current user: public

If you have questions about the server, please let us know.

Query: [R] KOG3511 Sortilin and related receptors, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650    .  660    .  670    .  680    .  690    .  700    .  710    .  720    .  730    .  740    .  750    .  760    .  770    .  780    .  790    .  800    .  810    .  820    .  830
# Score Template Links and tools%idFirst MERPWGAADGLSRWPHGLGLLLLLQLLPPSTLSQDRLDAPPPPAAPLPRWSGPIGVSWGLRAAAAGGAFPRGGRWRRSAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDITDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMAPLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSVPIILAIVGLMLVTVVAGVLIVKKYVCGGRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLLELast
1 -198.000[R] KOG3511 Sortilin and related receptors  ali  100  1MERPWGAADGLSRWPHGLGLLLLLQLLPPSTLSQDRLDAPPPPAAPLPRWSGPIGVSWGLRAAAAGGAFPRGGRWRRSAPGEDEECGRVRDFVAKLANNTHQHVFDDLRGSVSLSWVGDSTGVILVLTTFHVPLVIMTFGQSKLYRSEDYGKNFKDITDLINNTFIRTEFGMAIGPENSGKVVLTAEVSGGSRGGRIFRSSDFAKNFVQTDLPFHPLTQMMYSPQNSDYLLALSTENGLWVSKNFGGKWEEIHKAVCLAKWGSDNTIFFTTYANGSCKADLGALELWRTSDLGKSFKTIGVKIYSFGLGGRFLFASVMADKDTTRRIHVSTDQGDTWSMAQLPSVGQEQFYSILAANDDMVFMHVDEPGDTGFGTIFTSDDRGIVYSKSLDRHLYTTTGGETDFTNVTSLRGVYITSVLSEDNSIQTMITFDQGGRWTHLRKPENSECDATAKNKNECSLHIHASYSISQKLNVPMAPLSEPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSVPIILAIVGLMLVTVVAGVLIVKKYVCGGRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLLE 831
2 -25.700[R] COG4447 Uncharacterized protein related to plant photosystem II stability/assembly factor  ali follow..  2.........................................................................................................................VIVKSWQKIFTLLVVLLLCIGCSKVPSTSYNPWAVVSLPTE----AKLLDIAFTENPQHGFLV-------GSSATLLETNDGGNNWQPLNLALDDDRYRF----AGKEGWIVGEPSLLLHTTDEGRSWSRIPLSEKL----PGNPIAIQALGTDIAEMATDVGAIYKTTDGGKNWKAQVEAAVGVVRNLERSVDGKYVAVSAKGSFYSTWEAGQNAWVPHNRNSSRRVENMGFSQDGLWLLA-------RGGQVQFSDPANPDEWLDA-------ETPELATSWGLLDMAYRTPNEVWIGGGSGNLLVSTDGGKTWEKDRDVEEVAAN--------------------------YKVVFLKPDQGFVIGDRGV----------LLKYQPEAAKTATTEPAA..................................................................................................................................................................................................................................................................................................................... 339
3 -21.300[S] COG1306 Uncharacterized conserved protein  ali follow..  8...................................................................................................YWVVIFFFSVFKVFSIYSLTDEEFFYSLFFVHKGFLSKNVNGK-ITKVQVNGINSRWVYPF-YKLVPSRITSIYEDVYSSSSFLTTS--------NNLYVSYDYSKNFRKLVGSGAYITSSAFSQGDYKRIAIGTAIHGIYLSVNGAISFKNLNRLIP-------------------------------QIYLGAGYYDIISAIEFSKEETNNLYFSSGVYGD----IFLISQKSGFIKKISFPFKKQIIRILDLSSKNVEKILV-----RTYDNHFYSYINGQWVFIGKLSLQDQDFFEKSQRMQLAKNKGSIYLTATLRNKKAVDERFKFIKDSGMNAVVIDFKDDNGNLTYSSK---LSLPNKLRSVKNFIDVPYILKKAKELGICVVFKDSKLYYYDNFKHALWNKKTNKPWAHLIKKV------DSSGL---------------VKYVQVEHW----------------VDIFSPATWEYNISIAKE-------IQSFGVDEIQ-------DYIRF-----PSDGPVSLAISRMNKYEMQPVDALESFLIMAREQLYVPISVDI--------YGYNGWFPTNSI-------------------------------------GQNISMLSDYVDVISPMFYPSHYTDDFLPSNFYYTKRAYRIYKEGSDRALAFSLDGVVIRPYVAFLLGKERLVDDEIYLEYLKFQLKGIKESFSGFSLWNASNVYY 601
