current user: public

If you have questions about the server, please let us know.

Query: [R] KOG3115 Methyltransferase-like protein, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270
# Score Template Links and tools%idFirst MSATAKKSAAQLQREEEEARKKLKRLSKQGGVEGRLPMKRLFRQRAHANVLSDHELEYPRSPSEMDWSPYYPDFDVESNKKVEIVDIGCGYGGLTVALGPQFPDTLVLGMEIRMQVSDYLKEKIQALRYRADHEEPVPGGYKNISVLRMNCQKFLPNFFEKGQLSKMFFCFPDPHFKARKHKNRIITSTLASEYAYFIRPHGTLYTITDVEELHVWMAQHLDAHPLFRRFTKEEEENDICVTLMTNETEEGKKVARNGGKKFVACYERIPNPKLast
1 -105.000[R] KOG3115 Methyltransferase-like protein  ali  100  1MSATAKKSAAQLQREEEEARKKLKRLSKQGGVEGRLPMKRLFRQRAHANVLSDHELEYPRSPSEMDWSPYYPDFDVESNKKVEIVDIGCGYGGLTVALGPQFPDTLVLGMEIRMQVSDYLKEKIQALRYRADHEEPVPGGYKNISVLRMNCQKFLPNFFEKGQLSKMFFCFPDPHFKARKHKNRIITSTLASEYAYFIRPHGTLYTITDVEELHVWMAQHLDAHPLFRRFTKEEEENDICVTLMTNETEEGKKVARNGGKKFVACYERIPNPK 273
2 -75.300[R] COG0220 Predicted S-adenosylmethionine-dependent methyltransferase  ali follow..  16  2................................RVRNRKGAGEMLAENAHIVVENPADFK-----------GRWSERFGNDHPIHIEVGCGKGAFITGMAALHPEINYIAIDMQLSVLSYALDKAI------------EADLPNVQMMLVDGAA-LSEYFADGEIDQVYLNFSDPWPKGRHEKRRLTYKSFLATYEKILRPEGEIHFKTDNRGLFEYSLVSLANYGMELKKVWLDLHQDEEFAPQNVMTEYEQKFSQKGQVIYRLEAKFLPK.. 216
3 -22.800[R] KOG2899 Predicted methyltransferase  ali follow..  12  1MDLENNNNTPLTGKQAEKCAKKRKCVITLDEKQVESKRLKKEESNVEATSRPPAQSPKKRLHLNGKPMQNKDLNFKYGNRNKQLLDIGCNSGHLSIQIARKFEVKSLVGLDIDRGLINDAQKTVSHLKRHATPGQGIPHQFVHGNYVLEDDVLL----IERPQFDVILCLSVTKWIHLNFCDSGL--KQAFRRMYLQLRPGGKLILEP................................................................. 233
4 -20.100[R] KOG1271 Methyltransferases  ali follow..  11  58..............................................................................KEASRVLDLGCGNGMFLVGLANEGFTGDLTGVDYSPKAVELAQNIAEDNKL-------------SITYKVADLTQPFDVVHDKGTYDAVSLCPDNAKEKRA---------LYLDTVEKLLRTADSLFVITSCNWTEDELVDSFAEKFVKYYTIPTPTFKF-----------------KVGNVVTSIVFKRKKE.. 219
5 -19.800[R] KOG2361 Predicted methyltransferase  ali follow..  15  89..............................................................................SGKSVILEVGCGAGNTIFPLIATYPDIFVYACDFSPRAVELVKAHDEYTETRVC---------AFACDLTGDGLDK----ISPSSVDIVTMIF--------SAVSPEKMSSVLQNIRKVLKPNGCILFRD................................................................. 200
6 -19.200[J] KOG3420 Predicted RNA methylase  ali follow..  15  2..................................PDKKTLWMLNELEGFEKPKIKLEQYATSSELAVSMMEMIDETIGFEGKKLIDIGCGCGMLMTTAATMYELETVLGVDIDDEALKICSRNLETAEVQ-----------DRCELLQADILD-PESDLPRGTFDVA-VINP-PFGTKNNAG---IDMQFVQIGLQMVRPGGSVFSLH................................................................. 158
7 -18.900[R] COG4106 Trans-aconitate methyltransferase  ali follow..  11  29..............................................................................ERVLNGYDLGCGPGNSTELLTDRYGVNVITGIDSDDDMLEKAADR-----------------LPNTNFGKADLATW-----PAQKADLLYANAVFQWVPDH--------LAVLSQLMDQLESGGVLAVQM................................................................. 129
8 -17.300[H] COG2242 Precorrin-6B methylase 2  ali follow..  16  69..............................................................................KEESIIWDIGAGTGTIPVELALLCPRSRIVAVERDEEVAGLIRRNCERF------------GVTNVTVHEGSAPDCLPQLIAHPTH-----------------------KQILQETWAHLAPGGRLVATANNLESLYGISETLSELQVRNVEVVQAGVN-------RLEKRGLQQIFAAVDPTFILAGEKLS... 227
