current user: public

If you have questions about the server, please let us know.

Query: [J] KOG2411 Aspartyl-tRNA synthetase, mitochondrial, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460
# Score Template Links and tools%idFirst MQYNLRLRSQMVMKMREYLCNLHGFVDIETPTLFKRTPGGAKEFLVPSREPGKFCSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDALSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPLFLPKEESPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYHIRVSKPTDSKAERAHLast
1 -171.000[J] KOG2411 Aspartyl-tRNA synthetase, mitochondrial  ali  100  1MQYNLRLRSQMVMKMREYLCNLHGFVDIETPTLFKRTPGGAKEFLVPSREPGKFCSLPQSPQQFKQLLMVGGLDRYFQVARCYRDEGSRPDRQPEFTQIDIEMSFVDQTGIQSLIEGLLQYSWPNDKDPVVVPFPTMTFAEVLATYGTDKPDTRFGMKIIDISDVFRNTEIGFLQDALSKPHGTVKAICIPEGAKYLKRKDIESIRNFAADHFNQEILPVFLNANRNWNSPVANFIMESQRLELIRLMETQEEDVVLLTAGEHNKACSLLGKLRLECADLLETRGVVLRDPTLFSFLWVVDFPLFLPKEESPRELESAHHPFTAPHPSDIHLLYTEPKKARSQHYDLVLNGNEIGGGSIRIHNAELQRYILATLLKEDVKMLSHLLQALDYGAPPHGGIALGLDRLICLVTGSPSIRDVIAFPKSFRGHDLMSNTPDSVPPEELKPYHIRVSKPTDSKAERAH 463
2 -150.000[J] COG0173 Aspartyl-tRNA synthetase  ali follow..  39  135MQRNLRLRYQVAMGVRRYL-DAQGFIDIETPMLTRSTPEGARDYLVPSRHPGEFFALPQSPQLFKQLLMVAGFDRYYQITKCFRDEDLRADRQPEFTQIDLETSFLNEDEIMDITEGMAKQVFKDALNVDLGDFPRMPYSEAMFYYGSDKPDMRINLKFTELTDLMKTEEFKVFRGAADMKGGRVVALRV-PNGAEFSRKEIDEYTKFVGIYGAKGLAYIKVNDDSGLQSPIVKYLSENALKEIIARTGAQNGDIIFFGADKAKVVNEAIGALRIKVGLEHGKDNG--YFTDEWKPLWVVDFPMFEY-DEEADRYVAVHHPFTAPKEGHEDLMVSDPANCLARAYDMVLNGWEIGGGSIRIHRADVQEKVFAALKEEQQEKFGFLLDNLKFGAPPHGGLAFGLDRLVTLMTGAESIRDVIAFPKTQRAQCLLTNAPNSVDDKQLRELSLRLRQKATETKE... 601
3 -66.700[J] COG2269 Truncated, possibly inactive, lysyl-tRNA synthetase (class II)  ali follow..  21  36SISQLKQRATLLRQIREFF-AERNVLEVETPAMSHATVTDKTEFVGPGYAKGSALHLMTSPEFHMKRLLAAGSGCIYQLGKAFRNEENGRYHNPEFTMLEWYRIGFDHHALMDEMDALLQLVLRCG------SAERMTYQEAFLNVLGVCP----------------------------------------------------------------------------------------------------------------------LEEEMRELKQVAATLGLSDIAEPEEDRDTLLQL-LFSIGIEPKIGQITPAFVYDFPASQAALAKINPADPRVADRFEVYFKGIELANGFHELDNPAEQLARFKAMGLTEQPIDYHLIAALEAGLPECAGVALGIDRLIMLALGEDHIDKVTAFPFPRA.................................... 349
4 -65.700[J] KOG0556 Aspartyl-tRNA synthetase  ali follow..  22  250NQAIFDIQAGICQAFREFL-LSNSFNEIHTPKMSGASSEGSNVFKIQY---KTDGFLSQSPQLYKQMLIAADRERVFEIGPVFRAEDSNTYRHTEFTGLDLEMAFNEYHEVMEFIEKLFLYIFKTIREKPDADRIRFHFKDAVKLLKEAGYRKQLVPGQKVPEDEEFHYCEDPEFDDFS--------------------------------------------------------------------------------------------------TPEERALGQIVREKYHTDFYVIDKYPSSVR-------------PF---------TMPDPEDPRYSNSYDFFMKGQEIMSGAQRIHDPELLVERMKALGVSPDVGLQQYIDAFAIGCPPHAGGGIGLERVVMFYLNLPNIRLASSFPRDPK.................................... 576
