current user: public

If you have questions about the server, please let us know.

Query: [R] KOG3062 RNA polymerase II elongator associated protein, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .
# Score Template Links and tools%idFirst MPLVVITGLPASGKSTRARQLRDHFVERGRKVHLISENEAVPKAGFGKNSHTGDSQKEKVVRSDLKSEASRHLNQEDLVILDAGNYIKGYRYELYCMSKVSRTTQCTVFTCIPQEEAWTFNSQRTAPDELPGDSERVQPVDNSDVPYTRETFDALCQRYEEPQSNNRWDSPLVVVLPKDTLDMEAIYKALYESQPLPPNQSTYNAPLGTTNYLFELDKIVQAIIKEILGAVKIKAFGQLRIPGSRNPVKVATSMNALQLNRLRQKFITSTCHASQTSPTPLEQVPHLFVQFINANTIGCLast
1 -106.000[R] KOG3062 RNA polymerase II elongator associated protein  ali  100  1MPLVVITGLPASGKSTRARQLRDHFVERGRKVHLISENEAVPKAGFGKNSHTGDSQKEKVVRSDLKSEASRHLNQEDLVILDAGNYIKGYRYELYCMSKVSRTTQCTVFTCIPQEEAWTFNSQRTAPDELPGDSERVQPVDNSDVPYTRETFDALCQRYEEPQSNNRWDSPLVVVLPKDTLDMEAIYKALYESQPLPPNQSTYNAPLGTTNYLFELDKIVQAIIKEILGAVKIKAFGQLRIPGSRNPVKVATSMNALQLNRLRQKFITSTCHASQTSPTPLEQVPHLFVQFINANTIGC 299
2 -80.000[F] COG4088 Predicted nucleotide kinase  ali follow..  32  1MPLIIVSGYPSSGKTTRSNELKKALEDRIHQNIDNTKD-INDESLNIEKETYRESKNEKAARGLLYSAVQRELSKSTFVICDALNYIKGFRYQLYCESKSMYTTHCVIHVAVPQDLCRKFNSNKEQP-------------------YPDDVLEQLMFRYEEPNGMTRWDSPLFTVLHDDACPIDDIWSVLIHNKNVKPNQATMVKPPAEVNYLYELDKTTQDVIMLILDNSNDTSLITVPGSKLQIALP-SVTVSLPLLQRLRRQFIQINRQQSY----NTNVLKEMFVEFLNGQFET. 279
3 -66.800[R] KOG4622 Predicted nucleotide kinase  ali follow..  17  18RGLCVLCGLPAAGKSTFARALAHRLQQEGWAIGVVAYDDVMPDAFLAGARARPAPSQWKLLRQELLKYLEYFLSRPLFLVLDDNFYYQSMRYEVYQLARKYSLGFCQLFLDCPLETCLQRNGQRPQA-------------------LPPETIHLMGRKLEKPNPKNAWEHNSLTIPSPACASLLTALENPVKYAEDNMEQKDTDRIICSTNILHKTDQTLRRIVSQTMKEAKDEQVLPHNLKLLAEELNKLKAEFLEDLKQGNKKYLCFQQT------IDIPDVISFFHYEKDNIVQK. 352
4 -33.000[R] COG0645 Predicted kinase  ali follow..  15  3..LAVTHGVSAVGKSQVAMRLVEAL-----GAVRLRSDIERKRLF-QFAAGIYSSQASEATYAHLHQLAAKILQAGYPVVIDAAYLKQNQRQAACHIAEETGVPFLILDCQAPEAVIAGWLAQRQAEGKDPSDA-------------TLDVIRTQQATREPLTAAE--TVQSKRVDTHDAASLDGLVDGIRQ........................................................................................................... 180
5 -30.800[R] COG4639 Predicted kinase  ali follow..  20  10..LVVLIGASGAGKSTFARKHFQ-------PFEVISSDFCRGLVSNDEN----SQSASRDAFDVLHYITTKRLAAGKLTVIDATNVQPEDRKTLLQMAKQYHCFTVAIVFDLPEELCHERNQQRSDRQFGSHVVRR---------------HTQMLRRSLRSLEKEGFRYVYTL............................................................................................................................. 155
6 -27.100[L] KOG2134 Polynucleotide kinase 3` phosphatase  ali follow..  12  16..VVLLIGPPGSGKSTFCDTA---MRSSHRPWSRICQDIV--------------NNGKAGTKAQCLKMATDSLREGKSVFIDRCNLDREQRSEFIKLGGP-EFEVHAVVLELPAQVCISRSVKRTGHEGNL------------QGGRAAAVVNKMLQSKELPKVNEGFSRIMFCYSDADVDNAVNMYNKL---GEKKLDTKSQPGIMKFFKKVSALPASSSNEATNTTRKADEMTANVRVSPVKLGSADIVPTLAFPSISTADFQF---------DLEKASDIIVEKAEEFLSK..... 276
7 -24.900[V] COG3896 Chloramphenicol 3-O-phosphotransferase  ali follow..  12  25..LILLNGGSSAGKTSLALAFQDLAAE---CWMHIGIDLFWFEADGLEWFTVHPGPILDLAMHSRYRAIRAYLDNGMNVIADDVIWTREWLVDALRVFE--GCRVWMVGVHVSDEEGARRELERGDRHP-----------------------GWNRGSARAAHADAEYD---FELDTTAT----------------------------------PVHELARELHESYQACPYPMA-----------------------FNRLRKRFLS............................... 225
8 -24.100[P] COG0529 Adenylylsulfate kinase and related kinases  ali follow..  15  5..VLWFTGLSASGKSTIANRLEQRLHALGKHTYLLDGDNV--RHGLNSDLGFSDADRVENIRR-VGEVARLMADAGLITPVSFISPFREERDQVRARLP--EGEFIEIFIDTPIEECMARDPKGLYAQALRGEIKAFTGIDSP---YEPPVAPELRLNTAGRTVDELIAEVENYLAERGVIG..................................................................................................................... 176