9 -17.200[A] KOG1975 mRNA cap methyltransferase  ali follow..  11  81..HERYDQEERLRKQRAQKLREEQLKRHEIEMTANRSINVDQIVREHYNERTIIANRAKRNLSPIIKLRNFNN-DKYTKPGDVVLELGCGKGGDLRKYGAA---SQFIGIDISNASIQEAHKRYRSMRNLD-----------QVVLITGDCFGVEPFPDCRFPCDIVSTQFCLHYAFETEEKAR----RALLNVAKSLKIGGHFFGTI................................................................. 283
10 -16.900[J] COG2519 tRNA(1-methyladenosine) methyltransferase and related methyltransferases  ali follow..  17  92..............................................................................SPGDFIVEAGVGSGALTLFLANIGPEGRVVSYEIREDFAKLAWENIKWAGFD-----------DRVTIKLKDIYE-----IEEENVDHVILDLPQPE-------------RVVEHAAKALKPGGFFVAYTPCSNQVMRLHEKLREFKD--YFMKPRTINVLVFDQEVKKECMRPRTTALVHTGYITFARRI.... 253
11 -15.900[J] KOG3191 Predicted N6-DNA-methyltransferase  ali follow..  14  50.........................................................................KEIRSRDPKLVLEIGCGSGVVSTFVNQALGNVTSVATDLNPHALDVTLETAKLNDI-------------KIDVVRTDLFAGLENLLGKVDV----LLFNPPYVPTDEEPKRSTLDRLLPRVPELLSPRGVFYLVALHSNDIPALLKEHSE.................................................. 196
12 -15.800[J] COG1889 Fibrillarin-like rRNA methylase  ali follow..  16  77..............................................................................KEGTHILYLGAASGTTPSHISDI-ENGLIYSVEFSPRVFREFMEKLV------------DQGRRNVVPILGDARFP----QYAHYVKGVDVVYIDVAQPAQ-------AKILADNADYFLKPGGHVMLVI................................................................. 185
13 -15.700[J] KOG2915 tRNA(1-methyladenosine) methyltransferase, subunit GCD14  ali follow..  12  245..............................................................................NPGDTVLEAGSGSGGMSLFLSKAGSQGRVISFEVRKDHHDLAKKNYKHWRD-SWKLSHVEEWPDNVDFIHKDISGATED-IKSLTFDAVALDMLNPH-------------VTLPVFYPHLKHGGVCAVYVVNITQVIELLDGIRTCE................................................ 377
14 -15.100[J] COG2813 16S RNA G1207 methylase RsmC  ali follow..  13  222...............................................................GLDIGARFFMQHLPENLEGEIVDLGCGNGVIGLTLLDKNPQAKVVFVDESPMAVASSRLNVETNMP---------EALDRCEFMINNALSGV----EPFRFNAV-LCNP-PFHQQHALTDNVAW-EMFHHARRCLKINGELYIVANRHDYFHKLKKIFGNCTTIAT............................................ 372
15 -14.800[R] KOG1331 Predicted methyltransferase  ali follow..  14  47..............................................................................SAGSIILDVGCGEAKYT------SQKSHVIGFDTCSEVLSSSKKD-------------------DIDLCLADAINI----IRDDSVDAILNVS-------HHLATTARRRQVLQECSRCLRIGGQMLIYA................................................................. 143
16 -14.800[R] COG2521 Predicted archaeal methyltransferase  ali follow..  10  129...................................................................................VFECCTGLGYTAIEALK-KGARHVITVEVDPHVLTLASLNPYSRGLWS----------PAVDVILGDCYAFVQT-VRDSSIDFIIHDPPRL----SHATQRLYSEALYREFYRILKRGGGVFHYVSQSGTKYRGLNPYKG.................................................. 252
17 -14.700[R] COG4123 Predicted O-methyltransferase  ali follow..  15  46..............................................................................PKKGLIVDFCAGNGAVGLFASTRTQ-AQILSVEIQERLADMAERSVRLNGLE-----------EQMQVICDDLKN-MPAHIQGSKVDMI-LCNP-PYFKVARHEITTNLEEICRSAQSILKSNGRLAMVHRPDRLLDIL........................................................ 183
