKDISFVPISGYKGDNVTKLLQALDAF........................ 219
74 -9.470[G] KOG3354 Gluconate kinase  ali follow..  14  17.....FVVIGPAGSGKTTMAKAVSEKLGFEYIE----DLHPKANIEKMSQGHPLNDLHNCGGACAMELDKESIVVLTCSALKRSYRDILRSSLEHRPAILRFIYLAASRET---------LIKRTTSRKNHYMKADMVESQLAILEAPTADEKDVITISVENGKEQSEEECLDIVH.................................................................................................... 184
75 -9.450[U] KOG0096 GTPase Ran/TC4/GSP1 (nuclear protein transport pathway), small G protein superfamily  ali follow..  12  13...FKLVLVGDGGTGKTTFVKRHLT--EFEKKYIATIGVEVHPLSF---------------------------------------------YTNFGEIKFDVWDTAGQ-EKF------GGLRDGYYINAQCAIIMFDVTSRITYKNVPNWHRDLVRVCE-----NIPIVLCGNKVDVKERKVKAKTITFHRKKNLQYYDISAKSNYNFEKPFLWLARKLAG....................................................... 172

FFAS is supported by the NIH grant R01-GM087218-01
1 3 5 7 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Godzik A. Fold recognition methods. Methods Biochem Anal. 2003;44:525-46. Review.