5 -62.300[J] COG1190 Lysyl-tRNA synthetase (class II)  ali follow..  22  180SRHTFKVRSQVMSGIRSFM-VEKGFMEVETPMMQVIPGGAARPFVTHHNALDIDMYLRIAPELYLKRLVVGGFERVFEINRNFRNEGVSPRHNPEFTMMELYMAYADYKDLIVLTEELFRTLTETILGSSVVQYGEQTFDFGKPFAKLTMKEAICKYRPETNVADLDDMD---------------------------------------------------------------------------------------------------------KAVAIAESLGIKVEKSWGLGRIQCEIFEETAE-----SHLIQPTFITEYPAEVSPLARRNDDNPFITDRFEFFIGGREIGNGFSELNDAEDQAQRFADQDDEAMFYDEDYITALEHGLPPTAGLGIGIDRMVMLFTNSHTIRDVILFPAMRPVK.................................. 505
6 -61.900[J] KOG1885 Lysyl-tRNA synthetase (class II)  ali follow..  18  240VRQKFIIRSKIITYIRSFL-DELGFLEIETPMMNIIPGGAAKPFITYHNELDMNLYMRIAPELYHKMLVVGGIDRVYEIGRQFRNEGIDLTHNPEFTTCEFYMAYADYHDLMEITEKMVSGMVKHITGSY-----KVTYHPDGPEGQAYDVDFTPPFRRINMVEELEKA----------------------------------------------------------------------------------------LGMKLPETNLFETEETRKILDDICVAKAVECPPPRTTARLLDKLVGEFLE-----VTCINPTFICDHPQIMSPLAKWHRSKEGLTERFELFVMKKEICNAYTELNDPMRQRQLFEEQDDEAMFIDENFCTALEYGLPPTAGWGMGIDRVAMFLTDSNNIKEVLLFPAMKPEDKKENVATTDTLESTTVGTSV.............. 597
7 -59.100[J] COG0017 Aspartyl/asparaginyl-tRNA synthetases  ali follow..  19  126QHAVMKIRNEVIRATYEFF-NKDGFTKVDPPILTASAPEGSELFHTKY---DQDAFLSQSGQLYLEAA-AMAHGKVFSFGPTFRAEKSKTRRHIEFWMIEGEMAFTNHAESLEIQEQYVTHVVKSVLENVATPFPRISYDDAIEFLKAE-------------------------------------------------------------------------------------------------------------------------GFDDIEWGEDFGAPHETAIANHYDLPVFITNYPTKIK-------------PFYM--------QPNPENEETVLCADLIAGYGEIIGGSERVDDLELLEQRVKEHGLDEEA-YSYYLDLRRYGSVPHCGFGLGLERTVAWISGVEHVRETAPFPRLLN.................................... 426
8 -55.400[J] KOG0554 Asparaginyl-tRNA synthetase (mitochondrial)  ali follow..  19  224FGAVARVRNTLAYATHKFF-QESGFVWVASPIITASDCEGGEQFCVSQDFFGKPAFLTVSGQLNGE-TYATALSDVYTFGPTFRAENSNTSRHAEFWMIEPELAFADLDDDMACATAYLQYVVKYVLDNCKEDMEFFDTWIEKGIIRRLSDVAEKEFLQLGYTDAIE----------------------------------------------------------------------------------------ILLKANKKFDFPVKWGLDLQSEHERYITEEAFGGRP-----VIIRDY----------------------PKEIKAFYMRENDDGKTVAAMDMLVPRIELIGGSQREERLEVLEARLDE-LKLNKESYWWYLDLRRYGSVPHAGFGLGFERLVQFVTGIDNIRDVIPFPRTPASAE................................. 566
9 -53.300[J] KOG0555 Asparaginyl-tRNA synthetase  ali follow..  22  238ASRILRIRAAATRAMRDHF-FAAGYTEVAPPTLVQTQVEGSTLFGLDY---GEPAYLTQSSQLYLE-TCNAALGDVYCISQSYRAEKSRTRRHSEYQHVEAECAFITFDQLMDRIEALVCDTVDRLLADPARPFKRMPYKEAIEWLQKNDVRNEMGEKF--------------------------------------------------------------------------------------------------------------------VYGEDIAEAAERRMTDTIGVPILLNRFPHGIK-------------AF--------YMPRCADDNELTESVDLLMPGVEIVGGSMRIWKEDQLLAAFEKGGLD-SKNYYWYMDQRKYGSVPHGGYGLGLERFICWLTDTNHIRDVCLYPRFVG.................................... 541