18 -14.600[R] COG4798 Predicted methyltransferase  ali follow..  11  109..............................................................................KPGDTVVDYIMGGGYFTRIISGA-PQGVVYAYQPAEFIRFAARYGESL--------KAVTAALANSKPLDGPITAL------PDNVDAVITV------QNYHD-----AAKANAEIFKSLKPGGVFLV-IDHSA--AAVKQEVEAAG-FKLEAESGLLADPADARTINVFDPAIRGKTDQ---FILKFRK---PK 298
19 -14.300[R] KOG3010 Methyltransferase  ali follow..  32..............................................................................QDHKFAWDVGTGNGQAAIGLVEHY--ENVVATDINEAQLQRAIKHSRI-----------SYHHTPTTISEDEMVDL----GGENSVDLIVAAQAVHF---------FDLNVFYNVAKRVLRKEGGLIA................................................................... 134
20 -14.300[H] KOG1540 Ubiquinone biosynthesis methyltransferase COQ5  ali follow..  25QAHRACKEEEVNSPLSSAAEQPEQKYTHFGSKTVLKSTKQKLVGDVFSSVANRYDLMNDVMSLGIH-NKLDAGKRPNSTTPLNFIDVAGGSGDIAFGLLDHAESKTMDIVDINPDMLKEGEKRAMEQGK--------YFKDPRVRFLVSNGEKL--EEIDSDSKDIYTVSF-----------RNFTDQKGLNTAYRVLKPGGIFSMIANDYDSYQYLVESIERFPDQETFKS......................................... 279
21 -14.200[R] COG4262 Predicted spermidine synthase with an N-terminal membrane domain  ali follow..  238..............................AISSPYQRLVVTRWKDDLRLYINGNLQFSSRDEYRYHEALVLPALESVRGARRVLVLGGGDGLALRQILKYPQVEHVTLVDLDPRMTSLFSHAEALVALNQHAFS------PRVTVVNADAGQWLQT--AADMFDVAIVDFPDP---SNFSIGKLYSVPFYRLLSRHVADTGLVVIQATSPYFAPRSYWCVDAT................................................. 421
22 -14.100[H] COG2226 Methylase involved in ubiquinone/menaquinone biosynthesis  ali follow..  11  1MVEDSQETTHFGFQTVAKEQKADMVAHVFHSVASKYDVMNDLMSFGIHRLWKRFTID-----------------CSGVRRGQTVLDLAGGTGDLTAKFSRMGETGKVILADINDSMLKMGREKLRNIGVI-----------GNVEYVQANAEAL----FPDNTFDCITISF-----------RNVTEEKALRSMFRVLKPGGRLLV................................................................... 168
23 -14.000[R] KOG2940 Predicted methyltransferase  ali follow..  35..STEGAYGGDGEFQQNSSKVKIFDRDLKRIHRDRAAWLSRQKNDSFVDAVADNLLD-----------------EDCKKSFPTAFCLGGSLGAVKRLLRGRGGIEKLIMMDTSYDMIKSCRDAQDDSLDNS----------IETSYFVGDEEFL----VKESSVDLIISSLGLHWTND---------PGSMIQCKLALKPDGLFLAAILGGETLKELRIACTL.................................................. 219
24 -14.000[R] KOG1541 Predicted protein carboxyl methylase  ali follow..  15  46..............................................................................QPCSFILDIGCGSGLSGEILTQE-GDHVWCGLDISPSMLATGLSRELEGD-----------------LMLQDMGTGIP--FRAGSFDAAISWLCNADTSYNDPKQRL--MRFFNTLYAALKKGGKFVAQF................................................................. 158
25 -13.900[IR] KOG1269 SAM-dependent methyltransferases  ali follow..  12  123..............................................................................KPGSRVLDVGCGVGGPAREITEFT-GCNLVGLNNNDYQISRCNNYAVKRNLD-----------KKQVFVKGDFMHM----FEDNTFDYVYAI------ATVHAPSL---EGVYGEIFRVLKPGGVFGVYE................................................................. 229
26 -13.600[H] KOG1270 Methyltransferases  ali follow..  17  91...................................................................................ILDVGCGGGLLTEPLGRL--GASVIGIDPVDENIKTAQCHKSFDPVLDKRIEYRVCSLEEIVEETAETFDAV-------VASEVVEHVIDL-------------ETFLQCCCQVLKPGGSLFITTINKTQLSYALGIVFSE................................................. 209