9 -23.300[S] COG5324 Uncharacterized conserved protein  ali follow..  393..LIFPISVIGCGKTTTSQTLVNLFPD---SWGHIQNDDI---------------TGKDKSQLMKKSLELLSKKEIKCVIVDRNNHQFRERKQLFEWLNELKEDYLVYDLSEIRDITLQRVIKRGNNHQS--------KWDELGEKKVVGIMNGFLKRYQPVNLDKSPDNMFDLMIELDFGQADSSLTNAKQILNEIHKAYPILVPEIPKD--DEIETAFRRSLDYKPTVRKIVGKGNNNQQKTPKLIKPTYISAKIENYDEIIELVKRCIASDAELTEKFKHLLA............. 664
10 -21.400[P] KOG0635 Adenosine 5`-phosphosulfate kinase  ali follow..  18  117..VVWITGLSGSGKSTVACALSKALFERGKLTYTLDGDNV--RHGLNRDLTFKAEHRTENIRR-IGEVAKLFADVGVICIASLISPYRRDRDACRSLLPD--GDFVEVFMDVPLHVCESRDPKGLYKLARAGKIKGFTGIDDP---------------YEAPVNCEVLKHTGDDESCSPRQMAENIISYLQNKGYLE...................................................................................................... 292
11 -19.800[F] COG2019 Archaeal adenylate kinase  ali follow..  13  1M-RSVITGVAGVGKTTVLDIVARES-----GIPVVNYGTLMFEVAKRRGLVENRDQIRKETQVDLQKLAGEEIGKMENAIVDTHMSIKTPFGYLPGLPEWVLRSIVFVIIEADPAIIKRRRDNDPTRARDDEGVDSIREHQE............................................................................................................................................................. 142
12 -18.700[G] KOG3354 Gluconate kinase  ali follow..  15  16..VFVVIGPAGSGKTTMAKAVSEKL-----GFEYIEGDDLHPKANIEKMSQ-NDNDRWGWLHNCGGACAMELDESIKGVVLTCSALKRSYRDILRSSLEHRPAILRFIYLAASRETLIKRTTSRKNH-------------------MKADMVESQLAILEAPTADEK-DVITISVENGKEQSEEECLDIVHK........................................................................................................... 185
13 -18.100[G] COG3265 Gluconate kinase  ali follow..  15  4.KCIIVMGVSGTGKSCVGQALALAL-----GAKFIDGDDLHPRANIQKMAA--NDQDRAPWLERLSDVAYSLQQKNEVGFLVCSALKKQYRDRL----REGNEGIRFLWLTGDYDLVLHRMQQRAGH-------------------MPESLLKSQFATLEAPGSDEP-DVIPIDISSSIADVVEHCIAALSLENHVSAILSE................................................................................................. 178
14 -18.000[F] KOG3347 Predicted nucleotide kinase/nuclear protein involved oxidative stress response  ali follow..  3LPNILLTGTPGVGKTTLGKELASKS-----GLKYINVGDLAREEQLYDGYDEEYDCPILDEDRVVDELDNQ--MREGGVIVDYHGCDFFPERWF-----------IVFVLRTDTNVLYERLETRGYNEKKLTDNIQCEIFQVLYEEATASYKEEIVHQLPSNKPEELENNVDQILKWIEQ....................................................................................................................... 165
15 -17.800[G] COG2074 2-phosphoglycerate kinase  ali follow..  93..IILIGGASGVGTSSIAFEVANRL-----GIRNMISTDMIREV--LDEVLIGFRDHVESVSIGVEAVIERALTEGISIVIEGVHIVPGF---IREDLVNKENVAMFVLTVSDENVHKGRFYSRCRQMWARRPLKRYISYFWAIRRIHRYIENQA--------------------------------------------RKHGVPVIENIDVVTTIDSIIKSLTKTTVKGGEKGAEKT............................................................. 305
16 -17.500[S] COG4185 Uncharacterized protein conserved in bacteria  ali follow..  12  14..FLIVAGPNGSGKSSVYANADL--ELEGRSVWIVNPDLLAGR--ISEVENKPLPEANLVAVQRIEAWIQSSISVHKTIGVETVLSTDKYRRLVEAAEAVGFAIWLFYTVLDSPERSIERIKLRVAK............................................................................................................................................................................ 134
17 -16.500[F] COG1936 Predicted nucleotide kinase (related to CMP and AMP kinases)  ali follow..  13  3...IAITGTPGVGKTTVAKLLAKKL-----NYEYVSLKDFALEKGCGRRVNDEVEVEIDELAYFIEREL-----KGKNAVLDGH-------------LSHLMPVDLVVVLRAHPKLIGERLRERGYDREKIGENVEAELVDAVLIEAIEEHENVIEVDTTNKSPEDVVEEIVSLINSGIKKRVGIV................................................................................................................. 162
