current user: public

If you have questions about the server, please let us know.

Query: [R] KOG2423 Nucleolar GTPase, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .
# Score Template Links and tools%idFirst MYKSFKPIRDSKGKILKAAPFQDTLASGTQARIEPNRKWFGNTRIIGQEQLQKFQANLGKVLSDPFQVVMKQTKLPISLLQEKAKTQRVHVTETESFEYTFGKKSLRKKAKLTEASLEEMSKSAEDRDVKYKPELDLSREKELGDRPENMNPLFRAGQSNRVWGELYKVIDSSDVVVQVVDARDPMGTRCRHVEEFLRKEKPHKHLVTVINKVDLVPTWVTRKWIGELSKEMPTIAFHASINNSFGKGAVINLLRQFAKLHPDRPQISVGFIGYPNVGKSSLVNTLRKKKVCKTAPIAGETKVWQYVMLMRRIYLIDSPGVVYPQGDSETQIILKGVVRVENVKDPENHVQGVLDRCKPEHLRRQYGIPEFTDVDDFLTKIAIKQGRLLKGGDPDIVAVSKVVLNEFQRGKLPYFVPPPGCEERAKKDFSQAPINEMCADDDEQLPLDAQLELDDVARICHNRKSEKNRGRLKTPSKNSNFQNSLNYLFEFPPARNSNWKFSQKKNGGPDEDDDEAIDDEEQEELTEIGSTCSGLTDLSGISDLAGDLSDADDVADDDEKPSSSDSKTKKSKTDVASVRTRGKRGGKKANKAKLSGKTIVQAASEKKDKSVVEFAKPGATKTNMWRKKLEKRRKVKHQKLast
1 -106.000[R] KOG2423 Nucleolar GTPase  ali  100  1MYKSFKPIRDSKGKILKAAPFQDTLASGTQARIEPNRKWFGNTRIIGQEQLQKFQANLGKVLSDPFQVVMKQTKLPISLLQEKAKTQRVHVTETESFEYTFGKKSLRKKAKLTEASLEEMSKSAEDRDVKYKPELDLSREKELGDRPENMNPLFRAGQSNRVWGELYKVIDSSDVVVQVVDARDPMGTRCRHVEEFLRKEKPHKHLVTVINKVDLVPTWVTRKWIGELSKEMPTIAFHASINNSFGKGAVINLLRQFAKLHPDRPQISVGFIGYPNVGKSSLVNTLRKKKVCKTAPIAGETKVWQYVMLMRRIYLIDSPGVVYPQGDSETQIILKGVVRVENVKDPENHVQGVLDRCKPEHLRRQYGIPEFTDVDDFLTKIAIKQGRLLKGGDPDIVAVSKVVLNEFQRGKLPYFVPPPGCEERAKKDFSQAPINEMCADDDEQLPLDAQLELDDVARICHNRKSEKNRGRLKTPSKNSNFQNSLNYLFEFPPARNSNWKFSQKKNGGPDEDDDEAIDDEEQEELTEIGSTCSGLTDLSGISDLAGDLSDADDVADDDEKPSSSDSKTKKSKTDVASVRTRGKRGGKKANKAKLSGKTIVQAASEKKDKSVVEFAKPGATKTNMWRKKLEKRRKVKHQK 639
2 -80.300[R] KOG2484 GTPase  ali follow..  23  8...............................TKKSKRLTGRLKHKIEKKVRDHNKKERRAAKKNPKKGSKKLIQIPNICPFKDDILKEVEE-AKQRQEAERLARREAFKAEREQNKFKTLESMVEDADMRSTVHGIMHENDAQDQDEKKKNAVTKEQSLKQYFKEFRKVIENADVVLEVVDARDPLGTRCNEVERAVRGAPGNKRLVLVLNKADLVPRENLNNWIKYFRRSGPVTAFKASTQDQAGAELLMSMLGNYCRNKGIKTSIRVGVVGIPNVGKSSIINSLTRGRSCMVGSTPGVTKSMQEVELDSKIKLIDCPGIVFTSGGENSHAVLKNAQRVGDVKDPFTIAESVLKRASKEYFCTMYDITNYDTFEEFFAKKAARMGKFLKKGVPDVVAAARSVLNDWNTGKIKYCTQPPEVQEGQSVHISASIVHSEAREFDVENFESMETEILEHCAVKTDDIMEITSTGPLEIRQPREEAEPADKITASLVIDEKEKPAKGRKRKLDEEKEKVDPSLLLEENQSLNKGIKQMQKLKKKQNVRNEKKISKITDVLDSFSLGPSSSKAEK..................................................................... 571
3 -73.100[R] KOG1424 Predicted GTP-binding protein MMR1  ali follow..  18  9GGSLGRALMRHQTQRSRSHRHTDSWLHTSELNDGYDWGRLNLQSVTEQSSLDDFLATAELAGTEFVAEKLNIKFV--------PAEARTGLLSFEESQRIKKLHEENKQFLCIPRRPNWNQNTTPEELKQAEKDNFLEWRRQLVRLEEEQKLILTPFERNDFWRQLWRVIERSDIVVQIVDARNPLLFRCEDLECYVKEMDANKENVILINKADLLTAEQRSAWAMYFEKEDVKVIFWSALAGAISKQELLELFKELHTGRKVKDGLTVGLVGYPNVGKSSTINTIMGNKKVSVSATPGHTKHFQTLYVEPGLCLCDCPGLVMPSFSTKAEMTCSGILPIDQMRDHVPPVSLVCQNIPRHVLEATYGINIITTSEELLTAYGYMRGFMTAHGQPDQPRSARYILKDYVSGKLLYCHPPPGRDPVTFQHQHQRLLEEIKMQLGRNKKAKQIENIVDKTFFHQENVRALTKGVQAVMGYKPGSGVVTASTASSENGAGKPWKKHGNRNKKEKSRRLYKHLD........................................................................................................................ 657
4 -46.300[R] KOG2485 Conserved ATP/GTP binding protein  ali follow..  17  22...................................................................................................................................................DAGKINWFPGHMAAATRAIRNRLKLSDLVIEVRDARIPLSSANEDLQSQM----SAKRRIIALNKKDLANPNVLNVIRFFKWTRHQDCIAINAHSRSSVMKLLDLVELKLKEVIAREPTLLVMVVGVPNVGKSALINSIHQLKRATVGPLPGVTQDIAGFKIAHRIYVLDSPGVLVPSIPDIEKLALSGSVK-DSVVGEERIAQYFLAILNITPLHWKYLVEG-GPHADCIDKPSYNLKDLRHQRTKQPDSSALHYVGDMISEVQRSLYITLSEDENDLECLIEQQFEVLQKALKIPHKASEARLMVSK....................................................................................................................................................................................... 356