27 -13.200[H] COG2227 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase  ali follow..  16  51...................................................................................VLDIGCGGGILSEAMAQR--GASVTGIDMGEAPLAVARLHQLESGVAVDYRQITAEQMAEEMPGQFDVVTCLE-------LEHV----PDP-------------ASVIRACHRLVKPGGQVFLSTINRNPKAYLFAVIGAEYILQLLPR......................................... 174
28 -13.100[J] COG2265 SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase  ali follow..  18  206...................................................................................LLELYCGNGNFTLPLSEKFER--VLATEISKTSVGAAQWNIEA------------NGIGNIKIARLSAEEFTEAYTGKREFARL-TIFVDP-------PRAGIDEETLKLV---SQFDNIIYISCNPETLRAHVVERAALFDQFPFTHHIE....................................... 352
29 -13.100[R] COG4122 Predicted O-methyltransferase  ali follow..  15  64...................................................................................TLEVGVFTGYSSLIVALALPEGKLVACDINEEFTAIAQRYWQKAGVD-----------HKIDLYLAPALETLDKLLVAGEAETFDFAFIDA--KSNY-------DNYYERSLQLIRSGGVI--AID................................................................ 169
30 -12.900[Q] KOG1663 O-methyltransferase  ali follow..  14  95...................................................................................TMEIGVYTGYSLLATALALPEDGILAMDVNRENYELGLPIIEKAGVA-----------HKIDFREGPALPVLDEIVADEKNHGTYFIFVDA--KDNY-------INYHKRLIDLVKIGGVI--GYD................................................................ 201
31 -12.800[J] COG2890 Methylase of polypeptide chain release factors  ali follow..  11  134.............................................................................TEEPTRIMDLCTGSGCIAIACANAFPEAEVDAIDISVDALNVAEQNIQDHGLEQQVFPIRSDLFRDLPQEQYDLIVTNPPYVDQEDMDSL-----EPELGLAAGSDGLLARRILANAPLYLKENGILVCEVGNSM............................................................. 270
32 -12.700[I] COG3963 Phospholipid N-methyltransferase  ali follow..  11  51..............................................................................HSGLPVLELGPGTGVITKAILARIKPESLTAIEYSTDFYNQLLRS-----------------YPGVNFVNGDAFD-LDATLGEHKGQMFDSVISAPMLNFPMAARI----KLLDELLKRVPHGRPVVQIS................................................................. 160
33 -12.400[A] KOG3045 Predicted RNA methylase involved in rRNA processing  ali follow..  13  113.KELKLKPELAQAALEAMEATSSTTPAANSLASKLQSELLGGRFRYINEQLYSTTSRKAEALFRKDSSAFEAYHAGYRPKTAIIGDFGCGEGKLAQSVPNK-----VYSMDLVA---------------------------ARSDIIACNITDT----LQARTLDVAVLMGTDL-------------NEFFLEANRVLKLHGTVYIAEIQSRFQD-FVRCLNACG-FDLNKKDVAVNYFYFFQFKKMRHVPKNTKMKAFSLKPCLYRKR.... 358
34 -12.300[QR] COG0500 SAM-dependent methyltransferases  ali follow..  13  113..............................................................................NDNSFVVEIASNDGYLLQHFLPK--NIPILGIEPAAN----VARTAIAKGVPTLVDFFGSRLALEMIGEGRKADLII--------GNNVLAQVPDL-------------NDFVRGMQLLLKPEGLLRWNSRISSI............................................................ 220