18 -14.800[G] KOG0234 Fructose-6-phosphate 2-kinase/fructose-2,6-biphosphatase  ali follow..  12  40..LIVMIGLPARGKTYVSKKLTRYLNWIGVPTKVFNLGVYRREAVKSYKSYDDNEEAMKIRKQCALVALEDVKANGQIAVFDATNTTRERRDMILNFAEQNSFKVFFVESVCDDPDVIAANILEVKVSS-----------PDYPERNRENVMEDFLKRIE------CYKVTYRPLDPDNYDKDLSFIKVINVGQRFLVNRVQDYIQSKIVYYLMNIHVQPRTIYGESEFNLLGKIGGDSGLSVRGKQFAQALRK-FLEEQEITDLKVWTSHVKRTIQTAESLGVPYEQWKILNE..... 326
19 -14.600[C] KOG3877 NADH:ubiquinone oxidoreductase, NDUFA10/42kDa subunit  ali follow..  10  84..VICVEGPIAAGKSKFAKELAEELDMEGYDMRKLDPQLPPSCRSYDVRNFCLDPSHDLAAQFQIRMYMLRYLSTGQGVVLERQGYLSRGARSVYNTIGELLKPHLVIYLDLPVDAVKKQIKARNVDY------------EVQSKVFSDAYLSDLEQLYKQ-LKDISTHAELLIYDWTAGGETEVVVEDIERIDFNQFEADIHNKKMLDWRFPLEAEEARIKYCHEKPDLMNYFNVPRFDVPELVRSADDGKVWRDVWFNAPGMKY................................. 382
20 -14.200[R] COG3911 Predicted ATPase  ali follow..  19  9...FVLTGGPGSGKTTLIAALRR----AGFATSVVAGRGIVRDQSSIGGTALPWSDRTLFAELMLSWEMRNAVEQKGPVFFDRGLSGLPVADHVSTAAKRFRYNP-RVFIAPPWPDIFAQDEERKQTPDEA........................................................................................................................................................................ 143
21 -14.200[H] COG1072 Panthothenate kinase  ali follow..  15  82..IISIAGSVAVGKSTTARVLQALLSREHRRVELITTDGFHPNQVLKERGLMKKKGFPESYDMHRLVKFVSDLKSGVILILEGLNVLQSHDPHHVFVSDFVDFS---IYVDAPEDLLQTWYINRFLKFREGAFTDPDSYFHNYAKLTKEEAIKTAMTLWKEINWLN--ERASLILTKSANHAVEEV................................................................................................................. 304
22 -14.100[F] KOG3308 Uncharacterized protein of the uridine kinase family  ali follow..  14  7..IVGVSGASCSGKSTLCQLLHAIFEG----SSLVHEDDFYKTDNRENKNVAPEALIEYADIIKEFKAPAIPTLEQHLVFVDGFMMYVNED-----LINAFDIR---LMLVTDFDTLKRRREARTGYITLEG....................................................................................................................................................................... 165
23 -13.700[P] COG3709 Uncharacterized component of phosphonate metabolism  ali follow..  13  17..MIVIVGPSGAGKDTLMDYAAAQLSGRPGFHFTRRVITRSCDAGGENHDAVSMHEFNQLEDA-IPAAVYRHLEAGDVVIANGS-------RSALPHFGTAFSRLKVVNIVARPDVLARRLEQRGRESRDD........................................................................................................................................................................ 152
24 -13.700[F] COG0572 Uridine kinase  ali follow..  17  10..IIGIAGASASGKSLIASTLYRELREQDQHIGVIPEDGYYKDQSHLSMEERVKTNYDSAMDHNLLLEHLQALKAGKPVELPLYSYTEHTRKKETVHLEPKKVIILEIFVDTPLDICLMRRMKRDVNER.......................................................................................................................................................................... 157
25 -13.500[F] COG1428 Deoxynucleoside kinases  ali follow..  11  8..VIVLAGMIGAGKSSYTELIANELGKDNRILEMFYDDPKRWAFALQIYFLNTRFRSIKAALTDQNNVLDRSIYEDALFT-EMDTYLDLLDNMMEELAYMPKKA-LLIYLRGSLDTVLSRISLRGRPYEQT........................................................................................................................................................................ 156
26 -13.400[F] COG1102 Cytidylate kinase  ali follow..  12  5CLVITVSGLAGSGTTTLCRNLAKHYGFKHVYAGLI--RQMAKERGMSLEEFQKYAELHPEIDREVDRRQVEAAKECNVVIEGRLAGWMVKNADLK------------IWLDAPIRVRAERVAKREGISVEEAFMKIAEREMQNRKRYLN...................................................................................................................................................... 140
27 -13.300[H] COG3172 Predicted ATPase/kinase involved in NAD metabolism  ali follow..  18  8VRTVAILGGESSGKSTLVNKLANIF---NTTSAWEYGRDYVFSHLGGDEIALQYSDYDKIALGHAQYIDFAVKYANKVAFIDTD....................................................................................................................................................................................................................... 88
