current user: public

If you have questions about the server, please let us know.

Query: [E] KOG2551 Phospholipase/carboxyhydrolase, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230
# Score Template Links and tools%idFirst MAPEIHLKPKNPRILCLHGFRTSGRILQAGIGKWPDTILRDLDLDFLDAPFPATGKSDVERFFDPPYYEWYQANKGFKEYRNFEECLAYIEDYMIKNGPFDGLLGFSQGAFLTAAIPGMQEQGSALTKVPKVKFLVIISGAKIPGLMFGEPKAAVNAFSSPVRCPSLHFIGERDFLKIEGEVLVESFVEPVVIHHSGGHIIPKLDTKAEETMLSFFQSIRQMLSDESGSVRSLMLast
1 -102.000[E] KOG2551 Phospholipase/carboxyhydrolase  ali  100  1MAPEIHLKPKNPRILCLHGFRTSGRILQAGIGKWPDTILRDLDLDFLDAPFPATGKSDVERFFDPPYYEWYQANKGFKEYRNFEECLAYIEDYMIKNGPFDGLLGFSQGAFLTAAIPGMQEQGSALTKVPKVKFLVIISGAKIPGLMFGEPKAAVNAFSSPVRCPSLHFIGERDFLKIEGEVLVESFVEPVVIHHSGGHIIPKLDTKAEETMLSFFQSIRQMLSDESGSVRSLM 234
2 -26.500[R] COG0400 Predicted esterase  ali follow..  12  7....KGADPNAPTLLLLHGTGGNEH----DLVPLAEMISPGSSILGVRGNVLENGMPR----------FFRRIAEGVFDEEDLVIRTKELHEFLDDAVREHAAIGYSNGANIAASLLYHYEQ--------PLMGAILFKAMVP---------LRNRTVPDLQQMPIFIGAGKYDPLIPQTNTLTNAGANVYEQWIDVGHQL--TREEVERAKEWFNEQFLEA............ 204
3 -22.100[I] KOG2112 Lysophospholipase  ali follow..  13  1MAAASPAGRHSASLIFLHGSGDSGQGLRMWIKQVLNQ--QHIKIIYPTAPPR-SYTPMKGGISNVWFDRFKITNDCPEHLESIDVMCQVLTDLIDEE-KKNRILGFSMGGCMAMHLAYRNHQ--------DVAGVFALSSFLNKASAVYQALQKSNGV----LPELFQCHGTADELVLTNSMLKSLGVTTKFHSFPNYHEL--SKTELDILKLWILTKLPGEMEKQK....... 237
4 -19.900[R] COG3571 Predicted hydrolase of the alpha/beta-hydrolase fold  ali follow..  13  9.....GPGDAPVTILLAHGAGAPSTSMTAAAMALAGVGFRVARFEF-------------------GYMAARRTADGRKPRPARKTLNPEYRAAIAELGAQGTLVGKSMGGRVASMVADDLHAEGKIAGLLCLGYPFHPPG---------KPDQLRTRHLTDLKTPALICQGTRDEFRDEVSRYALSDRIELLWLEDGDHDLKPRKTVSGFSTADHLKTLAEAVAR......... 206
5 -17.600[R] COG3150 Predicted esterase  ali follow..  11  1..........MSTLLYLHGFNSSPR--SAKASLLKNWLAEHPDVEMIIPQLPPYP----------------------------SDAAELLESIVLEHGG---IVGSSLGGYYATWLSQCFMLP-----------AVVVNPAVRPESRHIYDLKVMQIDPLEAPDLIWLLQQTGDEVLDYRQAVAYYASCRQTVIEGGNHAFTGFEDYFNPIVDFL................... 188