5 -26.600[R] COG1161 Predicted GTPases  ali follow..  17  8........................................................................................AKIQTEAKNALGFLPAGALKKKIAERDQMEAVQAGDEGSEASIKTEDLY---QRCFRLRHYNEIAPTSLTDADFLRLLKEIGQHDALIVNVVDIFDFNGSLIPNLHKLT----GGNDLLMVANKRDVLPKSLKVGKLTWLREQAASRSLKPKDILVTSAQNKDDVAELMEAIEYYRRGRDVYVVGVTNVGKSTLINAIIKSDVITTSRFPGTTLDKIEIPLDEDSALIDTPGIIHRGLDPEQTLFFGGLARFDFISGERQGMTAYFDNEINVHRTKLEGATEFYEKHKGELLAPALVGAKLVRREFKITDKSDIVFSGL--GWV................................................................................................................................................................................................................................... 355
6 -15.400[R] COG0218 Predicted GTPase  ali follow..  18  27...........................................................................................................................................................................................................................................................................EIALAGRSNVGKSSFINTMLNRKLARTSGKPGKTQLLNFFNIDDKMRFVDVPGYGYARVSKKEREKWGCMIEEYLTTRENLRAVVSLVDLRHDPSADDVQMYEFLKYYEIVIIVATKADKIPRGKWNKHESAIKKKLN.......................................................................................................................................................................................................................................... 166
7 -15.300[R] COG1160 Predicted GTPases  ali follow..  20  69..............................................................................................................................................................EEKMAEQSLLAIDEADIVLFLVDARAGLTAADIGIANYLRQ-RQNKITVVVANKTDGIDADSHCA--EFYQLGLGEIEQIAASQGRGVTQLMEQVLAPFAEEEEQDKNIKIAIVGRPNVGKSTLTNRILGEDRVVVFDMPGTTRDSIYIPMGQQYTLIDTAGV---QAIQDANVVLLTIDARENISDQDLSLLGFILNAGRSLVVNKWDGLDQDVKDRVKSELDRRLDFIHGSGVGNLFDSIKEAYACATQ-KLKYAHPPP............................................................................................................................................................................................................................ 431
8 -14.500[R] KOG2486 Predicted GTPase  ali follow..  13  7...........................................................................................................................................................PRFHLSILAKPSFSLSSSHFSFLNPKPSVTV-SRTLFSFASKSNLATVEPIPLSVSDSTDLDDAPVE--IALDKLFIPPETDISGEDSASLTTRILKGSNIVLSKYARDAQVVFALVGRSNVGKSSLLNSLVRRKLALTSKKPGKTQCINHFRINDKWYLVDLPGYGYASAPHELKQDWNKFTKASWLGQNQVPMTLIFTKCDKRKKKKNGGKKPEANIKEFQDLIQGFFSSVTNQGRDEILLHMAQLRNYWLK...................................................................................................................................................................................................................................... 317
9 -13.400[R] COG1084 Predicted GTPase  ali follow..  17  55...............................................................................................................................................................DRLKMIIQRIPDIESLPEDYIDVTVGVDELKKSLGAL---NWAVGILNQLESDYMARIKRSKPSDASHLRREAFGRISSVIKRIEGDLDFLDFAKNKLRNMPTVDLDATVVIAGFPNVGKSTLLRTLTGAEP-EVADYPFTTKGIQIGHLEKRIQVIDTPGLLDRPVEDMNNIELQAMVALENIADVIMFIPVVTVFNKMDLAENVKYLEEYINMVEDPLKVSAFEGR----GVSKIIKKLEGLYEKETR...................................................................................................................................................................................................................................... 330
