current user: public

If you have questions about the server, please let us know.

Query: [A] KOG2412 Nuclear-export-signal (NES)-containing protein/polyadenylated-RNA export factor, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .
# Score Template Links and tools%idFirst MRFVFDEVFNSDTDSPEFEETCSTTSSTSSQCPTPEPSPAIKLPSFTKVGTKKLVNESVVILDPALENALRDLNLQSKLIPINEPIVAASSIIVPHSTNMPLPRASHSSLLDNAKNSNATAPLLEAIEESFQRKMQNLVLANQKEIQSIRENKRRVEEQRKRKEEEERKRKEAEEKAKREQELLRQKKDEEERKRKEAEAKLAQQKQEEERKKIEEQNEKERQLKKEHEAKLLQQKDKLGKAVTNFDKISKMFWHYKDKIAQIKQDIVLPIKKADVNVRNLLSRHKRKINPKFGQLTNSNQQLFKIQNELTQLINDTKGDSLAYHWILNFIAKAVVHQAETEVRVKPESALPLGKLTLYLLVQFPELQELFMARLVKKCPFVIGFTCEIDTEKGRQNMGWKRNNENKWEDNTSYDERMGGILSLFAIITRLQLPQEFITTTSHPFPIALSWHILARICNTPLNLITNTHFVILGSWWDAAAVQFLQAYGNQASKLLILIGEELTSRMAEKKYVGAARLRILLEAWQNNNMESFPEMSPLast
1 -91.300[A] KOG2412 Nuclear-export-signal (NES)-containing protein/polyadenylated-RNA export factor  ali  100  1MRFVFDEVFNSDTDSPEFEETCSTTSSTSSQCPTPEPSPAIKLPSFTKVGTKKLVNESVVILDPALENALRDLNLQSKLIPINEPIVAASSIIVPHSTNMPLPRASHSSLLDNAKNSNATAPLLEAIEESFQRKMQNLVLANQKEIQSIRENKRRVEEQRKRKEEEERKRKEAEEKAKREQELLRQKKDEEERKRKEAEAKLAQQKQEEERKKIEEQNEKERQLKKEHEAKLLQQKDKLGKAVTNFDKISKMFWHYKDKIAQIKQDIVLPIKKADVNVRNLLSRHKRKINPKFGQLTNSNQQLFKIQNELTQLINDTKGDSLAYHWILNFIAKAVVHQAETEVRVKPESALPLGKLTLYLLVQFPELQELFMARLVKKCPFVIGFTCEIDTEKGRQNMGWKRNNENKWEDNTSYDERMGGILSLFAIITRLQLPQEFITTTSHPFPIALSWHILARICNTPLNLITNTHFVILGSWWDAAAVQFLQAYGNQASKLLILIGEELTSRMAEKKYVGAARLRILLEAWQNNNMESFPEMSP 538
2 -13.100[R] KOG2295 C2H2 Zn-finger protein  ali follow..  240......GSVKVDSSQADALIRVLDTCVIKLEGGTDEDLKVLDEKPKDPVVYERKAEQMQSVKEVEKTINSPKEEMSEADPVSTQRKPVRPVNSDGENWDDDDAENSAPKKELAEDSKDSDSKPEDKQLNKKKTKKRKRNSSDDDSSSSESSSSSDEEKLKEKYDVEDGLRAEQKTEAEKDRQEATKAKQGPQSPKLDEDEGNENTEPKGLDSKINTYEEIDNTLKSPEISSNPIKNTDNGDGSKVEEDGEKPSVGKDKVVETETIDLDKVKDGQPRALHRTSSIFLRNLAPSI-----TRSEIEAVCNRFSGYLR............................................................................................................................................................................................................................... 543
3 -12.400[A] KOG4849 mRNA cleavage factor I subunit/CPSF subunit  ali follow..  449.....EEVMSRNRTVSSSAIARAVSDAAAGEYSSAIETLVTAISLIKQ--SKVAHDERCKILISSLQDTLHGIEAKSYNRRERSRSRERSHRSRQRRERSTSRYRERSRERERDRDRERERDGGRSVRPRKSPEPVVAEAAEAPSSKRYYEDRERYRSSDRERRDRDRDRDRERERDRDRHFTNDGRGLPLDPSNFTSQNPGNIKTGRPKSAAVAGGSMEKPRGQSAWDIIDTDAHWIIKQQTTSIPAPPSSQQN........................................................................................................................................................................................................................................................................................... 696
