current user: public

If you have questions about the server, please let us know.

Query: [O] KOG4265 Predicted E3 ubiquitin ligase, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350
# Score Template Links and tools%idFirst MGSILSRRIAGVEDIDIQANSAYRYPPKSGNYFASHFFMGGEKFDTPHPEGYLFGENMDLNFLGSRPVQFPYVTPAPHEPVKTLRSLVNIRKDSLRLVRYKDDADSPTEDGDKPRVLYSLEFTFDADARVAITIYCQASEEFLNGRAVYSPKSPSLQSETVHYKRGVSQQFSLPSFKIDFSEWKDDELNFDLDRGVFPVVIQAVVDEGDVVEVTGHAHVLLAAFEKHMDGSFSVKPLKQKQIVDRVSYLLQEIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCTSCADTLRYQANNCPICRLFPGPPADPGGAEEARSPVPRVLQPRPGPEPGALast
1 -101.000[O] KOG4265 Predicted E3 ubiquitin ligase  ali  100  1MGSILSRRIAGVEDIDIQANSAYRYPPKSGNYFASHFFMGGEKFDTPHPEGYLFGENMDLNFLGSRPVQFPYVTPAPHEPVKTLRSLVNIRKDSLRLVRYKDDADSPTEDGDKPRVLYSLEFTFDADARVAITIYCQASEEFLNGRAVYSPKSPSLQSETVHYKRGVSQQFSLPSFKIDFSEWKDDELNFDLDRGVFPVVIQAVVDEGDVVEVTGHAHVLLAAFEKHMDGSFSVKPLKQKQIVDRVSYLLQEIYGIENKNNQETKPSDDENSDNSNECVVCLSDLRDTLILPCRHLCLCTSCADTLRYQANNCPICRLFPGPPADPGGAEEARSPVPRVLQPRPGPEPGA 350
2 -39.100[O] KOG1571 Predicted E3 ubiquitin ligase  ali follow..  18  219..............................................................................................................................................................................................................IKRFEDAKTTTILKLVVCSTISAILVAFIAKKLYRKRKQEREEAKIRERLDTERRERRARSRPHTLSQDQLCVVCSTNPKEIILLPCGHVCLCEDCAQKIS---VTCPVCRGSIVSKAAAFIA..................... 338
3 -36.900[O] KOG4275 Predicted E3 ubiquitin ligase  ali follow..  21  603....................................................................................................................................................................................................................TVKQLKEVLMLHRVDYKGCCEKQELLDRV---------------SRLWKTMRECPAVEKLATDELCKICMDAPIECVFLECGHMATCTSCGKVL----NECPICRQYIVRVVRFFRA..................... 700
4 -33.500[O] KOG1100 Predicted E3 ubiquitin ligase  ali follow..  28  266................................................................................................................................................................................................................................................................RWKLAGEAQDTKKMCRVGMSMCRSCGKGEASVLLLPCRHMCLCSVCGSSL----NTCPICKSPKTASLHVNLSS.................... 335
5 -30.300[O] KOG0823 Predicted E3 ubiquitin ligase  ali follow..  18  95................................................................................................................................................................................................................................................................YLIAKALNMEKTSSVPGGFFDCNICLEKAEDPILTCCGHL-FCWGCFYQIYLNIKECPVCDGEVAEVIPIYGNGDDCDGTKPKLEDCGPPRPNA 195
6 -28.500[O] KOG0978 E3 ubiquitin ligase involved in syntaxin degradation  ali follow..  15  774..........................................................................................................................................................................................................LKSAVSSSEKEYEQISRRTDDIKLELDDEREKKKLEEELM--ELNKELEELGSESVEAAIVRLQEEVKNCKNILKCGVCFDRPKEVVIVKCYHL-FCQQCIQRLEIRHRKCPGCGTAFNDVRLVKM...................... 899
7 -25.900[R] COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers  ali follow..  16  233................................................................................................................................................................................................................................................................KGAKLEEGMVKNEKKEDIPFVCLICKKDYRSPIATTCGHH-FCEQCAITRYRKTPTCIQCGADFDRLLKNRKSKNDEAVKQKVGGFESNNS... 332
8 -25.800[T] COG5432 RING-finger-containing E3 ubiquitin ligase  ali follow..  22  23................................................................................................................................................................................................................................................................................DTLLRCHICKDFLKVPVLTPCGH--FCSLCIRTHLNNQPNCPLCLFEVSEIIQSYTSLRSS................. 93
9 -25.800[L] KOG0287 Postreplication repair protein RAD18  ali follow..  22  23................................................................................................................................................................................................................................................................................DTLLRCHICKDFLKVPVLTPCGH--FCSLCIRTHLNNQPNCPLCLFEVSEIIQSYTSLRSS................. 93
10 -25.700[O] KOG4692 Predicted E3 ubiquitin ligase  ali follow..  15  449...............................................................................................................................................................................................................................................................IDSLRVKQTLLSDITLPSEDSLCPICCAKPITAVFTPCKHQS-CSDCIMQHMMNSKVCFYCKTTIQTIETLDGTVIFSNDDVVQTPMIERA.... 538