10 -48.200[E] COG2502 Asparagine synthetase A  ali follow..  11  1MKKTFILQQQEISFVKNTFTEQLGIIEVQGPILSQVGNGMQDNLVNVKCIPNAVFEVVHSLAKWKRHTLAEDEGLFVHMKALRPDEDSLDPTH-YVDQWDWEKVIPEGRRNFAYLKETVNSIYRAIRLTLPKQITFVHSEDLVKRYPDLSSKER------------------------------------------------------------------------------------------------------------------------------------ENAICKEYGAVFLIGIGGKLSDGKPHDGRAPDYDDWTTESENGYKGLNGD----ILVWNDQLGKAFELSSMGIRVDESALRLQV-GLTGDEDHLKMDWHQDLLNGKLPLTIGGGIGQSRLAMLLLRKKHIGEVQSWPK-----EMLEEFSNIL........................ 330
11 -13.400[J] COG0442 Prolyl-tRNA synthetase  ali follow..  12  43LPTGVRVLKKVENIVREEM-NNAGAIEVSMPVVQPADEQYGPELLRFVDRGERPFVLGPTHEEVITDLIRGEINSYFQIQTKFRDE-----RAREFLMKDAYSFHTTQESLQETYDAM-YTAYSKIFSRMDLNFRAVLADTVLAESGEDD------IVFSTGSDYAANIEFAEALAPTEPRAPATEELRIVDTPNAKTIAELVEQFKLPIEKTVKTLLVAHEESGHKLVALLVRGDHDLNEIKAEKLPQVAKPLTFASEEEIRAAIGAGPGSLGPVNLSLPVIADHSVAV--------MSDFGAGANIDGKHYFGINWERDLALPLVADLRNVVEGDISPDGKGTLQIKRGIEVG-------------HIFQLGTKYSEVMKATVQGEDGRNQVMTMGYGIGVSRVVAAAIEQNHDDRGIIWPDAIAPFQVAILPMNMHKSFRVKELAEELYTTLRSHGID.. 506
12 -11.100[J] KOG1936 Histidyl-tRNA synthetase  ali follow..  11  67SPQHMVVREKILDLVISCF-KRHGAKGMDTPTLTEKYGEDSGLMYDLKDQGGELLSLRYDLTVPFARYLAMN--KRYHVGKVWRRETIVQGRYREFCQCDFDI------------------------------------------AGQFDPDAECLKIMCEILSGLQLGDFLIKVNDRRIVDGMFAVCGVPESKFRAICSSIDKLDKMAWKDVRHEMVVKKGLAPEVADRIGDYVQCHGGVSLVEQMFQDPRLSQNKQALEGLGDLKLLFEYLTLFGIADKISFDLSLARGLDYYTGVIYEAVLLQTPTQAGEEPLNVGSVAA------------------GGRYDGLVG--MFDPKGHKV---------------------------------PCVGLSIGVERIFYIVEQDSGIKAEMLYKNNPKLLTQLHYCESTIGEQELKEGVIKIRSVASREEVA.. 489
13 -10.800[J] COG0124 Histidyl-tRNA synthetase  ali follow..  11  13LPGDVETWQWIEQKAYDLC-RRYNYQEIRVPMFEDTTDIVQKEMYTFEDRGGRSLTLPEGTASVTRAYVSNKL-KLFYIGPMFRYERPQSGRMRQFVQFGVEA------------------------------------------LGSADPAIDAEV-LALVMRFYEELGLKNLKLVINSLGDTDSRLAHREALVNHFKPRIHEFCNDCQDR-------------------------EKNPLRILDCKKDRDHELMGTAPSIHDYLSTESKAYFEKVQSYLTALNIPFV--------------------------------VDATLVRGLDYYNHTAFEVMVDGEGFGAITTLCGGG-----------------------RYNGLVEEIGGPETPGIGFALSIERAIMALEAQQAKPDCYVVTLGEAAKDKGVELVYQLRNAGISAEKDYLDRKMKGQLKAAD 376
14 -9.820[E] COG3705 ATP phosphoribosyltransferase involved in histidine biosynthesis  ali follow..  10  14LPTNARQLESAREQLLALF-RVHGYELVQPPLMHIDAGLSLKTILVTDRLSGRQLGIR--ADITPQVARIDAHLRLCYAGPVLHAQSDGLLNMREPLQAGAEMDIRGDIELIDLMLKSMKIA-------------------DMGKVLLSLGHIGIFRALSDAAHLDAGQSATLLALMQDKDTETVEAQVKAWKLDGMWAKAFSLLPRLYGGREVLSDARGRLPDLSAVGGALGE-----------------------------------LQAVCDAFPDCEIHIDLSELRVDNY----------------------------------------------TGLLYAAYAADFAVARGG----------------------RYDGLGGYFGRARPA--GFSFDLRSFIGRLPAIERQPAVLVDAEDAEAAHEAV--------EALREQGQCVVIDYGIGHNVSE 365

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.