6 -17.400[R] COG3545 Predicted esterase of the alpha/beta hydrolase fold  ali follow..  14  1......MKVSETHILIVPGYTNSGP--NHWQTRWERKLSTARRVEQAEWSKP-----------------------------VREDWVARMIEEVNAAEKPVVIVAHSLGVATAIHALPHCTRQIAGA------FLVAPPDVANPKIRPKHLMTFGPYPRDPLPFPSVMVASRNDSFGEHAGDIANAWGSLLVDAGDAGHINTESGHGPWPEGSMVFAQFLSRLRA......... 184
7 -17.300[S] COG2830 Uncharacterized protein conserved in bacteria  ali follow..  10  1MKTKFYDYQGEHLILYFAGWGTPPDAVNHLILPENHDLLICYDYQDLNLDFDLSAYRHIR------------------------------------------LVAWSMGVWVAERVLQGIRLKSATAVNGTGLPCDDSFGIPYAIFKGTLENLTENTRLKDLIHWANAWVSSRDKIFTPANQHQYWALRCAVQEIEGEHYVFSRFTHWSALWDH.................... 215
8 -17.200[Q] COG3509 Poly(3-hydroxybutyrate) depolymerase  ali follow..  13  48LYKPVGLPSSAPLVVMLHGGFGSAKQAERSYGWDELADSEKFLVAYPDG-------------YHRAWNANGGGCCGRPAREGVDDIVRAVVADIANNVSID-VTGMSNGAIMSYTLACNTSI---------FAAIGVVSGTQLDP-------------QSPRPVSVIHIHGTADPLVRPVTTSGATCADNRRVVLDAGHRWP---SFATQTLWRFFAAHFR............. 280
9 -17.000[I] KOG4667 Predicted esterase  ali follow..  12  71LVGLLHETGSTDIVVLCHGFRSNKSIMNNVAAAIQKEGISAFRFDF-EGSF------------------------YYGNYNHEADDLHSVVQYFSNKNRVVIILGHSKGGDVVLLYASKYHD---------VRNVINLSGRYDLKMDRLSTDIHEACLKIDKECRVLTVHGSEDEVIPDAKEFAKIIPNHKLEIVEGNHGYTEHQSQLVSTVMEFIKTVIVKNN.......... 309
10 -17.000[R] KOG1454 Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily)  ali follow..  12  83.............VVLLHCFDSSCLEWRRTYPLLEQ---ACLETWAIDVL-------------------WGFSDLEKLPPCDAASKRHHLFELWKTYI----LVGPSLGATVAVDFTATYPEA--------VDKLVLINANAYSEGTGRLKELPKSIAYKHIDHKTLVVCSENDQIVQLSVKLLCELANAVLREVPDGHLPHVENPKIVKLISDFASG................ 326
11 -16.300[R] COG0596 Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily)  ali follow..  14  27.............IVLIHGFPLNGDSWEKQVLVL---LNAGYRVITYDRRGFGASSQPSSGY----------------DYDTFAADLHTLMTKLDLQNTV--LVGFSMGTGEVTRYLGKYGSER-------VQKAVLMAPVPPFLLKTNDNPEGVDQSVPRIDVPTLIIHGDADRILPTAARLPKRIKNSQLEIIPGPHAI-THADQVNPLLLNFLQ................. 276
12 -16.200[R] COG2945 Predicted hydrolase of the alpha/beta superfamily  ali follow..  13  19....PSKEKNAPIALILHPHPMNNKIVYDLFYMFQQRGFTTLRFNF-----------------RGIGRSQGEFDHGAGELSDAASALDWVQALHPDSKTC--VAGYSFGAWIGMQLLMRR---------PEIEGFISVAPQ---------PNTYDFSFLAPCPSSGLIIHGDQDKVAPDVQALVDKLKTQKKTIASANHFFTGQGEELIEECSEYLDRRLAGELVEARPKRL.. 223
