current user: public

If you have questions about the server, please let us know.

Query: [O] KOG2930 SCF ubiquitin ligase, Rbx1 component, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst MEVDEDGYEVPSSSSKGDKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWDFQKYGHLast
1 -52.300[O] KOG2930 SCF ubiquitin ligase, Rbx1 component  ali  100  1MEVDEDGYEVPSSSSKGDKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNREWDFQKYGH 108
2 -44.100[OD] COG5194 Component of SCF ubiquitin ligase and anaphase-promoting complex  ali follow..  60  8MDVDEDESQNIAQSSNQSAKRFEIKKWTAVAFWSWDIAVDNCAICRNHIMEPCIECQPKAMTDTDNECVAAWGVCNHAFHLHCINKWIKTRDACPLDNQPWQLARCGR 121
3 -35.100[DO] KOG1493 Anaphase-promoting complex (APC), subunit 11  ali follow..  25  31.LHTMQDDHPGILLKTNTRMSITVKKLHVCGEWKWLGGEDTCGICRMEFESACNMCKF-----PGDDCPLVLGICRHAFHRHCIDKWIAAPTQCPLCRQDWTIVE... 135
4 -29.200[O] KOG0800 FOG: Predicted E3 ubiquitin ligase  ali follow..  15  51......SSDLSSLGMRTTFIPGNSLSTIELGLSKELREMLPIVVFKESFTVMDSQCSVCLGDYQPNDKLQQIPVCKHTFHMDCIDLWLTSHTTCPLCRLALIPSR... 149
5 -25.700[O] KOG0828 Predicted E3 ubiquitin ligase  ali follow..  22  695.....................................HTVDCAICMSDVPIYIEEIP---ETHKVDQHSYMVTPCNHVFHTSCLENWMNYKLQCPVCRSPLPP..... 757
6 -24.200[O] KOG3970 Predicted E3 ubiquitin ligase  ali follow..  17  51.....................................................PNCSLCKTTLAEGDTIRLN--CLHLLHWKCFDEWAANFPRCPCCSQEVFPPI... 108
7 -23.100[O] KOG1734 Predicted RING-containing E3 ubiquitin ligase  ali follow..  18  271................TARMASRIGYYTPEGLPKKHLEDGVCAVCGGRLHVHDADAVVTTKMVEDEDEKLYKLSCGHVFHEFCIRGWVVKLQTCPYCKERVDLQRM.. 366
8 -22.700[O] COG5243 HRD ubiquitin ligase complex, ER membrane component  ali follow..  14  308LALYQSGTSLWKIWRNNKQLDDTLVTVTVEQLQNSANDDNICIICMDELIHSPNQ-----QTWKNKNKKPKRLPCGHILHLSCLKNWMERSQTCPICRLPVFDEK... 407
9 -22.200[O] COG5540 RING-finger-containing ubiquitin ligase  ali follow..  31  311.............................................STRRATFGVECVICLESFTKGDKVVALP-CKHEFHRPCIAKWIDYRHACPTCNTEVPPPK... 370
10 -22.000[O] KOG0801 Predicted E3 ubiquitin ligase  ali follow..  14  165....................................LSKPRLSYNDDVLTKDAGECVICLEELLQGDTIARLP-CLCIYHKSCIDSWFEVNRSCPEHPAD........ 227
11 -21.300[O] KOG4628 Predicted E3 ubiquitin ligase  ali follow..  19  213.................................SMLKKLPVLRYTKNNANNKYDTCVICLEDFIEDDKLRVLP-CSHPYHTHCIDPWLTENRVCPICKRKVFTKG... 284
12 -20.800[O] KOG0827 Predicted E3 ubiquitin ligase  ali follow..  20  4.....................................................LNCVICAELFGQADEVFATV-CGHMFHHNCLNQWLDRSKTCPQCRNKCTTRNIFR 57
13 -20.800[S] KOG4445 Uncharacterized conserved protein, contains RWD domain  ali follow..  18  106......................................................QCVVCLYGFADGDEFTRTE-CFHYLHSYCLARHLNALRLCPVCREHIGDE.... 177
14 -17.900[O] KOG0317 Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein  ali follow..  24  276.............................................LPFIPEASRKCILCLMNMSDPSCA----PCGHLFCWSCLMSWCKERPECPLCRQHCQPQEI.. 332
15 -17.700[O] KOG3268 Predicted E3 ubiquitin ligase  ali follow..  19  298..............................................LEKSDFTMDCGICYAYQLDGTIPDQVSQCGQPFHQICLYEWLRGLLTCPYCSKPITLKMSGR 373
16 -17.100[O] KOG0802 E3 ubiquitin ligase  ali follow..  23  344........................AALPDATSEELRAYDDECAICREPM-----------------AKAKRLH-CNHLFHLGCLRSWLDQGYSCPTCRKPLFVGR... 410