4 -11.300[S] COG5373 Predicted membrane protein  ali follow..  12  19.....................................................................................................................................................................................GGRRSAERLDREIESLKAEIARLAKEGMGEPGPDLATGRPSEAGVPSVAGTEATADGPWSRAREGAGTSHDESAAGRESGDGAIDGPVAPSAAAARAESLESRIGGRWPVWVGGLA--------------------------LALGGYFLVQYSIEAG------------PAVRLTLAAI-----FGLALGV----------------------EVIRRRDVPAIADRFRNAMIPGVAGAVTLFGVVYAA----------------------IYDFIG-------TGAAFVLLALVSLATVGLSLLHG-QALAGLGLLASLLTPLFVSSGEPRPWVLFGFL................ 274
5 -11.300[U] KOG0946 ER-Golgi vesicle-tethering protein p115  ali follow..  629.............YKSSEEDKKEEEVKKTLEQHDNIVTHYKNMIREQDLQLEELRQQVSTLKCQNEQLQTAVTQQVSQIQQHKDQYNLLKIQLGKDNQHQGSYSEGAQMNGIQPEEIGRLREEIEELKRNQELLQSQEKDSMIENMKSSQTSGTNEQSSAIVSARDSEQVAELKQELATLKSQLNSQSVEITKLQTEKQELLQKTEAFAKSVEVQGETETIIATKTTDVEGRLSALLQETKELKNEIKALSEERTAIKEQLDSSNSTIAILQTEKDKLELEITDSKKEQDDLLVLLADQDQKILSLKNKLKDL................................................................................................................................................................................................................................. 930
6 -11.100[A] KOG2217 U4/U6.U5 snRNP associated protein  ali follow..  2.........GSSSSGKKHKKDKKNRHRSRSSERPRRVTEDEDVTLDLTDDSSSRHRHHKHKKHKEHRHKHHKQKERERANEVISLEESDSDSSDCVEVPVQAQVQAQAKLRDARESSNRDKERDSGRDRELLRERERERDRERERDRDREKEREREREKERLREREEREREREKERIREREKERLRERERERERERVRELTAPPPPQISKHAEYESRREREIERERDARKRSGRERERERNRERSRSQSPASSSRKPATKEREPSSRSFSPIPENGAGDVLSITETNKLRAKLGL................................................................................................................................................................................................................................................... 287
7 -10.900[K] COG5164 Transcription elongation factor  ali follow..  10  1MSDNSDTNVSMQDHDQQFADPVVVPQSTDTKDENTSDKDTVDSGNVTTTESTERAESTSNIPPLDGEEKEAKSEPQQPEDNAETAATEQVSSSNGPATDDAQATLNTDSSEANEIVKKEEGSDERKRPREEDTKNSDGDTKDEGDNKDEDDDEDDDDDDDDEDDDDEAPTKRRRQERNRDDEDEDEDEEDSELVREGFITHGDDEDDEASAPGARRDDRLHRQLDQDLNKTSEEDAQRLAKELRERYGRSSSKQYRAAAQDGYVPQRFLLPSVDTATIRCRPGKEKELIRKLLKKKFNLDRAMGKKKLKILSI------------FQRDNYTGRIYIEAPKQSVIE-KFCNGVPDIYISQKLLIPELPLLLKPNKSDDVALEEGSYVRIKRGIYKGDLAMVDQSENNLEVMLKIVPRL........................................................................................................................ 420