28 -13.300[FH] KOG2702 Predicted panthothenate kinase/uridine kinase-related protein  ali follow..  15  129..LVGLAGPPGAGKSTVANEVVRRVNKPPDVAIVLPMDGFHLYRSQLDAMEDPKEAHARR--ALLLNCLKKLVSLQHKVVIVEGNYILLEEGSWKDISDMFDEK---WFIDVNLDTAMQRVENR............................................................................................................................................................................... 291
29 -13.100[C] COG3954 Phosphoribulokinase  ali follow..  7..VIAVTGSSGAGTTTTSLAFRKIFAQLNLHAAEVEGDSFHRYTRPEMDMAIRKARDASLLEHTFIEYGQPLPEPTDVLFYEGLHGVVTPQHDVARHVD------LLVGVVPIVNLEWIQKLIRDTSERGHSREAVMDSVVRSMDDYINPTVDTSNPFAAKGIPSLDESFVVIHFRNLEGIDFPWLLAMLQGSFISHINTLVVP----GGKMGLAMELIMLPLVQRLMEGKKIE................................................................. 289
30 -12.700[R] COG4128 Zonula occludens toxin  ali follow..  1MSIFIHHGAPGSYKTALWLRLLPAIKS--TNVRGLNLERMAKYLKMDVSDSIEFIDTDHPDGRLTMARFWHWARKDAFLFIDECGRIWPPRLTVTNLK-----------------------------------------LDTPPDLVAEDRPESFEVAFDM-HRHHGWD--ICLTTPN----------------------------------IAKVHNMIREAAEIGYRHFNRATVGTLTTHDAANSGQMDSHALTRQVKKIPSPIFKMYASTTTGKARDTMAGTALW........... 222
31 -12.400[E] COG0703 Shikimate kinase  ali follow..  14  74...IFLVGPMGAGKSTIGRQLAQQL-----NMEFYDSDQEIEKRTGADVGWVFDLEGEEGFRDREEKVINELTEKQGIVLATGGGSV--KSRETRNRLSARGV---VVYLETTIEKQLARTQRDKKR............................................................................................................................................................................ 187
32 -12.200[F] COG0563 Adenylate kinase and related kinases  ali follow..  14  1MNLILM-GLPGAGKGTQAEKIIEKYGIPHISTGDMFRAAMKNETELGLKAKSYMDAGELVPDEVTIGIVRDRLSQDDCFLLDGFPRTVAQAEALEDILASLDKKLYVINIDVPEQLLMDRLTGRRVSPTSGRT---------------------YHVIFNPPKVEGICDVDGSELIQRDDDKPETVKKRL---EVNQKQAQPLIDFYSEKGYLQNINQDISRVFEDINELLKG.................................................................. 214
33 -12.000[R] COG1373 Predicted ATPase (AAA+ superfamily)  ali follow..  49.RIYTLRGPRQVGKTTLVKLIIRELLETIQSIFYFTCDLVADEKELFEVL------------DLYLKWAAAFRLERKYIFLDEISSVRDWEKGLKYLVDTGALNNATVVLTGSHSIDIKSSIERLPGRRGSEYAETLNSDLKQFMEANGLFEAEKRQEILSNLSEGRADPLLNMLLLYQPELDRLFDQYLLTGGIPRAVNEFFSKNKIDSSIYEIY-NIPEMPVKQTLRSIAGKLTTPVSWRSITDETDIGAHVTVRKVTALEDSFVLNVLYPLDLPKKTANFKKEKKIYFQDPFI... 360
34 -11.900[F] KOG3079 Uridylate kinase/adenylate kinase  ali follow..  13  37..VVFVLGGPGAGKGTQCARIVEKY-----GYTHLSAGELLRDERKNPDSQYGELIEKYIKEGKIISLLKREMDQTMAFLIDGFPRNQDNLQGWNKTMDGKADVSFVLFFDCNNEICIERCLERGKSSGRSDDNRE................................................................................................................................................................... 178
35 -11.800[TZ] KOG4203 Armadillo/beta-Catenin/plakoglobin  ali follow..  11  67..LVGLAGPSGAGKTIFTEKILNFMPS----IAIINMDNYND----GTRVIDGNFDDPRLTDYDTLLDNIHGLRDGKPVQVPIYDFKSSSRIGYRTLEVPSSRIVILVSVTGGVHFDLVKRVLRDIQRA.......................................................................................................................................................................... 202
36 -11.600[F] COG1618 Predicted nucleotide kinase  ali follow..  17  10MLRIAVTGSPGVGKSTVVAKTAEKLAEKP--RDLATGKTGILSHVKGSGPRLGKYHVNLDDLERIGANAVRNALACDLVVIDEIGPMELISQSFVSAVEEV...................................................................................................................................................................................................... 131