11 -25.000[O] KOG1813 Predicted E3 ubiquitin ligase  ali follow..  20  250..........................................................................................................................................................................................................................................................NKAMGVEDEDDEADKDSDEDENALPFACFICREPFVDPVVTKCKHY-FCEHCALKHHTKNKKCFVCNQPTMGIFNA........................ 324
12 -24.900[O] KOG0320 Predicted E3 ubiquitin ligase  ali follow..  18  245................................................................................................................................................................................................................................................................ASPPKRVNRDIDESQKEELYKCPICMDSKREPVSTKCGHV-FCRECIETAIRATHKCPICNKKLRQFFRIYL...................... 319
13 -24.700[DR] KOG1101 Apoptosis inhibitor IAP1 and related BIR domain proteins  ali follow..  16  501...............................................................................................................................................................................................................QIPLQARELIDTILVKGNAAANIFKNCLKEIDSTLYKNLFVDKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLR----KCPICRGIIKGTVRTFLS..................... 618
14 -24.600[O] KOG0317 Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein  ali follow..  20  233................................................................................................................................................................................................................................RKRTNDSITRSSVGLQERSEHESIEGIPKESQLTHINLSDKNQLPFIPEASRKCILCLMNMSDPSCAPCGHL-FCWSCLMSWCKERPECPLCRQHCQEILVLR....................... 336
15 -23.400[O] KOG3800 Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor  ali follow..  29  1...................................................................................................................................................................................................................................................................................KECKKCKSNQLVMMINECGHP-LCKNCVDNFALNSGNCHVCNRVLRK............................ 52
16 -22.700[O] COG5540 RING-finger-containing ubiquitin ligase  ali follow..  16  268................................................................................................................................................................................................................................KSKTRRFIEDLPSRTISREGFYSEEEEIENSTQNGELVPLMDESTRRATFGVECVICLES--KVVALPCKHE---RPCIAKIVDYRHACPTCNTEV.............................. 366
17 -22.300[O] KOG0824 Predicted E3 ubiquitin ligase  ali follow..  27  3................................................................................................................................................................................................................................................................ASTSSPSQQLQQAINSTIDKECAVCYSEMILPTTIPCGHK-FCFICLKGVSVSNNDCPICRGPIDS............................ 69
18 -22.100[O] KOG4172 Predicted E3 ubiquitin ligase  ali follow..  22  1..........................................................................................................................................................................................................................................................................NGAQEVNEGDECTICMDAPVNSVLYTCGHMCMCFECGRRLLTTKGTCPICRAPVQDVIKTYKS..................... 63
19 -21.900[O] KOG0826 Predicted E3 ubiquitin ligase involved in peroxisome organization  ali follow..  13  198.......................................................................................................................................................................................................................................FFLQFVQWWYSNDQRRKVGGTLINPEAMPRKQLPKEVQQSLPQRGECPVCLLSIQTTACSVSGYV-FCWKCIVSHMKEHGTCPVTHYPIDDLVRIYET..................... 297
20 -21.700[O] COG5243 HRD ubiquitin ligase complex, ER membrane component  ali follow..  17  303.......................................................................................................................................................................................................................................VVWDILALYQSGTSLWKIWRNNKQLDDTLVTVTVEQLQNSANDDNICIICMDENKKPKRLPCGHI---LSCLKNWMERSQTCPICRLPVFDEKGNVVQTTFTSNSDITTQTTVTDSTGI 433
21 -21.500[O] KOG0800 FOG: Predicted E3 ubiquitin ligase  ali follow..  21  90...........................................................................................................................................................................................................................................................................KESFTVMDSQCSVCLGDPNDKLQIPCKHT----DCIDLWLTSHTTCPLCRLALIPSRSRQSQDDPVPSLVSPDEEVSSQPESE 175
22 -21.300[O] COG5574 RING-finger-containing E3 ubiquitin ligase  ali follow..  12  109..STPSDSTQQPPTNTLPSVSASSQSVETCETVDEDIDTQTMSSDMSEVQSMEISLNCDHEFFEKLTSELQSVEGLQREQRKILFNAIDILSHEISLIASPNSKKKYKSLYCWRKI-------FEIYMDS--DIFISCKEADQSHERTPELAERHLKWFDDQVR----------------LAKCLPSSSKHRDRILYAKFLELNESLLKVASFQQMNKLAVTKIMKKFDKRTSLTAQPLFQVIESDPLLLVDNASKAICFSLSSKLFSIIPQLRDFECAICSNVAYKPVRLGCSHV-FCLHCLIIQKQKVDFCPLCRAKLMNFMKTYFPREIKEKFEENENDTFTPS... 442