17 -16.600[O] KOG0826 Predicted E3 ubiquitin ligase involved in peroxisome organization  ali follow..  22  243......................................................ECPVCLLSIQTP---TACSVSGYVFCWKCIVSHMKEHGTCPVTHYPISLDDL.. 291
18 -16.300[O] KOG0824 Predicted E3 ubiquitin ligase  ali follow..  15  2.................................NASTSSPSQQLQQAINSTIDKECAVCYSEMIL---PTTIPSCGHKFCFICLKGSVSNNGDCPICRGPIDSQIFKK 74
19 -16.200[O] KOG1645 RING-finger-containing E3 ubiquitin ligase  ali follow..  50VQEEDEEEEEEEDSERQTREYIDVLDSPVRVSQNESEGIENQNRRMSNGNKVTLRDCLVLSVWKFGPAVANT-KSGILDSIVFPVDTCMSTSGFSSDEVEGSLRDV.. 158
20 -16.000[O] KOG3800 Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor  ali follow..  17  2......................................................ECKKCKSNYTNKQLVMMINECGHPLCKNCVDNIFALNSNCHVCNRVLRKNNF.. 55
21 -15.800[O] KOG0320 Predicted E3 ubiquitin ligase  ali follow..  22  265......................................................KCPICMDSVSKREPVST--KCGHVFCRECIETAIRATHKCPICNKKLTARQF.. 314
22 -15.100[O] KOG1813 Predicted E3 ubiquitin ligase  ali follow..  16  267.............................................DEDENALPFACFICREPFVDP----VVTKCKHYFCEHCALKHHTKNKKCFVCNQPTM...... 319
23 -15.100[R] COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers  ali follow..  15  244.............................................NEKKEDIPFVCLICKKDYRSP----IATTCGHHFCEQCAITRYRKTPTCIQCGADTK...... 296
24 -14.700[O] KOG0823 Predicted E3 ubiquitin ligase  ali follow..  17  115......................................................DCNICLEKAEDP----ILTCCGHLFCWGCFYQLPLIYLECPVCDGEVTDAEV.. 165
25 -14.700[O] KOG4159 Predicted E3 ubiquitin ligase  ali follow..  29  8......................................................................VTTPCGHSFCKNCLERCLDHAPYCPLCKESL....... 38
26 -14.400[U] KOG2066 Vacuolar assembly/sorting protein VPS41  ali follow..  11  706NHAELQQCCYDSTLNDLNVLTQGLISAADESV---VNIVSRCSLCAQIIINSNQETTKKFSDI-------KVFKCGHIFHLACSTS--IEEGLCIACSDQIELINV.. 807
27 -14.400[A] COG5183 Protein involved in mRNA turnover and stability  ali follow..  15  1MDVDSDVNVSRLRDELHKVANEET---DTATFNDDAPSGATCRICRGE---------------ATEDNPLFHPKCRGSIHESCLLEWVASKNICDICHYPIQFKTI.. 102
28 -14.100[B] KOG4718 Non-SMC (structural maintenance of chromosomes) element 1 protein (NSE1)  ali follow..  17  162......................AILEMEQYIRETYPDAVKICNICH-SLLIQGQSCE----------------TCGIRMHLPCVAKYFQSNPRCPHCNDYWPHE.... 228
29 -14.000[T] COG5432 RING-finger-containing E3 ubiquitin ligase  ali follow..  20  1MDHQITTASDFTTTSIPSLYQLD--------------TLLRCHICKDFLKVP------------------VLTPCGHTFCSLCIRTHLNNQPNCPLCLFEFRESLL.. 74
30 -14.000[L] KOG0287 Postreplication repair protein RAD18  ali follow..  20  1MDHQITTASDFTTTSIPSLYQLD--------------TLLRCHICKDFLKVP------------------VLTPCGHTFCSLCIRTHLNNQPNCPLCLFEFRESLL.. 74
31 -13.700[O] KOG2879 Predicted E3 ubiquitin ligase  ali follow..  288............PLLNSSAVKNILSPFAKDKSSSTKEDTVTCPICQVDPAIP-FIALPCQHSMCCSCYIHLKELTCRRYCYYCIRTRCASAARCLRCNEPVVAIQ... 381
32 -13.600[O] KOG0978 E3 ubiquitin ligase involved in syntaxin degradation  ali follow..  24  845.....................................................LKCGVCFDRPKE----VVIVKCYHLFCQQCIQRSLEIRHKCPGCGTAFGQNDV.. 894