35 -12.200[R] KOG4300 Predicted methyltransferase  ali follow..  14  310.........................................................................FDNLVGKAEKVLEIGIGTGPNF-KYYTDIPNVSVIGIDPNAKMESYARKSATEAGLKP----------EEFTFVHALGESI----LEDASVDAVVGTLTDV-------------TQTLKEIKRILRPGGIYHVAAEDGTFLRLVQTVLD................................................... 440
36 -12.200[R] KOG2904 Predicted methyltransferase  ali follow..  11  198.............................................................................WFKKDIWADLGTGSGAIAIGIAKVGSRGRVIATDLSPVAIAVAGHNVQRYSLEGMIEVREGSWFEPLKDLEGKLVGLVSNYIPSDDIPGL-VGRHEPKLALDGGIDGTSLFHLCHGASRMLQPGGFFVFETNGEKQSKMIVDYMMTSD................................................ 351
37 -12.200[S] KOG4174 Uncharacterized conserved protein  ali follow..  1MGKKARFKEARRLQKRNLNNAIGSSSINSQNSLTNDKIGKGKNKGPTERYVLPF------------------------EKNNRFLLLGEGNFSFAFSLLLHHVSSE-------GFVLATSYDSKEDLKQKYPDAAEYISKIEINGMHEIDATKLHLH-LKTQKFDTIFWNFPHSGKGIKDQDRNIMLLAFFKASKFLLSEKGVIVITAETKPYTLWNLKGLAKDAGYT............................................. 207
38 -12.100[E] KOG2352 Predicted spermine/spermidine synthase  ali follow..  16  460...................................................................................MAVLGLGGGLLTAYLVRHFKKAHVTAVELDPEVLKIANSHFS-----------FPHSDARIDVVIQDALIHLQETAKKPEEEKYDVIFVDVSGSQNAAPSAFLTPEALGNMKNSVKEQGMINLVTRDSEFGKSIKKNIAE.................................................. 594
39 -12.000[O] KOG1661 Protein-L-isoaspartate(D-aspartate) O-methyltransferase  ali follow..  11  1MGGAVSAGEDNDDLIDNLKEAQYIRTERVEQAFRAIDRGDYYLEGYRDNAYKDLAWKHGNIHLSAPCIYSEVMEALKLQPGLSFLNLGSGTGYLSTMVGLI-PFGINHGIELHSDVVEYAKEKLESFIKNSDSFDKF--EFCEPAFVVGNCLQIASD---SHQYDRIYC----------------VQKDHENYMKILLKVGGILVMPIEDQ.............................................................. 194
40 -11.600[J] COG2263 Predicted RNA methylase  ali follow..  14  44.............................................................................GDLDESVQDLGCGTGILAIGAKLL-GARKVVGYDTDPKALEVARKNAERLGV-------------EVEFVCSDIKKVSGHV-------KTTLMNP-PFGARVKGRDR-------PFLSSALRTSEVIYSNRGSLAFIQKFIK...................................................... 158
41 -11.600[E] COG0421 Spermidine synthase  ali follow..  15  92...................................................................................VLVIGGGDGGVLREVVKHECVEEAILCDIDEDVIKVSKQYLPEMSAGFNH--------PKVKVHIGDGFKFLQD--YQNTFDVIITDSSDPDGPAE----ALFQKPYFQLLSDALRGGGVITTQAECMWIHLGVISNVLTA................................................. 218
42 -11.400[R] COG4076 Predicted RNA methylase  ali follow..  17  24.........................................................................EAISSRARGLTYDLGAGSG--ILSFFASEYADRVIAIERDPKIAACAGENLSGL--------------DNVSVVNEDALHY--------EFSAADTIICE-----------LIDEEQVPVLLKFLRNDGTV..................................................................... 127
43 -11.400[S] KOG2912 Predicted DNA methylase  ali follow..  17  73.............................................................................DKKRIIGLDIGTGASCIYPLLGCRMYSYDFVGTEIDKFSFETAKSNILQNNME-----------SQIKIVLRSKQDCLLPDTEGMEEFTFVMCNP-PFYEHEEFKQNPPSGVCTGVYHEMVTEGGEVGFAN................................................................. 195
44 -11.400[L] COG1041 Predicted DNA modification methylase  ali follow..  12  177............................................................................LTKATREVLDPFMGTGGMLIEAGLI--GLKVYGLDIREDMVEGAKINLEYY------------GIRDYVVKVGDATK-IEEVFPGKTFEAVATDPPYGNSTTLPMDRNELYKRSLESIHSVLE-GRLAIAFPADFDARDVAESI..................................................... 304
