current user: public

If you have questions about the server, please let us know.

Query: [J] KOG1762 60s acidic ribosomal protein P1, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst MASLSELAYIYSALILHNDKINALIKAAGVNVEPFWPGVFAKALANVSIGNPICNVRAGGLAAAGDPTPSTAAASVEKKVEAKKEESEESDEDMGFGLFDLast
1 -77.100[J] KOG1762 60s acidic ribosomal protein P1  ali  100  1MASLSELAYIYSALILHNDKINALIKAAGVNVEPFWPGVFAKALANVSIGNPICNVRAGGLAAAGDPTPSTAAASVEKKVEAKKEESEESDEDMGFGLFD 100
2 -47.200[J] COG2058 Ribosomal protein L12E/L44/L45/RPP1/RPP2  ali follow..  31  2.....KYLAAYLLLTVGGSDIESVLSTVGIESESERVEALIKELDGKDIDELIAAGNEGAAAAAAPAAAGGAAPAAEEAAKEEAKEEEESDEDMGFGLFD 110
3 -35.800[J] KOG3449 60S acidic ribosomal protein P2  ali follow..  13  2.....KVVAAYLLAKLSGADLKKIVESVGAEIDQEKIDLFFSLIKDRDVTELIAVGAVAVASGGGGGAAPAAEPASVESKKKEEEKEESEDDGGMMSLFD 114
4 -16.000[J] KOG0815 60S acidic ribosomal protein P0  ali follow..  50  276..........................................................VAAAPVAADTTAAPAAAAAPAKVEAKEESEESDEDMGFGLFD 317
5 -7.010[S] KOG1443 Predicted integral membrane protein  ali follow..  334VGIVKELLTVIFGIIILSERLSGFYNWLGMLIIMADVCYYNYFRYKQDLLQKYHSVSTQDNRNELKGFQDFEQLGSKKIAPYSISVDLTNQEY....... 426
6 -6.580[GER] COG0697 Permeases of the drug/metabolite transporter (DMT) superfamily  ali follow..  13  260.......VVGQSFWLIGLKTSTVSTASLVASFTPIAGIVAAYFILSEVPTVAQYLGGGLIMLGIFLSQISKSRQTSHKSPIASTPAEQKVEMDMGFGM.. 351
7 -5.200[S] COG4807 Uncharacterized protein conserved in bacteria  ali follow..  13  1MLSNDILRSVRYILKANNNDLVRILALGNVEATAEQIAVWLRKEDEEGFQRC................................................ 52
8 -5.200[G] KOG1583 UDP-N-acetylglucosamine transporter  ali follow..  11  269YVLTTECASLTVTLVVTLRKFVSLLFSI----------YFRNPFTLNHWVGTILVFFGTILFANVINQVRDAYRARSSRKTHFDTAPLAKKVE....... 352
9 -5.010[F] COG0717 Deoxycytidine deaminase  ali follow..  13  1.............MRLCDTDIERYLDDGIISLTPR................................................................. 22
10 -4.700[R] COG4783 Putative Zn-dependent protease, contains TPR repeats  ali follow..  11  105FAFFGGNVVLHSALFRYTDNESELASVLAHEISHVTQRHLARAMEEQQWVGVLGSILLTMASPQAGMAGLSGTLAGAQQGIISFTQGNEQEADIGIQVL. 210

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24