13 -15.900[R] KOG4840 Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily)  ali follow..  25SNVTLTSNVTRSLLLFVGGLGDGLLTVPYVQELVNPLDEIGWSIVQVQ----------------QSSYIGWGTGSLKRDDEDLHKAVDYFLHIGGADFSTR-LMGHSTGSQNVLYYLTQSILPNY------LIAGIAQAPVSDREAAYQFNGKLKEISGSTAHSQLILLMSERDEFVSPSTDKAQLLNRLSGIIPGATHNV-SSPEALKWLINQLITALRSFIDQ......... 316
14 -15.700[R] KOG1552 Predicted alpha/beta hydrolase  ali follow..  16  84....RCSKNAKYTLLFSHGNAVDLGQMSSFYLTLGSQINCNIFGYDYSGYGMSGGKPS-----------------EKNLYADIEAAWQAMRTRFNISPETIILYGQSIGTVPTVDLASRHEVGAVILHSPLMSGLRVVFRNTKRTWFFDAFPSIDKV--AKVKAPVLVIHGTDDEVIDHGIGIYERCPKTVFWVEGAGHNDVELHPHYYERLRKFLSV................ 282
15 -15.500[R] COG4188 Predicted dienelactone hydrolase  ali follow..  12  59..PQRWKEGKTPVLVFSHGLASRPEDFDNAAEKMASY------FVVALPQHPGSDILQAQALLNRTSRQGYYPTEFIDRPKDISYVIDELERRNASEDRLNGVGGHSFGGYGALAVALTLPRSDYDFRDPRVVAVLAANPVNSAIFGVSGL--------HKVTVPVLLLGGSYDPATPFVLEQARSFPKYLTLMEGQAHVD--DPNLLHTYGSAVMVPFFQLYVAGDESFRPLV 340
16 -15.400[Q] COG3208 Predicted thioesterase involved in non-ribosomal peptide biosynthesis  ali follow..  12  5.....APMTLRPRLICLPPAGAGPSLFR----SWVQNSESIFDVVPVALP--------------------REAHFTKPLPRDIQSLADHVTNEIIGQAPY-ALFGYSMGAVVAYELLRHLSLRRLPLPD-----AFYILGSNAPDRVLEGREPIHSMTSEPVTFPVHVFVADADHLVSWKAAGACIGQDITMHGIEGSHML---PQAFAHFIGKLGQLWQTDQVQACAVSTR.. 252
17 -15.300[R] COG1647 Esterase/lipase  ali follow..  10  12.......EKGKRAVLLLHGFTGSSADVRILGRFLQEN---------CYAPQYRGHGVSPDLLLKTGPNDW---------WEDVLAAYDHLKSLGYTE-----VAGLSLGGLFSLKLGFSRPLKGIIAMSTPTRMVAYKDAPMNTIAKLKDEINGVVSEIDMIYAPIMVVQGEKDDMVSGAQLIYDTVESTKHWFKESGHVI-TLDKERKDVNQAILTFLDSLDWQE........ 248
18 -15.200[R] KOG4409 Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily)  ali follow..  11  150CESEQPIVKAKYPIVLIHGFGAGVALWGSAI----KRLAQFQTVHAFDLPGFGRSSRP---------------KFSSDPETAETEMIDSIEQWRDKMN----LVGHSFGGYLATSYALKYPKR--------VENLILADPWGFNEMDPAKQPMSKRFHELDNTVPVTFIHGERSWIWRTTRRLFGELEHVESHIMDSGHHVYADDADFVQLVIGSLKDGKTGELVPEEVNLE.. 437
19 -15.200[Q] COG0412 Dienelactone hydrolase and related enzymes  ali follow..  12  68HARPKQSDGPLPVVIVVQG-------VHEHIRDICRRLALEGYLAIAPELYFREGDPNDFADIPTLLSGLVAKVPDSQVLADLDHVASWASRNGGDVHRL-MITGFCWGGRITWLYAAHN---------PQLKAAVAWYGKLTGDKSLNSPKQPVDIATD-LNAPVLGLYGGLDNSIPQEQALRAANAKAEIIVYPDGHAF--HAASAEDGWQRMLEWFKQYGGKKS....... 292
