current user: public

If you have questions about the server, please let us know.

Query: [K] KOG3302 TATA-box binding protein (TBP), component of TFIID and TFIIIB, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200
# Score Template Links and tools%idFirst MADQGTEGSQPVDLTKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEHLSKLAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHSAFSSYEPELFPGLIYRMKLPKIVLLIFVSGKIVITGAKMREETYTAFENIYPVLREFRKVQQLast
1 -89.300[K] KOG3302 TATA-box binding protein (TBP), component of TFIID and TFIIIB  ali  100  1MADQGTEGSQPVDLTKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIREPKTTALIFASGKMVCTGAKSEHLSKLAARKYARIVQKLGFPAKFKDFKIQNIVGSCDVKFPIRLEGLAYSHSAFSSYEPELFPGLIYRMKLPKIVLLIFVSGKIVITGAKMREETYTAFENIYPVLREFRKVQQ 200
2 -71.700[K] COG2101 TATA-box binding protein (TBP), component of TFIID and TFIIIB  ali follow..  37  2.................SEREKITIENIVASTSLAEHLDLSRIALALDGSEYEPEQFPGLIYRLQDPKTAVLIFRSGKVNCTGAKNIEDVKRTIKIIIDKLKAANIEVDDPDIIVQNIVAVYDLESELNLTDIAMSLGENVEYEPEQFPGLVYRVEEPRVVLLLFGSGKVVCTGAKEESEIEQAVIKVKKELQKV..... 181
3 -7.440[R] COG2823 Predicted periplasmic or secreted lipoprotein  ali follow..  15  76...........................................................................QGKVLLVGQSPNAELSARAKQIAMGVDG-----------ANEVYNEIRQGQPIGLGEASNDTWITTKVRSQLLTSDLVKSSNVKVTT---ENGEVFLMGLVTEREAKAAADIASRV......... 177
4 -7.340[S] COG1666 Uncharacterized protein conserved in bacteria  ali follow..  11  9..............................SFDIVSEVDLQEARNAVDNASREVES-----FDFRNVEASFELNDASKTIKVLSESDFQVNQLLDILRAKLLKRGIEGSSLDVPENIVHSGKTWFVEAKLKQ---------GIESATQKKIVKMIKDSKLKVQAQIQGDEIRVTGKSRDDLQAVMAMV............ 153
5 -6.370[T] COG0394 Protein-tyrosine-phosphatase  ali follow..  11  1.......................................MDIIFVCTGNTCRSPMAEALFKSIAEREGLNVNVRSAGVFASPNGKATPHAVEALFEKHIALNHVSSPLTEELMESADLVLAMTHQHKQIIASQFGRYRDKVFTLKEYVTGSHGDVLDP------FGGSI-----KQTRDELEELLRQLAKQLKKDRR... 150
6 -5.820[S] COG4837 Uncharacterized protein conserved in bacteria  ali follow..  4...................................................................LIEVTVFGA-EEKCASCIHLPSAKETMEWLEAAVKR-----------------------KYPEHNFRFRYVDINKVAEKKDQAYADAILSDEYMYLVVIEDEVVAEGNPRLKDVYVKIDAM............ 101
7 -5.690[T] KOG3170 Conserved phosducin-like protein  ali follow..  10  95...LEISGKYYVQEVTKASEGLWVILHLCKRGIPLCAL-LSGLARKFPDVKFIKANSTTCIPNYPDRNLMVFVYLEGDIKLIGPLVFGGMNLTRDELGWKLSESR............................................................................................... 202
8 -5.610[KIT] KOG1620 Inositol polyphosphate multikinase, component of the ARGR transcription regulatory complex  ali follow..  11  72............AVEGSDGAAMMVLENLLAEYTKPSVMDVK-----MGSRTWYPDASEEYIQKCLKKDTGTTTVSSG-FRISGFEDVDGARLTLRKFVSSNSLSDTGSKPDSAFASSVYGGSH-GILTQLLELKTWFENQTLYHFNSCSILMVNDDDARPQVKLVDFAHVLDGNGVIDHNFLGGLCSFINFIREILQSPD 281
9 -5.360[S] KOG4448 Uncharacterized conserved protein, contains phosphotyrosine interaction (PI) domain  ali follow..  12  256..............................................................DISTPDPEFKVSYLGNVLTGWAKGEGCVEKQLNTLWRNYTQHSKPDVIMRLKVCA--------------KATTRQHGLTEYWAHRITYCCAPKNYPRVFCWIYRHEGVLCSKEKIAQDICDTLRENLESLREFKREKI 394
10 -5.270[R] COG3054 Predicted transcriptional regulator  ali follow..  10  58...........................................................................AGKVRVL-AGRTSAKEKNATLIEAIKSAKLPHDRYQTTTIVNTDDAIPGSGMFVRSSIESNKKLYPWVDSNGVARNAWQLKEEGSAVIVLKDGRVQ-DGALTQQEVQQVVDLLHKLLSK...... 185

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.