23 -21.100[O] KOG0828 Predicted E3 ubiquitin ligase  ali follow..  25  681...................................................................................................................................................................................................................................................................SNEYISEHGGGTAEHTVDCAICMSDQHSYMVTPCNHV---TSCLENWMNYKLQCPVCRSPLPPL........................... 758
24 -20.900[O] KOG0801 Predicted E3 ubiquitin ligase  ali follow..  26  150...................................................................................................................................................................................................................................................KSVASDEMEMHFIMCLSKPRLSYNDDVLTKDAGECVICLEE--DTI-LPCLCI---KSCIDSWFEVNRSCPEHPAD............................... 227
25 -20.500[O] KOG4628 Predicted E3 ubiquitin ligase  ali follow..  25  224..........................................................................................................................................................................................................................................................................TKNNANNKYDTCVICLEDEDDKLVLPCSHP---THCIDPLTENRRVCPICKRKVFTKGEARASRSRQPSLDNVTDTDDDTTP.. 308
26 -20.300[O] KOG0802 E3 ubiquitin ligase  ali follow..  18  323...............................................................................................................................................................................................................................................SAILKRIKGYIKLRIALGALHAALPDATSEELRAYDDECAICREPMAKAKRLHCNHL---LGCLRSLDQGLNSCPTCRKPLFVGRTENEVNPRTVEVSSDEQLARQLERQN 436
27 -20.000[O] KOG1645 RING-finger-containing E3 ubiquitin ligase  ali follow..  31...........................................................................................................................................................................................................EEEDEEEEDEEEAYVDYGEVQEEDEEEEEEEDSERQTREYIDVLDSPVRVSQNESEGIENQNRRMSNGNKVTLRDCLVLSVGPAVANTKSGIL---IVFPVDCMDSTSGFSSDEVEGRDVRKIYASRVAAVDDEAHKR......... 176
28 -19.300[R] COG5222 Uncharacterized conserved protein, contains RING Zn-finger  ali follow..  269................................................................................................................................................................................................................................................................IDGDETIWRKGHFKDLPDDLKCPLTGGLLRQPVKTSCNI-DFSKEALENLVESDFVCPNCETRKEKEVETFLKKQEELHGSSKDGNQPETKKMK 376
29 -19.100[O] KOG2231 Predicted E3 ubiquitin ligase  ali follow..  20  27................................................................................................................................................................................................................................................................TDNAAVKPEALESYTGNDDNACVVCFKNVEIFSIGDCDH--VCYECSTRMRCQQNECPICRHVLSKVLFTLDKLPYRELEANNRSDLYSKKYRI 121
30 -18.700[O] KOG0827 Predicted E3 ubiquitin ligase  ali follow..  14  3..................................................................................................................................................................................................................................................................................NLNCVICAEL--EVFATVCGHM---HNCLNQWLDRSKTCPQCRNKCRNIFRVYFNLANLDVSHIDVGSLQE..... 77
31 -18.400[DKL] COG5220 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3  ali follow..  21  2..........................................................................................................................................................................................................................................................................DDEGARKVDEKCPLCQADRKLLINPECYH--MCESCVDRIFTTGPATPGCNKILRK............................ 65
32 -18.000[R] KOG3002 Zn finger protein  ali follow..  18  1............................................................................................................................................................................................................................MAPGGSALKEALESNSTGVDYEVKMAKVEANSKPTKSGSGSIGKFHSSNGVYE---ECPVCTNLMYP--IHQCGHT-LCSSCKLRV---QNTCPTCRYELGNI----RCLALEKVAESLEVPCRYQNLGC 122
33 -16.400[O] KOG2879 Predicted E3 ubiquitin ligase  ali follow..  15  296................................................................................................................................................................................................................................................................KNILSPFAKDKSSSTKEDTVTCPICQVDPAIHLKELTCRR-YCYYCRTRCASAASRCLRCNEPVVAIQREGVSSGK.................. 389
34 -16.300[O] KOG3970 Predicted E3 ubiquitin ligase  ali follow..  17  10..........................................................................................................................................................................................................................................KVTNLFCYEHRVNVCEFCLVDNHPNCVVQSYLTWLTDQDYDPNCSLCKTAEGDTIRLNCLHL---WKCFDEWAANGYRCPCCSQEVFPPINEVSPLIEKLREQLKQSNWARAALGL 134