20 -15.100[R] COG4814 Uncharacterized protein with an alpha/beta hydrolase fold  ali follow..  12  28.TTYPKAANDAIPTIFIHGYRGTDRSLHGMIRRFDQKYNWGTESLTVNVSPDGSISTGTYSKNEKNPLINIVFEDNRATLPQQSMWTKKIMSYLQKNYDIK-AIGHSMGGGAWVSYL---ASYEKNKSYPQVNKIVFLAVDIKNANNVHAKFAQKMAKVLPDNTEIMIIGGNSDGEVKLNSVLYQKVITHVIKGPKATHSSMHESTVVDKYVGQFL.................. 269
21 -14.300[Q] COG3458 Acetyl esterase (deacetylase)  ali follow..  11  73LLVPKLEEEKLPCVVQYIGYNGGRGCFVMDTRGQGSGWLKGDTPDYPEGPVDPQYPGFMTRGILDPRTYYYR-----RVFTDAVRAVEAAASFPQVDQERIVIAGGSQGGGIALAVSALSKKLVDTHPYAEITNFLKTHRDKEEIVFRTLSYFDGVNFAARAKIPALFSVGLMDNIPSTVFAAYNYYAGPKRIYPYNNHEG-GGSFQAVEQVKFLKKLFEKG............ 325
22 -14.100[U] COG3946 Type IV secretory pathway, VirJ component  ali follow..  13  254EVPSKAQKKSDTFAIFVSGDGGWAEIDKKVAGHLADA---DIPVVGLDSL------------------YFWSERTPEGFAKDLDRIARFYAHHWKRN-----LVGFSQGADVLPAAINKLSPNTR----QIIRMTALLSLGKYAHYEFHEGIPIAPDMVKLRSTRTVCIYGVDD----QETLCPSLPQQNRRVALPGTHHF---NGDYETVAKTILAQMEAA............ 451
23 -13.300[R] KOG4391 Predicted alpha/beta hydrolase BEM46  ali follow..  10  98.LCSMSVSWDTLSCYDLDLRIPDIAHRLEMVRIMIQKLKCNVFMLSYRGYGASEGYPSQQGII-----------------KDAQAALDHLSGRTDIDTSRIVVFGRSLGGAVGAVLTKNNPDK--------VSALILENTFTSILDMAGVLL-KTIDAIAEIKQPVLFLSGLQDEMVPHMKMLYAKAAARNVEFPSGMHM--SGGEVYWKTNLQFLEKYAPEKRKEDTGKMI.. 337
24 -12.800[IO] KOG2541 Palmitoyl protein thioesterase  ali follow..  10  15AFLAKVDISVSVPFIMLHGIASQCSDDTNANFTQLLTNLSGSPGFCLE------------------------NGVINSMFLPLTQQAEIACENVKEMKELSQIVGRSQGNLVARGLI------EFCDGGPPVFNYISLAGHLAPSGYYKIPNDMKQYLERSKYLPKLNVKFQDDEVITPNDSLKTLDDAGKVKFVPGGH-VRMAEEDVVKYVVPYLQNQQPAAQSFNRKTKEPL 291
25 -12.100[V] KOG1515 Arylacetamide deacetylase  ali follow..  14  157.SSSGGNSRKLPVMLQFHGGG--GSNDSVANDFFCRRMAKHCDIIVLAVGYRLAPENRYPAACEDGFKVLKWLGKQANLAECNKSMGNLVEPWLANHADPSVLLGVSCGANIADYVARKAIEVGQNLDPVKVVAQVLMYPFFIGSVPTQSEIKQANSYFYDKPMPTLTIVAEHDWMRDRAIAYSEELRKVPVLEYKD-HRTPQAQACAEDIAIWAKKYISLRGHEFS....... 459
26 -11.900[E] KOG4627 Kynurenine formamidase  ali follow..  11  69VFYSEKTTNQAPLFVFVHGGYWQEMDMSMSCSIVGPLVRRGYRVAVMD--YNLCPQVTLEQL-----------------MTQFTHFLNWIFDYTEMTKV---FAGHSAGAHLLAQILM-RPNVITAQRSKMVWALIFLCGVERNIESVSPMLWEYTDVTVWNSTKIYVVAAEHDSFIEQSRHYADVLRKSFTLFKGYDHFIEETAIDDSDVSRFLRNIEIE............. 300