37 -11.600[F] KOG3078 Adenylate kinase  ali follow..  13  18...AVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCFLLDGFPRTVRQAEMLDDLMEKRKEKLSVIEFSIPDSLLIRRITGRLIHPKSGRS---------------------YHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRL---QAYHTQTTPLIEYYRKRGIHSAIDQTPDVVFASILAAFSKATS............................................................... 232
38 -11.600[F] COG0125 Thymidylate kinase  ali follow..  18  5..FITFEGPEGAGKTTVLQEIKNILTAEGLQVMATREPEQIREVILNENNILMDPKTEALLYAALVEKVKPALEQGFIVLCDSPLAYQGY-LSINEFAIGDMMPHVTVYFSIDPEEGLKRIYANGSRE........................................................................................................................................................................... 153
39 -11.500[H] COG1763 Molybdopterin-guanine dinucleotide biosynthesis protein  ali follow..  18  1MNIFGITGWKNSGKTTLTEKLVAELVRRGWKVSTVKHDSFRHRQAGATEVAIVSGNRWALMHELPLESILSRLAPCDIVLVEGYKRESHRKIETRRLEAK....................................................................................................................................................................................................... 118
40 -11.400[OK] COG0378 Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase  ali follow..  16  6..IIGVGGPVGAGKTMLIERLTRYLSTKGYSMAAITND..................................................................................................................................................................................................................................................................... 41
41 -11.300[R] KOG2878 Predicted kinase  ali follow..  17  27..ILGISGPQGSGKSTLASALDTELTRKNESVVKFSLDDFYLTHAEQVELAKNNPNNPLVQHTFLNNVLNAFVKGSDEEV........................................................................................................................................................................................................................... 113
42 -11.000[R] COG1341 Predicted GTPase or GTP-binding protein  ali follow..  18  33.AKVMIIGDVDTGKTTLTIYLANELLSRGFRVAIIDSDIGQKGILPPATISITPNQYFGEMVVGVMKLSELAMKFSDVVLIDTTGMIYGSGVELKRMKIEAVKPNLILALERNNEL....................................................................................................................................................................................... 171
43 -10.700[F] KOG0707 Guanylate kinase  ali follow..  11  139..PIVISGPSGVGKGTLISMLMKE-EMDGVHYHFADKKVM--EKEIKDGKFLEFASVHGNLYGTSIESVEAVTDSGKRCILD-------IDVQGARSVRASSLDAIFIFVCPPMKELEDRLRARGTETEEQIQKRLRNAEAEIKEGISSGIFGLILYNDNLEECYKKLKVNHLLLIAQ......................................................................................................................... 324
44 -10.600[J] KOG1384 tRNA delta(2)-isopentenylpyrophosphate transferase  ali follow..  10  66.KVVVILGATGAGKSRLSVDLATRFPSE-----IINSDKIQVYEGLEITTNQITLQDRRGVRSAASNVVKEITSRQKVPIIGSNSFVHALLAQRFLISSDLRYECCFIWVDVSETVLYEYLLRRVDEM------------------MDSGMFEELSRFYDPVKSGLETRFGIR-----KAIGVPEFDGYFKEYPPEKKMIKDALRKAAYDKAVDDIKRNTWTLAKRQVKKIEMLKDAGWEIERVDAT---------ASFKAVMMKSSSEKKWRENWEEQVLEPSVKIVKRHLVQN.... 357
45 -10.600[K] KOG1534 Putative transcription factor FET5  ali follow..  19  6...AFVCGVASSGKSTFCGALMSYMKSVGRSCHLVNLDPAAENFEWEPTVDIRDLISIDDVNGGLIYCFEFLMENEDYLIFDM-THVPILPALIRHLQVTLNFRPCAVYL............................................................................................................................................................................................. 138
46 -10.500[A] KOG2749 mRNA cleavage and polyadenylation factor IA/II complex, subunit CLP1  ali follow..  12  114.PRVIIVGDIDSGKSTLAKMLLNWAVKDGWKPTFVDLNDKALIHYFGLTNPSVNLRLYRTLVEELARELKEEFSANAEMVIDTMGFIVREGYALLHAIRTFNASLVIVVGQEEKLVYDLKKNLKFKKNLQVLNLEKSEGVFSRSSDFRKTLRNSNIQNYTVYTKTVKFSDVQVYRIGDFRVSGSTSAHQRGNDPLVTIDEHLVNKVLAISYAIKPDQIISSIVAGFVCIKNVDISEERITYVSPSAAELPSKILILGTLT....................................... 419