4 -17.900[G] COG4692 Predicted neuraminidase (sialidase)  ali follow..  12  21...........................................................................................................QCHASTLVRLPCGTLVAAWFAGLREG-----SEDTAIWLSRYEHNIWTTPQRVAAREGEAHWNPVLFYPSDKLWLFYKVGSDVHVWKTWFITSSDRGFTWST-------------APLVNDDILPRGPVKNKLLLASNGA----------------------------------------------------------------IAPGSIESPERWRAFVDRSSDEGKHWSIS-------------------FVPLEPDNAISGTNVALWDGIKKGRLWECCLENLLRWDGVIQPTLWESS--PGHIHMLLRSTRGAIFRSDSIDYGATWSVARATSLPNNNSGI------------------------DLVSMQDGTLILALNPVNGNWGKRYPLSLIASQDNGESWLDLESDHGEYSYSEGGIVHITYTWNRKNIVYCRLQT........................................................................................................................................................................................................................................................................................ 346
5 -17.300[G] COG4409 Neuraminidase (sialidase)  ali follow..  10  46.............................................................................................................FHQSLVKQGSDNVPIWSLLRTKDGVLIAAADKRWIRISHDDGKTWGNITTILDLPSQNTEHSPVMNTSTNPWGDKDNVIRQRIRDPNYSSQYMNSAFLI---------------------------DAQMVQDKRNGRVFLAVDMFPESAGFFHLNGAFNNPGKDGSGRLTIDGKQYLKLIYQDKQWTLREDGS-----------VFDELNRKTQYKVIVKGDPNKNFKDLG-------DVYNENNENIGNIYLTNRKGSKNEKAPFYIPTTS-----------------------------------------YLWMTYSDDNGKTWSSISAQIKKDWMRFLGTGPGVGIQTK---------------------NGNLIFPVYYTNQNNVQSTALIISKDGGKSWEL-LTEAQLVELEN--GELKLFMRNQTGKVMMSTSKDGGYTWVNTEKDHGYSQLSVIKYSKRINGKEYIVFSGQSRSGQGG........................................................................................................................................................................................................................................... 479
6 -14.200[W] KOG3658 Tumor necrosis factor-alpha-converting enzyme (TACE/ADAM17) and related metalloproteases  ali follow..  47............................................................................................QVTRRKRSIDSAASHYQEPIGFRFNAYNRTFHVQLHPIDDGGYADIKPSHFLYEGYLKDDPNSHVHGSVFDGVFEGHIQTGEGRRDKAAKYFERDDRPTQYHSIIYRDDERDAENLSEQMQGCGFSSRVRREMTDVQNSGESTDFFTNYMTMGGRSKRANTLRDHDGLYFVRTCSLYMQADHKLYEHIRMKEG---NNDPIRTREEIVSLFYNHIKAVNEIYEGTNFNGIKGLHFVIQR-------------------------------TSIYTPDSCDRGRAKTDSDNPFC-------EENVDVSNFLNLNSQRNHSAFCLAYALTFRDFVGGTL----GLAW-----------------ASPQFNTAGGICQVHQRYNEGSRGWVYRSLNTGIVTLVNYGNRVPARVSQLTLAHEIGHNFGSPHDFPAECQPGLPDGIMFASATSGDKPNNGKFS-----SVKNISAVLAVVLKSMPVDPTRNASPVGI-------------------FQERTSAFCGNQIYEP-----------GEECDCGFSQADCDQMGDK-CCVPHEARGNGGPGPCKCSPSQGYC-----ICRQESEC---------SNLQTCDGRNAQCPVSPPKH-DGIPCQDSTKVCSSGQCNGSVCAMFGLED.................................................................................... 643