10 -12.800[R] COG3596 Predicted GTPase  ali follow..  21  36.......................................................................................................................................................................................................................................................................HYEPVIGIMGKTGAGKSSLCNALFAGEVSPVSDVAACTRDPLRFRLQHFMTIVDLPGVLYREQLPRLDLIL--LIKADDLATDEHFYRQVIGEAYRHKMLFVIS................................................................................................................................................................................................................................................................................ 155
11 -12.100[J] KOG1191 Mitochondrial GTPase  ali follow..  15  261.........................................................................................................................................................................LSQAENVEKLISAKSSAAADAAGFSSLVKSL--RAQCIELLTEIEAR--------LDFEDEMPPLDIESVINKITSMSQDVESALDTANYDKLLQSGLQIAIVGRPNVGKSSLLNAWSKSERAIVTEVAGTTRDVANVTVRG-ITLLDTAGI-----ETNDIVEKIGVERSETAAKVADVIIMAVS............................................................................................................................................................................................................................................................................................ 441
12 -11.000[R] COG1162 Predicted GTPases  ali follow..  19  120........................................................................................................................................................................IAANLDTIFIVTSVGKDLNLR--RLERYLAIVSSGASPVILLNKIDLADDPARLVEKIRDVTGDVPVIPLSALSKTGLDALGPYL----------NPGETVALVGSSGVGKSTLINAFLGETVQKTADI-GTTTVRQMFLLPNGAVLIDNPGI--------REIQLGDS---EGLEKAFSEIVDAARNC-------KFKDCTHRNEPGCAVLQAVRDGIIPEERLESYHRLTDEL............................................................................................................................................................................................................................................ 333
13 -10.400[R] COG0486 Predicted GTPase  ali follow..  17  134.........................................................................................................................................................................LAQAEAIADLIDASSEQAARSAEFSNKVNQLVDSYLRTYVEAAIDFPDEEIDFLADGKIEAHLNDII-----------TQLDHVRSEAKQGSILREGMKVVIAGRPNAGKSSLLNALAGREAAIVTDIAGTTRDVEHIHIDG-LHIIDTAGL-----EATDEVERIGIVRAWSEIEQADRILLMLD............................................................................................................................................................................................................................................................................................ 315
14 -10.200[R] KOG1490 GTP-binding protein CRFG/NOG1 (ODN superfamily)  ali follow..  47.............................................................................................................................................................YMRKVKYTQTNFHAKLSAIIDEFPRLEQIHPFYGDLLHVLYNKDHYKLALGQVNTARNLISKISKDYVKLLKYGDSLYRCKCLKVAALGRKRITPSLAYLEQIRQHMARLTVLICGYPNVGKSSFMNKVTRADV-DVQPYAFTTKSLFVGHTDLRYQVIDTPGILDRPFEDRNIIEMCSITALAHLRAAVLFFLDIFMNKPLVIVCNKTDLMPMENISEEDRKLIEE-STLTDEGVMSVKNAACERLLDQRV-RFHVAIPKPRDSIERLPCIPQVVLEAKAKEAAAMEKRKTEKDLEEENGGAGVYSASLKKNYILQHDEWKEDIMPEILDGHNVADDPDILQRLAELEREEGIREAGVEEADMEMDIEKLSDEQLKQLSEIRKKKAILIKNHRLKKTVAQNRSTVPRKFDKDKKYTTKRMGRELSAMGLDPSSAMDRARSKSRGRKRDRSEDAGNDAMDVDDEQQSNKKQRVRSKSRAMSI 599