27 -11.900[E] COG1506 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases  ali follow..  11  421.....ECSGCLPWILYIHGKTSYGYAFIHEFQMLA---SQGFAVIYSNPRGSDGYSEEFADLRGRYG-------------DDYSELMKVVDEALSDFPQLDGVTGGSYGGYMTNVIVTKTRRFKAAVTQRSCSNWISFYGESPWRDLEKYVDFSPLFSVENIETPLLIIHSTEDF-LSGAIQLFTALKETRLLVFPGNHNLSRSGTPKRRVLRAIASWFKEHLGSQQRG..... 659
28 -11.600[I] COG0657 Esterase/lipase  ali follow..  10  63...SPRFLMVGHAVLYAHGGF-SPMASRALCASLADEVGKFYIPAYQLAP-------------------------EHPFPAALENMYDAYVALIDQKK----FSGDGAGAGLMLALTHYLKQKGLVCPRALALISLTEDRFAGEGVKKKELLLTRDMFRYCALQPVFVQCGEQELFHTDACALAQILEGAGVVWPGMWHVSPCAHIAVARMGAWAHRMLESPAIAVQSLELR.. 312
29 -11.300[R] COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold  ali follow..  12  62WSEAPAQAQHKPRLVVFHGLEGSLNSPYAH-GLVEAAQKRGWLGVVMHFRGCSGEPNRMHRIYHS----------------GETEDASWFLRWLQREFGHAPTVGYSLGGNMLACLLAKEGNDLPVDAAVIVLITARIHGYADAIDYYRQCSAMPML--NRIAKPTLIIHAKDDPFMDHQVIPKPESLPPQVLTEHGGHTLLHPQMWLESRIPDWLTTYLEAKS.......... 339
30 -11.200[R] KOG3043 Predicted hydrolase related to dienelactone hydrolase  ali follow..  11  35...AGSTSPKEKVIVILT------DVYGNKFNNVLLTADKFASAGYMVFVPDILFGDAISSDKPIDRDAWFQRHSPEVTKKIVDGFMKLLKLEYDPK----GVVGYCFGAKFAVQHISGDGGL-----------------ANAAAIAHPSFVSIEEIEAIDSKKPILISAAEEDHIFPANEKLKDNHATYQLDLFSGAHGFPAVKYAKEKVLLDQIYWFNHFSN.......... 245
31 -11.000[I] KOG1455 Lysophospholipase  ali follow..  82...PVDSAKNRGLVVLLHGLNEH------RYSDFAKQLNVNGFKVY-----------------GIDWIGHGGSDGLHAYVPSLDYAVADLVIAENPGLPC--CIGHSTGGAIILKAMLDAKIEARVSGIIFGVIAPFLSFLIPRYQLSAAKKKIMPVSRDPIKVPFLVMHGTADTVTKGTQKLYNEASDKSIKLYDGLHDL-LFEPERETIAGVILDWLNRRV........... 333
32 -10.900[R] COG4099 Predicted peptidase  ali follow..  218.DKNYSPDKAWPLVLFMHDAGATSDVTRTTLYQWASPEDQAQRPCFVLAP-----------------QYEEIIADDDSKTSDMLDTTIDLINVLSEQYNID-ATGQSGGCMMTIAMNIKYPD---------FAASFLVAGQ------------DPALVKPLAQQKLWILVSQDDNKWPGQNAIIDVLEKE............................................ 381