7 -11.200[R] KOG3669 Uncharacterized conserved protein, contains dysferlin, TECPR and PH domains  ali follow..  241......................................................................................................................PTGSELAQISVGPTGLVWAVLHNGRVIVDNLVGDSWLDVKTPVAASSLR----IVHVSVGTDAVWCV------TNDHHAWFDSAIGKGWVEMVGNISMVS-----AANDQVFAIGAADRCLYHADPTGKKWRLIQCPMQISRTSSSLSIVSRKSGGSSS----TPGSKHQSFSNLYSKEKEKGVVETCAVIETVLNSSTGSCSSERWKLSADSPPTIGSLNLNDRHKQRTAALRETSHASSAPAADVVEVVTGKFETQLRNPRAWSPVRSVSVVGTEAHPESDSTVFESDSTHHGSDVFLGEDDDHTGSQFWTECGILWSCVASGNEQTSDSKVDVNANWRKDIVNKLQRRQEKLAKLQTVAKFEKA-------ELSSWVKSADARYQRP---GGEFEDCIIELEWVSSGSGTDTNSSENSRSGDSGTFVLSPDGAATKIQFPLSD----ITCVQCCSEAGAPRIAIH---APHLPVNCSPVKLQFSS-------DSEMEDWLSHLSS............................................................................................................................................................................................................. 757
8 -10.900[T] COG3292 Predicted periplasmic ligand-binding sensor domain  ali follow..  42..........................................................................................TSTDGLPHNSINSIAQTRDGYL---WFATWEGVTRTLLPMDNNGLLVAGARGSITHRQSYGQSFRSAPSLVNGALIDDAQNLWLAIEGLGVVVRPYLRLVKNQHGVIFAATDKG--LYRFNDWQASAMELPIGRYERINYISISLNQELVVATDQG-INTEEGFQSLFVPLEKEVVTLAEQDRAGNWWIGTVNRGIARLKNQQLQFLEPSRGLPYSRVLSWY--------QDIEGSVWVGTNAG---------MRLRDAPFININSDKGLVGDYVRTLLPLDDRRVMVGTSRGLS-------IIEEGLAHSALMPQVGARPSILSLAKADQQGEKVWVGTVQKG---LLWQNGQLRPVLDENNGLPSSEVRAIVTDPQDNLWIGTSNGIVKRTPQGVLTTYNKDNSPLPDDYIMALAVDSEGKLWVGSAVGVAYF---DAQGKIRPVDLTKQEQAQYVFGFESDYVWMAVRYRLSDASVSLVGRAAGLPIDK--FFQMLRDSEGHVWLVWKLNYDQMLAVADGMSTQLEFEHFDEGDGMATSQANGGTNPASASLPNGELLFATAK............................................................................................................................................................................... 627
9 -9.570[PT] KOG4294 Non voltage-gated ion channels (DEG/ENaC family)  ali follow..  11  250................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................SYSAEELLVTCFFDGVSCDARNFTLFHHPMHGNCYTNNRENETILSTSMGGGLQVILYINEEE----FLVSSTG-----------KVIIHRQDEYPSVEDVGTEI-TMVTSIGMHLTESFKLS-----SSQCTEGGSDVPIRNIYNAAYSLQICLH-------------SCFQTK------MVEKCGCA------QYSQPLPPAANYCNYQQHPNWMYC------YQLHRAFVQEELGCQSVCK-------------EACRFKEWTLTTSLAQWPSVVSEKWLLPVLTWDQGRQVNKKLNKTDLAKLLIFYKDLNQRSIMESPANSIEMLLSNFGGQLGLWMSCSVVCVIE 548
10 -8.660[O] KOG4400 E3 ubiquitin ligase interacting with arginine methyltransferase  ali follow..  11  54................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................DERQKKKRSEYRRLRRINQRNRDKFCFAGHIVQ-EAKDNVSICFR----SKEHSLNACSC----FICENGHLSGQ----CEQNPKGLYPKGGCCKFCSS-----VHHL---AKDCDQVNKDDVSFGTTGADEDVEYAKTVAAPTKKRPVKPVKKLVTF................................................................. 218

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 1 8 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.