15 -10.000[P] COG0370 Fe2+ transport system protein B  ali follow..  18  2........................................................................................................................................................................................................................................................................SQNTYCILGNPNTGKTSLFNALTGSYE-YVGNWSGVTVEKKVGTLRKTGKLIDLPGIYDLNPISRDETVVTRFLLEEKFD-------CMLNIVDSSQIERNLNLQLLEYGAPVVMGLNMIDVAAGRGIHLNIQNLAKKL............................................................................................................................................................................................................................................ 135
16 -9.940[E] COG4917 Ethanolamine utilization protein  ali follow..  13  3...........................................................................................................................................................................................................................................................................RIAFVGSVGAGKTTLFNALQGNYTL--------ARKTQAVEFNDK-GDIDTPGEYFNHTLQDVDMLI--ISKTDMPDADVAATRKLLLETGFEEPMFELNSHDPQSVQQLVDYLASLTKQEEAGEKTHHSE................................................................................................................................................................................................................................................. 159
17 -9.470[R] COG1159 GTPase  ali follow..  17  11............................................................................................................................................................................................................................................................................IAIVGRPNVGKSTLLNKLLGQKISITSRKAQTTRH------PYQAIYVDTPGLAASSSIGDVELVI--VVEGTRWTPDDEMVLNKLRDGKAPVILAVNKVDNVQEKVDLLPHLQFLASQMNFLDIVPISAETGMNVDTIAGIVRKHLPEAI............................................................................................................................................................................................................................ 177
18 -9.090[O] KOG0448 Mitofusin 1 GTPase, involved in mitochondrila biogenesis  ali follow..  12  1........................................................................................................................................................................MAEPVSPLKHFVLAKKGITAIFDQLLEFVTEGSHFVEATYKNPELDRIATEDDLVEMQGYKDK------------------LSIIGEVLS-----RRHMKVAFFGRTSSGKSSVINAMLWDKVLPSGIGH-ITNCFLSVELRDDLVLVDSPGT-------------------DVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNEWLSK............................................................................................................................................................................................................................................................ 229

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 3 5 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Liu T, Rojas A, Ye Y, Godzik A. Homology modeling provides insights into the binding mode of the PAAD/DAPIN/pyrin domain, a fourth member of the CARD/DD/DED domain family. Protein Sci. 2003 Sep;12(9):1872-81.