47 -10.300[R] COG3596 Predicted GTPase  ali follow..  10  39.PVIGIMGKTGAGKSSLCNALFAGEVSPVSDVAACTRDPLRFRLQIGEHFDLPGVGESGVRDTEYAALYREQLPRLDLILIKADDRALATDEHFYRQVIGEAYRHKMLFVISQSDKAEPTSGGNILSTEQK---------------------QNISRKICLLHELFQPVHPVCAVSVRLQWGLRVMAERMIKCLPREPSSPVVALLQHPFRTWVAREQARDDFGETVDTILDTVSTFPLIPAPVRTIIQAVRSSVVSVARAVWDFFF................................ 289
48 -10.300[P] COG1348 Nitrogenase subunit NifH (ATPase)  ali follow..  10  1MRQVAIYGKGGIGKSTTTQNLTSGLAELGKKIMVVGCDPKADSTRLLLGGLAQKTVLDTLREEGEDVDLDTIMKTGFGNIVGCAGRGIITSINMLEQLGAYEDELDYVFYDVLGDVVCGGFAMPIREGKAKEIY-----IVASGEMMAMYAANNISKGISKFANTGGVRLGGIICNSRKVKNEKELLEAFAKEYFVPRSHEVQKAEINKQTVIQEQADEYRALAKAIDGNDMY---------------VVPKPMAQDKLEAILMEY................................. 268
49 -10.300[S] COG2326 Uncharacterized conserved protein  ali follow..  61..VIVFEGRDAAGKGGVIKRITERVSPRVFRVV-----------------ALPAPTDREKTQIYMQRYIQQFPAAGEVVIFDRSWYNRPG-PRFEAAMIESGIVLLKYFLDVSEEEQDRRFRQRINDPLRQWKLSPMDVESYRRWWDYTRAYDEMIRMTDTDDA---WDNKKQARVNCIAHILSSIPYERVKFEDPDLGKRQKRPADFEGDTRRRTVP................................................................................. 281
50 -10.300[NU] COG2874 Predicted ATPases involved in biogenesis of archaeal flagella  ali follow..  15  36.SLTLIEGENDTGKSVLCQQFVYGGLMSGHNIAYYTTENTIKSFLRQMESHLEGIDWSTEQMRSILNLVANHIKTENIAIIDSLTMFEDDVLEFLTRLKNLCDNGKTILITLHQHA....................................................................................................................................................................................... 176
51 -10.200[DL] KOG2035 Replication factor C, subunit RFC3  ali follow..  12  37MPHLLFCGPSGAGKKTRIKCLLRELYGVGVE-KKLEIQTVSSNYHIEMTPSDVGIYDRVVVQDLVKEMAQTS-RSFKVVVLCEASLTRDAQHGLRRTMEKYANNCKIVLSCESLSRIIEPLQSRCIIIN---------------PAPTDEDVTKVLRKVIERESFLLPENVLQKIVEKSEGNLRRAILMTEALRMENESGVAESVVIPVPEWEIYIQETARLILQKQSSDMLLKVRERLYIPPTVIFKKLLEHLLPKCPPQIAREVVSEAAKFEQKAIFHLEGFVAAFMDIYLTNASK. 352
52 -10.200[R] COG4240 Predicted kinase  ali follow..  13  88.PFIQILGSQGTGKTTMSLVIQLILQHLGYRTLSLSLDDLYKTYSDRLVLLQQDPRLIWR--DLGLNVLEQIRQGKSPVIV.......................................................................................................................................................................................................................... 174
53 -10.100[F] COG0194 Guanylate kinase  ali follow..  47..LIVLSGPSGVGKGTVRQAIFSQEEVNGVDYFFKTRDEF--EQMIADNKLLEWAEYVGNYYGTPVDYVEQTLQDGKDVFLE---------QGALQVRNAFPEGLFIFLAPPSLSELKNRIVTRGTET-------------------DALIENRMKAAKAEIEMMDAYD--YVVENDNVETACDKIKAIVLAEHLKRERVAPRYKKMLEVE........................................................................................ 244
54 -10.100[R] KOG1533 Predicted GTPase  ali follow..  19  36...VLVIGAPGAGKSTFCAGLTDIFSQTKRPFLTINLDPANDTMAYAPDVNITEMITVNDVNGALKYCIETLGANKKYLIIDELYKSEGELWKVIRFLEKSGVRLCALHL............................................................................................................................................................................................. 167
55 -10.100[R] KOG2486 Predicted GTPase  ali follow..  15  135LPEFALVGRSNVGKSSLLNSLVRRTSKKPGKTQCINHFRINDKWYLVDLPGYGYASAPHELKQDWNKFTKDYFLN-VFLLVDASIPVKPIDLEYASWLGQNQVPMTLIFTKCD.......................................................................................................................................................................................... 257