45 -11.400[S] COG1255 Uncharacterized protein conserved in archaea  ali follow..  17...................................................................................VIEVGIGFYTRIAKRLKEL-GFDVLAIDINKDAVVNAKNS-------------------GLNAEVDDIFNP--NISLYMGAKAIYSIRPTP------------MMNYILKISKAVKVPAYIVPLTGDPVPQGMKLITYRGIPIYK............................................. 128
46 -11.300[S] COG4627 Uncharacterized protein conserved in bacteria  ali follow..  12  2.................................................................................DLKVVVGAGPYNNN---------PGWIHTQEEKL-------------------------------LLDRSMWEKR--FTPESISAIL---------AEHVWEHLTFREAANICYDFLKPSGYIRCAVDGFFRDETYQAVVQV.................................................. 97
47 -11.300[V] COG3510 Cephalosporin hydroxylase  ali follow..  11  75...........................................................................LSELQPSLVIEFGTRYGGSAVYFANIGQPFKVLTVDNSHKALDPRARREPDVLFVESSSTDPAIAEQIQRLK--------------NEYPGKIFAILD----SDHSMNHVLAE--MKLLRPLLSAGDYL-VVEDS............................................................... 192
48 -11.200[D] KOG2360 Proliferation-associated nucleolar protein (NOL1)  ali follow..  11  213.................................................................NKATCLAAELLAPPSGATVLDMCAAPGMKTVHICNVMQNKGIYSVEQDHVRYNTLCEITKDA------------GCDIVKPILGDALNLVEYILVDPSCSGSGMQNRMTVCDEPKEDKRLLQIKILSHAMGAFPNVKRIAYCTWKEENEQVVQRCLQLNPSFKLLSCKKADKDYPNIGKNVLYCQPDSDLTDG--IFLALFEKRREGE 431
49 -11.100[O] COG2518 Protein-L-isoaspartate carboxylmethyltransferase  ali follow..  10  76..............................................................................RKHEDVLEVGAGSGYMAALLAHRGRH--VTTVDIAPELVAFARDNLARN------------GVTNVDVVQGDAGQ-----WGNSLYDVICVS---------------SVPAVPESLLAQLKVGGRLSIFVGSAPVMEAQLITRVSETEFQT............................................ 194
50 -11.100[R] COG1568 Predicted methyltransferases  ali follow..  16  148...............................................................................ENKEIFVLGDDDL-TSVALMLSGLPKRIAVLDIDERLIKFIEKVADEL------------GYNDIEIFTFDLRKPLPDYAL----HKFDTFITDPPETIKAIR------AFVGRGIATLKGPRCAGYFG................................................................. 253
51 -11.000[J] KOG2198 tRNA cytosine-5-methylases and related enzymes of the NOL1/NOP2/sun superfamily  ali follow..  12  275................................................................MDGASTLPPLFLQVKPGERVLDACASPGGKSLLMLQTLHLDHLVCNDIQESRLNKLRKVMQEY-----FDYKERWAGKRLILSQSDARNL-----QYEQFDKILVDVPKPTRIKERLRIPELQAGILANCLRLLRPGGSLVYSTQNDGVVHMALQKVFTE................................................. 448
52 -10.700[J] COG0144 tRNA and rRNA cytosine-C5-methylases  ali follow..  12  240.................................................................DASAQLVGHLLDPQPGEVIIDACAAPGGKTTHIAELMKDEGVWAGDRTASRLRKLKENAQRL------------NLHSIEICIGDSRNLADRVLLDAPCSGLGTLHRHADARWRQTPESVLQKELLAHTSKFVKVGGVLVYATHPAENEEVITEFVAGNSDWQIEPRPDSPYSAYTTPQGWLKVWPHNQDMDG--FFMVRLRKTNVSE 449