35 -16.300[DR] KOG4739 Uncharacterized protein involved in synaptonemal complex formation  ali follow..  16  6.....................................................................................................................................................................................................................................................................................CNHCGIKPNQTYLTACGHV-FCQNCTKA--AFNSQCYLCKKPL-KVDEINKNLRPD................. 59
36 -15.600[R] COG5236 Uncharacterized conserved protein, contains RING Zn-finger  ali follow..  22  30...................................................................................................................................................................................................................................................DRKNFRRKQKKNNLSAEPNLTTSSADDTDEENELCVICARKLTYVSLTPCHH--TCHICGFRQRYNKKSCLICRTENEEVMFTDRIDGDISDKYN............ 125
37 -15.600[O] KOG2164 Predicted E3 ubiquitin ligase  ali follow..  18  207..............................................................................................................................................................................................................................................................................SDFQLAACPFCLEEPVAARMSRCGHV-YCFSCTKIVKCGHRSCPICWDSIRDVHPIRWVEDKEFQKLEE........... 297
38 -15.400[S] KOG3899 Uncharacterized conserved protein  ali follow..  156.................................................................................................................SAVASEIGIEFRQPEIYKKKLNSISSVIATQNWIIKTTMYN--------------HFAHQSNTSLSVAKAETYNISHQDQNDTLQMISIIVRPMRQGVSDFHIRINALEFRNLENRVRRPIAIPSNIQLHRNVIDRFVDVFKAQVAQNPIFPDDATTE-----KCFACMLNEPNTKIHKCRPM--CVECLEVWLEQKCTCPMCRAKVLDVSYITTTVDATNSTQSQGTEED...... 404
39 -15.200[S] KOG2660 Locus-specific chromosome binding proteins  ali follow..  14  15....................................................................................................................................................................................................................................................................................SCSICDNILRDA------TT-ISEKCYEKITEDEIECPVCNIDLQDLRKIFALKRRKVKAPGIVSLPGKRK... 95
40 -14.800[O] KOG4159 Predicted E3 ubiquitin ligase  ali follow..  16  6..............................................................................................................................................................................................................................................................................................EPVTTPCGH-SFCKNCLERCLDHAPYCPLCKESLEELIVKYLPDELSERKKIYDEETAELSH.. 81
41 -14.500[K] KOG4218 Nuclear hormone receptor betaFTZ-F1  ali follow..  23  17..............................................................................................................................................................................................................................................................GLTPIVSQFKMVNYSYDEDLEELCPVCGDKVSG--LLTCE--CTCQNCQ---KTQRKRCPYCR--FQKCLSVGMKLEAVR................ 111
42 -14.300[T] KOG3575 FOG: Hormone receptors  ali follow..  14  1..................................................................................................................................................................................................................................................MSPLKMHVNMLQSDHALIMSSFPEPSPSSKRPTENCKVCGDRPNN--ASACL--CKCQNCL---CTYRNACRYCR--FQKCFAVGMHSSAIQ................ 107
43 -14.300[O] KOG1734 Predicted RING-containing E3 ubiquitin ligase  ali follow..  20  300.......................................................................................................................................................................................................................................................................GGRLDDSEHVHDADAVVTTKMVEDLYKLSCGHV---EFCIRGVVGKLQTCPYCKERVD............................. 362
44 -14.200[O] KOG1039 Predicted E3 ubiquitin ligase  ali follow..  15  211..........................................................................................................................................................................................................................................................AHEKICMLTFEHEMEKAFAFQASQDKVCSICMEVILEKILSNCNH-TYCLSCIRQWRCAKKSCPECRVISEFVIPSVYWVEDQNKKNELIEA........ 317
45 -14.200[R] KOG2789 Putative Zn-finger protein  ali follow..  27  147.................................................................................................................................................................................................................................................................................NAMECPICF------LYYPC---CICSECEFDLISEPAKCPYCMTERFGVI.......................... 220