56 -9.920[L] COG0470 ATPase involved in DNA replication  ali follow..  10  46LPHLLFYGPPGTGKTSTIVALAREIYGKNYSNMVLELN----------ASDDRGIDVVRNQIKDFASTRQIFSKGFKLIILDEADAMNAAQNALRRVIERYTKNTRFCVLANYAHKLTPALLSRCTRFR---------------QPLPQEAIERRIANVLVHEKLKLSPNAEKALIELSNGDMRRVLNVLQSCKATLDNPDE--DEISDDVIYECCGAPRPSDLKAVLKSILEDDWGTATLNKVRSAKGLALIDLIEGIVKILEDYELQNEETRVHLLTKLADIEYSISKGGNDQIQ.. 319
57 -9.760[R] COG1660 Predicted P-loop-containing kinase  ali follow..  11  6INLVIVTGMSGAGKTVAIQSFED--------LGYFTIDNM------------------ALVPKFLELIEQTNENRRVALVVDSRLFFKEINSTLDSIESNPSIDFRILFLDATDGELVSRYKETRRSHPLAADGRVLDGIRLERELLSP------------------LKSMSQHVVDTTKLTPRQLRKTISDQFSEGSNQASFRIEVMSFGFKYGLPLDADLVFDV-----------------------LPNPYYQVELREKTFNYVMSHPESEVFYKHLLNLIVPILPAYQKEGKSGC 255
58 -9.720[E] COG4917 Ethanolamine utilization protein  ali follow..  10  1MKRIAFVGSVGAGKTTLFNALQGNYTLARKTQAVEFNDKGD----IDTPGEYFNHPRWYHALITTLQDVDMLI-----YVHGANDPESRLPAGLLDIGVSKRQIAVISKTDMPDADVAA.................................................................................................................................................................................... 110
59 -9.710[H] COG2087 Adenosyl cobinamide kinase/adenosyl cobinamide phosphate guanylyltransferase  ali follow..  15  7..SVFILGGARSGKSRFAEELAGKAGGRLHYLATGAWDDEMRDRISHHQERRGGEWTTHEAPVDIATVLQRLDSPDSVILIDENADMETAFAELEAAIVSTRAKLILVSNEVGLGIVPENRMAR............................................................................................................................................................................... 140
60 -9.700[D] COG3640 CO dehydrogenase maturation factor  ali follow..  28  6MPKLIISGRGGSGKSTLVTLIAHTLKEQKKRVLVVDSD..................................................................................................................................................................................................................................................................... 43
61 -9.630[K] COG1224 DNA helicase TIP49, TBP-interacting protein  ali follow..  10  66...ILMAGPPGTGKTAIAVAISKELGKDIPFVQVSASEFYSAEMK-----------KTEALIQAMRKAIGVRIRETRTVLEGEVVGLDYNMVP.............................................................................................................................................................................................................. 144
62 -9.610[R] COG2607 Predicted ATPase (AAA+ superfamily)  ali follow..  10  86...VLMSGARGTGKSSLVKALLHEYADKGLRLIEVDKSDLIGLPYL--------------------LTLLKECPEKFIVFCDDLSFYKALKTALDGGLSQRCANVLVYATSNRRHLMPEYFDENAGTTGMRGEIHQKEAVE------------------EKISLSDRFGLWLSFYPFDQNDYLAAVQNWLEDFGVPYDETAQMAALQWAQTRGSRSGRSAWQFACDWAGRLPKQ................................................................. 284
63 -9.540[S] COG4983 Uncharacterized conserved protein  ali follow..  499SAYLFITEETGIGRNWLSSVLVRVLRGY--VAAGIDIQEMLDGTFNGRLSRKLLAVVDEAKAGMQGYGRWSHSEKLKSMINPEMRRINEKHGLEFVEWNCCR----WLFFSNNWDALPFDASDRR--------------VANPTHRQSPDYYERIYSQIANPDFISAVRKRLELLDISGFKPGAIPDMNEAKRKALGAMASDLDNLLAAFRDEWPGPLAERSDVINYLHVSIAKLPGEKTINKLIEQAGMKLVERISIGPNKYRFVVQQIETNPQWAYAEAVNARGKYGFRQG...... 780
64 -9.520[L] KOG0991 Replication factor C, subunit RFC2  ali follow..  14  69VPNIIIAGPPGTGKTTSILCLARALLGPALKDAMLE---------LNASNDRGIDVVRNKIKMFAQQKVTLPKGRHKIIILDEADSMDGAQQALRRTMEIYSKTTRFALACNASDKIIEPIQSRCAVLR---------------TKLTDAQILTRLMNVIEKERVPYTDDGLEAIIFTAQGDMRQALNNL-------QSTFSGFGFINSENVFKVCDEPHPLLVKEMIQH..................................................................... 269
65 -9.440[T] KOG0609 Calcium/calmodulin-dependent serine protein kinase/membrane-associated guanylate kinase  ali follow..  10  348..TLVLIGVSGVGRRTLKNRLINS-EENGSSYWFMDREEM--EEAVRNNEFLEYGEHNGNLYGTHLQSIKDVINSGRMCILD---------NALKILHNSQELMPFVIFVAAPGMEQLKTIYADRRATGS-----------------NRNLSATLVALLDLCLNTQTLL--NTFAFYDFSEQDDDLVATVEESSFVQRKYEKYFDMVIVNEDFDETFRQVVETLDQMSHEEQ................................................................... 568