33 -10.700[R] COG4757 Predicted alpha/beta hydrolase  ali follow..  10  24....PADTALKGRLVVAGATAVPQGFYRRFAQFAGTRGFETLTFDY-RGIGQSRPPSLHGLRT--------------DFLDWARLDLAAAVDTMADGAVPLYVVGHSYGGHAFGLLPNHRKVAGFCVFGTGAGWLTWWKGYCPWKMLGLGEDLPVGVYRQDVRTPIVAVNALDDLWAPPADAFMQGYRNAPLIGGKVGHM---FRQAGEPLWERMLGWFSSLPRTTATR..... 290
34 -10.600[R] KOG1838 Alpha/beta hydrolase  ali follow..  138VNASNPGTDRTPIAIIVPGLTSDSSAAYIK-HIAFRLAKEGWNVVVQNHRGLGGISLTSDCVYTA----------------GWTEDLRKVIAHIHSQFPEAPLVGTSIGANVLVKYLGEDGPNTPLIGATAVYATRLVAKFETTDTYYRRSSSSQYV--ENVAVPLLCISALDDPVCTREAIPWDECRANKATTTHGGHLLTASSMWWTRVVHEYFEVLLSSPFADRRH..... 419
35 -10.600[R] KOG2564 Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold  ali follow..  54IYRTKQPEKPGPVLLLLHGGGYSALTWAHFCSEVTSMIHCQCLCIDMRGHGDSKVDDE-----------------DDLSADTLAKDIGDLILKLYPEE----VVGHSMGGAIAVHFAHMDDAADGSSESAAAGADFKKPNTTKSTTEAAKNYTWRIDLSKSEKYWVGWFSGLSDKFLNLRLPKQLLLASQMQVLARCGHAVHEDRPHVAEVISGYLIRNRFAEAASE....... 394
36 -10.400[R] KOG2382 Predicted alpha/beta hydrolase  ali follow..  11  30.....NMRSKGTPLILVPGLFGTKENWIQVGKDLSQRLGCMVFAVENRNHGSFSKAASM-------------------TYEEMADDLVGFIDWVRKITGED-LHGHSMGGKAVTQLATTPEYSSRIKS-------LIVEDMSPLGYPLKRAEYLECIKQGVFDGPTLFQRAPGSGFLPAANRVEKMFPMVQFAETAWNHWIHADDP------KFFVDSICEFLEEPDQLGMR.. 294
37 -10.300[Q] COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases  ali follow..  13  1.....RAGGSRPPLFLVHPLGGHVLCY----LPLVRALPPDQPVYALQAAGTGQGSTPLAVL------------------EDIAASYLAAIRRVQPEGPY--LGGWSFGGFVAYEMARQLRALD.............................................................................................................. 96
38 -10.000[I] COG2267 Lysophospholipase  ali follow..  26...PALQPGAKKVIVLFHRGHEHSGRLQHLVDELAMP-----DTAFYAWDARGHGKSS--------------PRGYSPSLARSVRDVDEFVRFAASDSQVGLVIAQSVGAVLVATWIHDYAPAKVKLYVPLARPALALWHRLRGLFFINSYVKGRYLTHDRITLPTQLLISGDDYVVHPQIDFYQRLPLKELHLLPGFHDT--GEENRALAFEK.................... 274
39 -9.930[S] COG4947 Uncharacterized protein conserved in bacteria  ali follow..  11  26MEYKRYGHAGRPVVVFPTSQGRFYQFEDSGGVGALAEFIDTGRIQLF-------VDGIDSESFFDKHADTAHRIGRHEAYFRYEEALPEILSTASGRKLKPLFSGCSMGGYHSSNFVFRFPEL--------ASGVISLSGVYSARDFFGKVLDGDIFYNSPLKALRLIFCGQEERMLVETRQLEQILRDKSIWGGDVSHDWPWWHKQLVYFFGRWLDD................ 260
