current user: public

If you have questions about the server, please let us know.

Query: [S] KOG3136 Uncharacterized conserved protein, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270
# Score Template Links and tools%idFirst MSKSGFSLLFLVLLLIMGFLFPLRVSAIRKDIGFLEERSCRTTVQGRYLISDDEGNVCDALSLESRTRCCPWKGERFSCHGCNILSQCCNSYEFCVSCCLNPSQTLLEKVVKVKVAKPATSGTYKSVFDFCAGRCRHNSESVVHENAYHSEFHHCFSLTSNASGANLTQVETRLLGIDVIVGSQGDSCDAVCKSRGQLCVMNKLSLLNQCDVMKRYMNCKGSCLASAGADQPAEVVEDAPRDLARVCIPGHNHCFPVTVHTNTPDDSAHVPRSLast
1 -116.000[S] KOG3136 Uncharacterized conserved protein  ali  100  1MSKSGFSLLFLVLLLIMGFLFPLRVSAIRKDIGFLEERSCRTTVQGRYLISDDEGNVCDALSLESRTRCCPWKGERFSCHGCNILSQCCNSYEFCVSCCLNPSQTLLEKVVKVKVAKPATSGTYKSVFDFCAGRCRHNSESVVHENAYHSEFHHCFSLTSNASGANLTQVETRLLGIDVIVGSQGDSCDAVCKSRGQLCVMNKLSLLNQCDVMKRYMNCKGSCLASAGADQPAEVVEDAPRDLARVCIPGHNHCFPVTVHTNTPDDSAHVPRS 273
2 -8.660[R] KOG4582 Uncharacterized conserved protein, contains ZZ-type Zn-finger  ali follow..  31  126.............................................................................ECDGCGLAPKCCSNYDLCQKCELAHKHPE....................................................................................................................................................................... 162
3 -8.640[T] KOG3575 FOG: Hormone receptors  ali follow..  10  37.....................................KVCGDRPNNDRYVVKNLKYKCMK-----EQNCLISCTYRNACRYCR--------FQKCFAVGMHSSAIQRRDLVGPRKISGDGEVIICEN.................................................................................................................................................. 128
4 -7.980[TZR] KOG1704 FOG: LIM domain  ali follow..  17  206.....................................AQCNDVLADQKYMQRANKPVCLK--------CFHSSSSTFSCTTCRLGDLHWHASAECFCCC.............................................................................................................................................................................. 272
5 -7.590[S] KOG4543 Uncharacterized conserved protein  ali follow..  12  12...........................................LVGGAHLVNAGGLSISELNIDAD----ISRTHRVGAQRYRQFGTRCWHGESCASCCCGE------------VDEEFVCNSPPGSTDLCVIYETVSIHTDLEKQRKPASSNSLPSDFPDISMNEPQQPSTSENATAVTSEEQPQLIDPFIDFECHVCKVIDGRYDSPVYFMRDPFKPPSRDRAKKPCLNDFLVLGTP-----SAC----NQPVCMSDACSGANFCPCVSRE 248
6 -7.400[R] KOG4729 Galactoside-binding lectin  ali follow..  12  60................................GERITLSCQTGFYGRVLCPPQAGRKHSEANLDPLSMIHHSSTCDRISELCDKRRKCCSKYLQMAYGCIPMSFDEETFCTPKPTDPPRPEIRLE---------CREGRRLAVYSAQMKTSPQCDPETEIRHECVSDVL------PQVLRQCHAKEGCTLKSDGIKGHCRHGHLHVVYVC............................................................... 251
7 -7.320[K] KOG2857 Predicted MYND Zn-finger protein/hormone receptor interactor  ali follow..  15  1.................................................MCPRATQTCE---------CEKVVS-KYKCPSCLV--------PYCSLGCFKIHKV........................................................................................................................................................................ 39
8 -7.320[K] KOG4218 Nuclear hormone receptor betaFTZ-F1  ali follow..  14  25.....................FKMVNYSYDEDLEELCPVCGDKVSGYHYVQNNKRYTCIE-----NQNCQIDKTQRKRCPYCR--------FQKCLSVGMKLE.......................................................................................................................................................................... 108
9 -7.220[T] KOG1829 Uncharacterized conserved protein, contains C1, PH and RUN domains  ali follow..  10  339........................................................................ESQQWKCAACRQCPRFCD-YYFCSLC-LPGDLVKKNKALRAVVELRQKLKHMEGFIKICIDASNQVFEFGNLSTMFASIDRYLLEHDDLFSLNDNKDLLSLLEPLAKRAREHIIHC-KKCRLQAPVCV----------------------CNDMTDRLFAFEERAVSRCEGCGHLSHS----PKPRRDVPRDTHCPCA... 574
10 -7.200[T] KOG1701 Focal adhesion adaptor protein Paxillin and related LIM proteins  ali follow..  14  418......................................RCGENVVG-------EGTGCTAMDQVFHVDC-------FTCIICNNKLRCEPCYEQCNVC---------------KPIMERILRATGKAYHPHCFTCVMCHRSLDGIPFTVDAGGLIHCI----------------EDFHKKFAPRCSVCKEPIMPAPGQEETVRIVALDR----VHCYRCE-DCGGLLSEG------------DNQGCYPLDGHILCKTCNSARRVLTKA.... 608

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 1 8 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.