66 -9.400[R] COG0218 Predicted GTPase  ali follow..  15  25LPEIALAGRSNVGKSSFINTMLNRTSGKPGKTQLLNFFNIDDKMRFVDVPGYGYARVSKKEREKWGCMIEEYLTTREVSLVDLRHDPSADDVQMYEFLKYYEIPVIIVATKAD.......................................................................................................................................................................................... 147
67 -9.340[F] COG1435 Thymidine kinase  ali follow..  11  4..LYFKYGTMNSGKSIEILKVAHNYEEQGKPVLLMTSDTRAGVGTVASRIGMKAEAVAIDEEMSVFDYVNSLPAKPFCVLIDEAQFLNKKHYDFARVVDELNVPVMAFGLKND.......................................................................................................................................................................................... 117
68 -9.230[U] KOG0780 Signal recognition particle, subunit Srp54  ali follow..  103..VVMFVGLQGAGKTTTCTKYAYYHQKKGYKAALVCADDQLKQNATKAKIPFYGSYTESDPVKIAVEGVDRFKKEKCLIIVDTSGRHKSLFEEMRQVAEATEPDLVIFVMDSSIAAFEQAEAFKETVSVGAVIITKMDGHAKGGGALSAVAATKSPVIFEHMDEFEVFDVKPFV-KGDWSGLVDKLQEVVPKDLQNELVENLSQGNFTLRSMYDQFQCSLRIPLNQLFSEMMPKGHGEESRVKMKRYMTMMDSMTNKELDSPNPKIFNESRIMRIASGRLVREVMEMLEEY........ 421
69 -9.200[P] COG0003 Oxyanion-translocating ATPase  ali follow..  11  1MRVILMTGKGGVGKTSVAAATGLRCAELGHKTLVLSTD--------------PAHSLADSFDLELGHEPRLVKENLWGAELDALMELEGNWGAVKRYITQVLQARGLDGVQAEELAILPGMDE----FGLVRMKRHYDEADYDVLIIDSAPTGTALRLLSLPEVGGWYMRRFYKPLQGMSVALRPLVEPL--------FRPIAGFSLPDKEVMDAPYEFYEQILEKVLTDNTQTSVRLVTNPEKMVLKESLRAHAYLSLYNVSTDLVIANRILPETIDDPWKSNQQVYKQEIYDNFHP. 279
70 -9.180[L] KOG0990 Replication factor C, subunit RFC5  ali follow..  14  72LPHLLLYGPPGTGKTSTILAVARKLYGPKYRNMILELNA-------------SDDRGIDVVRQQIQDFASTQ-SSVKLVLLDEADAMKDAQFALRRVIEKYTKSTRFALIGNHVNKIIPALQSRCTRFR---------------APLDGVHMSQRLKHVIEAERLVVSDCGLAALVRLSNGDMRKALNILQSTHMASKEITEEESKQITEEDVYLCPKDIEQISHWLLNK..................................................................... 285
71 -9.110[U] KOG0077 Vesicle coat complex COPII, GTPase subunit SAR1  ali follow..  16  23...ILFLGLDNAGKTTLLHMLKDERLVQHQPTQHPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVDAVV-----YLVDAYDKERESKRELDALLSDEALATVPFLI............................................................................................................................................................................................. 126
72 -9.090[LD] KOG2227 Pre-initiation complex, subunit CDC6, AAA+ superfamily ATPase  ali follow..  152...LYICGCPGTGKSLSMEKVVQQVGDWSTQAGLPPVDTLILGEIKPGKNANTNSSPLQHLQNLFSQKQESSSSRMMLIIADEMDYLITKDYDLFMLTTLPFSRCILIGVANAID-LADRFLPKLKSLNCKPMVITF-------RAYSKDQILRILQERLRVLSYVAFQPKALELCARKVADMRKALCVCRSALEILEIETRGSTGPESQGPTPDDSVVRMDHMAAALSKTFKS-----PVVETIQSLPQHQQIIICAAAKAFRG----------KKDATVGELNKLYLEICKSW.... 445
73 -9.020[S] COG4916 Uncharacterized protein containing a TIR (Toll-Interleukin 1-resistance) domain  ali follow..  41...LLIEGPSGIGKTCVVFKVFEELQWSQGRDFTYV--------------GCRDQNAEQIIDDFLKNAAAGNALSPCVLVIDDFHLLQAKRMEIGSTLKRLPAKVILIGIPTAGVSLLSDAYDLGPRLGSYAL-----------TRASDVEIDKLISEVLFEDRDVLLAESAGNFWLAQYVCNKVCAIEEVYETQDDAKILTFDILGIRGRLMAELTQRYLPIARTFAKGKRWR................................................................. 262

FFAS is supported by the NIH grant R01-GM087218-01
1 3 6 3 5 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Liu T, Rojas A, Ye Y, Godzik A. Homology modeling provides insights into the binding mode of the PAAD/DAPIN/pyrin domain, a fourth member of the CARD/DD/DED domain family. Protein Sci. 2003 Sep;12(9):1872-81.