40 -9.800[R] COG0627 Predicted esterase  ali follow..  10  71......GGANSPALYLLDGLRAQDDFSGWDINTTAFEWYYQSGISVV---MPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQYLQSNKQIKPTGSAAVGLSMAGLSALTLAIYHPDQ--------FIYVGSMSGLLDPSNAMGPSLIGLAMGDGTLIANNTRIWGNGKPVRTSNIKFQDGYNAGGGFPDSGTHSWEYWGEQLNDMKPDLQQYLGATPGA......... 330
41 -9.730[S] COG4782 Uncharacterized protein conserved in bacteria  ali follow..  177LNTTVSKSPDRSVLVFVHGFNNRFEDSVYRFAQIVHDSGIKSAPVLVTWPSRGSLLA---------------YGYDRESTNYTRNALESLFQYLAEDGEVKEVLAHSMGNWLTLEALRQMAIRNDGLPAK-----VMLAAPDVDVDVFRSQIEDMGSQHPRFTL----FVSRDDRALAFSRRVITVIDLTKVKAGDGHHGKFAESPEVVRLIGARISEGQPLTDSRMGLGDH.. 415
42 -9.710[O] KOG2100 Dipeptidyl aminopeptidase  ali follow..  11  569..YNRDKHQAIPLIVHVYGGPNDQNTKEATQIGIEEVVASASQAAILRIDGRGSGGRGWK---------YRSAIYGQLGTVEVEDQIKAIKVVLRLYRHL-AVFGWSYGGFMTLSMVNEAPEQ--------FKCAVSVAGDAPLESYSDVTKKLDNFKSTRLLL--MHGLLDDNVHFQNSAILIDELQNRLMVYPNQAHSLSSRTSHVVGKMTHFLRQCFYTDK.......... 799
43 -9.450[P] COG2382 Enterochelin esterase and related enzymes  ali follow..  11  158FTTGDATAEERPLAVLLDGWAQSMPVWPVLTSLTHRQQLPPAVYVLIDAIDTTHRAHELPC-------------NADFWLAVQQELLPLVKAIFSDRADRTVVAGQSFGGLSALYAGLHWPER--------FGCVLSQSGS-PHRGGQQEGVLLEKLKAGEVSAEGLRIVGIREMIMRANQALYAQLHPIFWRQVDGGHDALCWRGGLMQGLIDLWQPLFHDRS.......... 374
44 -9.140[R] COG4287 PhoPQ-activated pathogenicity-related protein  ali follow..  116DIYIPETAKEHHALVVVNNGINYDKSISRDTNTIVISVSDNQYLTFQDDKKPLKEDESVSRSWALFMEAPEQRKLMPLNIPMVTAISQAMRLAKKELTQWNIITGISKRGWTTWLSAIADPD---------VEAIVPFAIDLLDIDASLEHIYQSTIYQPRLAIPKYIINASGDDFPDNTRFYYSKLPGVKSLR-NMNHYS--INQFAEGSLVPFINRFQSKKT.......... 395

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 5 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Lesley SA, Kuhn P, Godzik A., Deacon AM, Mathews I, Kreusch A, Spraggon G, Klock HE, McMullan D, Shin T, Vincent J, Robb A, Brinen LS, Miller MD, McPhillips TM, Miller MA, Scheibe D, Canaves JM, Guda C, Jaroszewski L, Selby TL, Elsliger MA, Wooley J, Taylor SS, Hodgson KO, Wilson IA, Schultz PG, Stevens RC. Structural genomics of the Thermotoga maritima proteome implemented in a high-throughput structure determination pipeline. Proc Natl Acad Sci U S A. 2002 Sep 3;99(18):11664-9. Epub 2002 Aug 22.