33 -13.400[R] COG5219 Uncharacterized conserved protein, contains RING Zn-finger  ali follow..  22 1482YNVDEHKLEMAIKIPSVPLQNVQVEGIERVGV-SWILASQSILSSQNGSITDALECAICYSVLSVERTLKRCGTCRHKFHASCLYKWFKSSSRCPLCRSSFTF..... 1609
34 -13.000[L] COG5627 DNA repair protein MMS21  ali follow..  17  194.....................................................NRCPLTLQPIVH---PILSTACNHFYEKDAILSLLNPTCVCPVCEARLQRSLL.. 245
35 -12.900[R] KOG2979 Protein involved in DNA repair  ali follow..  13  195.KLKATPSSVPQNDHLMRQFREAVWNVHHAGEPMPGDDDEDIVMTSTQCPLLNMTCPLSGKPVTELADPVRSMDCRHVYEKSVILHYIVNNPNCPVCRGKLQNSKV.. 303
36 -12.800[O] COG5574 RING-finger-containing E3 ubiquitin ligase  ali follow..  24  358.....................................................FECAICSNVAYKP----VRLGCSHVFCLHCLIILQKQKVFCPLCRAKEVMKA... 406
37 -12.700[DKL] COG5220 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3  ali follow..  17  1...........................................MDDEGARKVDEKCPLCQADRYLNPNMKINPECYHKMCESCVDRIFTTGPATPGCNKILRKAKF.. 68
38 -12.700[U] KOG2034 Vacuolar sorting protein PEP3/VPS18  ali follow..  14  803KQIEQLKEEMNDATRGADNIRNDISALTQRYA---IDRDEECGVCKRKILMMSGDFRMAQGYSSAGPLAPFY-PCGHSFHAQCLITHVTSASECPFC........... 952
39 -12.600[O] KOG1039 Predicted E3 ubiquitin ligase  ali follow..  22  234.....................................QDKVCSICME---------VILEKASASERRFGILSNCNHTYCLSCIRQWRCAKQSCPECRVI........ 294
40 -12.500[O] KOG4692 Predicted E3 ubiquitin ligase  ali follow..  11  430LNDFPSHVSSEEIDNVRRLIDSLRVKQTLLSDITLPSEDSLCPICCAKPIT------------------AVFTPCKHQSCSDCIMQHMMNSKVCFYCKTTIQ...... 513
41 -12.400[U] KOG2114 Vacuolar assembly/sorting protein PEP5/VPS11  ali follow..  20  804KIIEEDRRAVEKYQETTKNMRKEIEDLRTNAR---IFQLSKCTACTFTL-----------------DIPAVHFMCMHSFHQRCLG---DNEKECPECAPE........ 880
42 -12.200[O] KOG2164 Predicted E3 ubiquitin ligase  ali follow..  15  208.................................................DFQLAACPFCL---EEKPVAARMSRCGHVYCFSCLLRFVETPTACPICWDSIRLRDV.. 281
43 -11.900[O] KOG1571 Predicted E3 ubiquitin ligase  ali follow..  12  253....RKRKQEREEAKIRERLDTERRERRARSRPHTLSQDQLCVVCS------------------TNPKEIILLPCGHV--CLCEDCAQKISVTCPVCRGSIV...... 330
44 -11.900[K] KOG1244 Predicted transcription factor Requiem/NEURO-D4  ali follow..  18  294........................................SCSDCGRSGHPSCLQCNICGTS-ENDDQLLFCDDCDRGYHMYCLTSW-----SCHLCL.......... 375
45 -11.700[S] KOG4638 Uncharacterized conserved protein  ali follow..  13  342.............TALKALSRKEVHYGSYATTEQATCVPSARRRCTPQFFFAANTCFAK-----------IAFQSGEVFLHIAIIFVYE................... 406
46 -11.600[R] COG5222 Uncharacterized conserved protein, contains RING Zn-finger  ali follow..  15  288.....................................................LKCPLTGGLLR--QPVKTSKCCNIDFSKEALNALVESDFVCPNCETR........ 333
47 -11.600[S] KOG3899 Uncharacterized conserved protein  ali follow..  15  296...................................DATTEKCFACMLNEPNTKIQCADFDRNGAPLANGACCSNCRPMWCVECLEVWLEQKCTCPMCRAKFCVLDV.. 383
48 -10.800[O] KOG4265 Predicted E3 ubiquitin ligase  ali follow..  15  277......................................................ECVVCLSDLRD----TLILPCRHL--TSCADTLRYQANNCPICRLFPG...... 321
49 -10.700[O] KOG2817 Predicted E3 ubiquitin ligase  ali follow..  16  341.......................................................CPVSKEQATEENPPMMMS-CGHVIVKESLRQLSRNGSKCPYCPNENVAADAIR 395