8 -10.600[R] KOG2507 Ubiquitin regulatory protein UBXD2, contains UAS and UBX domains  ali follow..  10  130.........AKTLDPNEVRSFAGADGSSSTGESQVVQTASENFRDPETTSVSNSPTGGVEEAKTNPPNSPVAASLASIPAAVSTSSLEGKSGSEAEAASPTALAAEKRAAASKVEGSATTSGAAARNFATNNLIPAVPLMTPAVPVPTQRPLEAQDNTESEERLAEVRNILEQKRKERVEEEKRMEKENELRRRRDGREAQSQQARAKEQELKNMQEQIKRERQEELAARERIRAQIAADRAEQAQRFNTPDISSTTNSVAATAASNVITTDASVSSVDETRLQIRLPGGIQRTKSFPAGEVLATVRVYVRNEMLAASDVRD----LATSYPRREFQTEDEVKTLNELNLVPNAVVLV.................................................................................................................................................................................... 476
9 -10.200[S] KOG4610 Uncharacterized conserved protein  ali follow..  289..INYMNVFFTCKNSLVIILQLYRLYVVNAEFWKNRRESRMAKSRQFQSRRKVQDADQNSIYMISNERGGDVKKKIKRAKDKDYAEQEAVYSKKKKDKKDKKKRKRKDTGYSTASSQNLYSTKASGTDKDTRRKDKKGKKSKRTCSSSPSDCDLAKKQKRKNADKNDKKKSRKIEAVVEESSSSSSSSSDSSNSTLPSYEVIDEKKARRRKHRGSSSDTSSGDSSSSSSSSSSSDSS............................................................................................................................................................................................................................................................................................................. 523
10 -10.000[A] KOG4676 Splicing factor, arginine/serine-rich  ali follow..  211.........KSDTSSKEIEEAMKRVREAQSLISAAIEPDKKEEKRRHSRSRSRSRRRRTPSSSRHRRSRSRSRRRSHSKSRSRRRSKSPRRRRSHSRERGRRSRSTSKTRDKKKEDKEKKRSKTPPKSYSTARRSRSASRERRRRRSRSGTRSPKKPRSPKRKLSRSPSPRRHKKEKKKDKDKERSRDERERSTSKKKKSKDKEKDRERKSESDKDVKQVTRDYDEEEQGYDSEKEKKEEKKPIETGSPKTKECSVEKGTGDSLRESKVNGDDHHEEDMD.................................................................................................................................................................................................................................................................. 481
11 -9.790[T] KOG2141 Protein involved in high osmolarity signaling pathway  ali follow..  10  56.........KRKRQLEAKKEQRKLEYLQNKNRNDGDSDDEEDMEDSEDEEEKKPTNRKGIVEVSVNKGKRKYGDDSEDSDEDLTYEQYMEEVQTATKKRRQEADGTEEDDAAIRKYGVLLGVNEQKKERDGKLKVPKSMKSDGLDLLLDFCDSERRKELMEDELDDDNMEDEEEFEDEEDEADESGNELDLSEGEEPVESEDDEDMVDEMMSDEEDNVDDEKIVEISDSEIETSAPKKSEETEDIYGRKINKSTGELIKFDPAAARKKLEELDATSSTGEQKQRVERAVNSIINKLSDA--MLIKSQQGIAELWANSSKN------VKSALYKFLSKALLAPFRLQDSLLTTYGALIAMCHTMINEISAHFVECFMCD-------------------------VKSMQEEEEMDDKSMENCVIFTAFLVVFRI------------------SILIEIIDKLAENLNLTNLFAIRTLIAYAYKSLKKTSWPLVTQKIDEIHS----EFEKKPISALPRAKFLLEEVLKKSPPK...... 531

FFAS is supported by the NIH grant R01-GM087218-01
1 4 3 0 4 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zhang Y, Stec B, Godzik A. Between order and disorder in protein structures: analysis of "dual personality" fragments in proteins. Structure. 2007 Sep;15(9):1141-7.