53 -10.600[L] KOG2671 Putative RNA methylase  ali follow..  11  217..............................................................................TSGKLVYDPFVGTGSILVSAARF--GAMTMGADIDIRVVRDGRGPDCNVWSNFKQYGLP----MPVALLRMDNNVPPWRSGLKEIFDAI---ICDP-PSTGAYSLVECVHDLLHLAARMLVMKGRLVFFFPVLRDETGSEVKFPEHPCFKLVAVSE-------------QILSSRYSRV------LTMVKVEPYS 418
54 -10.500[E] KOG1562 Spermidine synthase  ali follow..  14  58..............................HEKSKYQDVLVFESTTYGNVLVLDGIVQATERDEFSYQEMLAHLPMFAHPDP-VLIIGGGDGGILREVLKHESVEKVTMCEIDEMVIDVAKKFLPGMSCGFSH--------PKLDLFCGDGFEFLKN--HKNEFDVIITDSSDP-----GPAESLFGQSYYELLRDALKEDGILSSQGECPWLDMKLISTVIHS................................................. 238
55 -10.000[R] COG2384 Predicted SAM-dependent methyltransferase  ali follow..  13  18..............................................................................DNGARLADIGSDHAYLPTYLMQKLVIDFAVAGEVVKGPFEIAKNHVSEADLSDRIEVRLANGLGAIEVIAGMGGILISEILEAGKLGHVKRLILQPNNHEESLRQWLVNHQFVIKKEEILLEAGKFY.................................................................... 154
56 -9.760[R] COG2520 Predicted methyltransferase  ali follow..  13  125..............................................................................LPGESVLIPFAGVGPFVLPSAGK--GAAVCAIEINPDACACLKENVRLNRLE-----------GQVTVIQGDAEYILSHPDSENGFDRAIVPTPY------------DMDHFLGEVSGNVRKEGKIHF................................................................... 236
57 -9.650[M] COG0357 Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division  ali follow..  18  69...................................................................................FIDVGTGPGLPGIPLSIVRPEAHFTLLDSLGKRVRFLRQVQHEL------------KLENIEPVQSRVEEFPSEPPFDGVISRAFASLND----------------MVSWCHHLPGEQGRF..................................................................... 161
58 -9.190[M] COG2230 Cyclopropane fatty acid synthase and related methyltransferases  ali follow..  13  188..............................................................................KEGDKVLDIGCGWGGMGLYLARHL-KANVTGVTLSEEQHAIANQRARDEGLA-----------DRAKFELTDYRNIFDRLVSVGMFEHVGVGH----------------AEYFQHVARLMKPDGVFLLHA................................................................. 293
59 -9.150[R] COG4976 Predicted methyltransferase (contains TPR repeat)  ali follow..  142.............................................................................GGRFRHVTDLGCGTG--LFGERIRDRADFLEGFDLSANM-------LAKAEAKGVYDRLAQADLSLAPEDSGVFGALEQRRADLVSAADVLMYLGNL-------------EGVFVIADRLLAPGGLFAFSVE................................................................ 251
60 -9.100[R] COG1092 Predicted SAM-dependent methyltransferases  ali follow..  12  244...................................................................................VLNCFSYTGGFGLY-ALKGGAKRVINADVSQPALDTAKFNAE--------LNGFDISKKRAVFLNADVFKLLREYRDQGTRFDVVVMDPPKFAESKAQLDGACRKDINMLAMQILNPGGTLLTYSDQVLFQKIIADAALDAGRVKFVERFEQAADHPTDTAYPEGFY....................... 409
61 -9.040[L] COG0742 N6-adenine-specific methylase  ali follow..  15  1................................MKKPNHSGSGQIRIIGGQWRGRKLPVPDSPGLRPTTDRVR-ETLFN-VDAQCLDCFAGSGA--------------LGLEALSRYAAGAT-EMDRAVSQQLIKNLATLKAGNARVVNSNAMSFLAQ-------TPHNIVFVDPPFRRGLLEETI-----LLEDNGWLADETLIYVESEVEN............................................................. 162

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.