50 -10.700[R] COG5109 Uncharacterized conserved protein, contains RING Zn-finger  ali follow..  16  341.......................................................CPVSKEQATEENPPMMMS-CGHVIVKESLRQLSRNGSKCPYCPNENVAADAIR 395
51 -10.500[A] KOG1609 Protein involved in mRNA turnover and stability  ali follow..  13  11ISSNSSLSLASTQVQSPEKPVRPAWLLASFSESTTSGSRRICRICQMHEGDMVRPC-----------------DCAGTMHEECLTKWVNMSNKCEICKSEYTNSG... 103
52 -10.400[DR] KOG4739 Uncharacterized protein involved in synaptonemal complex formation  ali follow..  15  4.....................................................IQCNHCGIKPNQTK---YLTACGHVFCQNCTKAA--FNSQCYLCKKPLKVDEINK 54
53 -10.400[R] KOG4299 PHD Zn-finger protein  ali follow..  27  262.....................................NNDYCSACHGPGNFLC--CE----------------TCPNSFHFTCIDAWY-----CNECKHH........ 312
54 -10.200[R] KOG4323 Polycomb-like PHD Zn-finger protein  ali follow..  12  139.DLDVAEGAEDDLQEDFHVEGMKTKSGRKIQRPVAYNPNATALKRKSRKVDMVTLCSVCQRHSPLSNRIVFCDGCNSPYHQLCHHEWF-----CMKCQYR........ 246
55 -10.100[T] KOG3842 Adaptor protein Pellino  ali follow..  14  327...................................DGKDRECPMCRSVGPYVPLWLGCEAGFYVDAGPPTAFSPCGHVCSEKTTAYWSQ-HAACPFCAHQLAGEQ... 406
56 -9.730[R] KOG3005 GIY-YIG type nuclease  ali follow..  19  359........................................................................ATCPSHFHSKCLSE-YPLKANCPTCGQFYLWGDIIR 406
57 -9.600[S] KOG0396 Uncharacterized conserved protein  ali follow..  13  337.......................................................CRVTGLPLNEHNQPMMLP-NGQIFGQMALPDITKDDGTCPVTNTKFSNPKVEK 390
58 -9.490[B] KOG1973 Chromatin remodeling protein, contains PHD Zn-finger  ali follow..  17  237.KGGAQKKTVEVDDSEKESCHTAATHPSDVMDMPVDPNEPTYCLCHQVSYGEMIGC-------DNPDCPIEW------FHFACVGKWF-----CPKCTQDRKKK.... 328
59 -9.480[S] KOG2660 Locus-specific chromosome binding proteins  ali follow..  15  6.............................................KKETMRACLSCSICDNILRD----------ATTISEKCIYEKITEDEICPVCNIDLGSTPL.. 58
60 -9.450[O] KOG4172 Predicted E3 ubiquitin ligase  ali follow..  24  11......................................................ECTICMDAPVN----SVLYTCGHM--FECGRRLLTTKGTCPICRAPVQ...... 55
61 -9.300[B] COG5034 Chromatin remodeling protein, contains PhD zinc finger  ali follow..  15  210.STERRPVRRSESRLKQTNGEPLVKHDTLDSSDISREGEQLYCYCQQVSYGQMIGC-------DNENCKREW------FHLPCVGIWY-----CKECEELAKSSESRQ 305
62 -9.300[C] COG0723 Rieske Fe-S protein  ali follow..  16  141........................................................QTDADRVKDPQWLIMLGICT---HLGCVPIGEAGDFGCP-CHGS-HYDISGR 190
63 -9.200[R] KOG3002 Zn finger protein  ali follow..  16  3.PGGSALKEALESNSTGVDYEVKMAKVEANSKPTKSGSGSIGKFHSSNGVYELLECPVCTNLMYPP-----IHQCPNG-HTLCSSCKLRVQNTCPTCRYELGNIR... 100
64 -9.170[O] KOG4275 Predicted E3 ubiquitin ligase  ali follow..  22  649.....................................TDELCKIC-------------------DAPIECVFLECGHM--ATCTS---KVLNECPICRQYIV...... 692
65 -9.020[C] KOG1671 Ubiquinol cytochrome c reductase, subunit RIP1  ali follow..  20  199........................................................QHDLDRVKKPEWVILIGVCT---HLGCVPIANAGDFGCP-CHGS-HYDASGR 248
66 -9.010[O] KOG1100 Predicted E3 ubiquitin ligase  ali follow..  13  247.ADDAQSCCGSNDEGDSEEERWKLAGEAQDTKKMCRVGMSMCRSCG------------------KGEASVLLLPCRHM--SVC-----SSLNTCPICKSPKT...... 326

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 6 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.