46 -14.000[O] KOG3268 Predicted E3 ubiquitin ligase  ali follow..  20  294........................................................................................................................................................................................................................................................................ARAILEKSDFTMDCGICYAYQLDGTI-QCGH----QICLYEWLRGLGECPYCSKPIT--LKMSGRKH................... 375
47 -13.700[K] KOG2393 Transcription initiation factor IIF, large subunit (RAP74)  ali follow..  19  8..................................................................................................................................................................................................................................................................................NTSCVGC-GSQSDLYGSSCRHMTLCLKCGRTMAQNKSKCHECGTVVTRLIRVRAAAPTDKNYFIGRFVTGLPNFKK 85
48 -13.600[S] KOG4445 Uncharacterized conserved protein, contains RWD domain  ali follow..  16  24............................................................................................................................................................................................................LTGEEEEQQYVCVTLQVHPTPGYPEESPTFKLLRPRGLDDARLEAIRSACNAKIKESEVVREHLSGSNLPSGQCVVCLYGFADFTRTECFHY---SYCLARHLNALRRCPVCREHIGDETDSLKCAMPPSELLNAPEFKVTEE... 201
49 -13.600[T] KOG4825 Component of synaptic membrane glycine-, glutamate- and thienylcyclohexylpiperidine-binding glycoprotein (43kDa)  ali follow..  18  733................................................................................................................................................................................................................................................................GGKAAPAEALGIPDEHYLDNLCIFCGERSES-MLTRCEHLC-CYRCSEAVFKEANRCPLCHENFAHLMGCTMNLRKTHILQKAPALQPGKSSAV 893
50 -13.100[O] KOG3579 Predicted E3 ubiquitin ligase  ali follow..  22  456..............................................................................................................................................................................................................................................................GGLEPVHPASLPDSSLATSAPLCCTLCHERLEDTHFVQCSH--FCFPCSQSIKQQGASCP-CQGEIATILDVKVKKERDS................ 560
51 -13.100[R] KOG4602 Nanos and related proteins  ali follow..  19  212................................................................................................................................................................................................................................................................PPLGQDQGLGAPGANGGLGTLCNFCKHNGESRHVYS-SHVCVCPVCAHTLKY----CPLNGGQQSLYRRSGRNSAGRR................ 305
52 -13.100[R] KOG4323 Polycomb-like PHD Zn-finger protein  ali follow..  21  174..................................................................................................................................................................................................................................................................NPNATALKRKSRKVDMVTLCSVC-SPLSNRIVF-CNHQ--CHH-DATVQDVDAECMKCQYR............................... 246
53 -13.000[K] KOG2068 MOT2 transcription factor  ali follow..  22  2..............................................................................................................................................................................................................................................................................SDYGEKTCPLCAEDLTDQQLKPC---CICVWCWHHIMDMAEKCPACRTPYDKEKIVGMTVDQERLASEGNMDRKKIQ... 87
54 -13.000[K] KOG3815 Transcription factor Doublesex  ali follow..  1.........................................................................................................................................................................................................................................................MNGYGSPYLYMGGPVSQPPRAPLQRTPKCARCRNHGVLSWL---GHKRYCKDC---------TCEKCRQRVMAAVALRRQQANESLESLIPDSLRALPGPP 98
55 -12.900[K] KOG1244 Predicted transcription factor Requiem/NEURO-D4  ali follow..  20  328...................................................................................................................................................................................................................................................................................KCCNICGTSENDDQLLFCDD---CDRCLTEPPEGSWSCHLCLD................................ 376
56 -12.900[S] KOG4638 Uncharacterized conserved protein  ali follow..  348...............................................................................................................................................................................................................................................................SRKEVHYGSYATTEQATCVPSARRRCTPQFFFAIAFQSGEV-FLHIAIIFVYE--------VERM.............................. 413
57 -12.700[R] KOG4299 PHD Zn-finger protein  ali follow..  1MDAKPWNHTSEAFQASILEDLKIIQKAGAERNAKSSHGSINSRSASPNKATSRRNRAQNGNSNGRASVDNSDDGSKDDLDYSPSVKRKHVNGEGAEKGDHDTSNNGPSITKLRRKVRRTYDTKDGF------------VAWNTLDDDFRPIVPDQERSRKINPQKGNNNNLLKENKSLKTTAKDLSDISSSSMKKANNSSKPLFSGKLTFKANIPVPTSEVVTENNVTRNVTVYSNQKHLGNESENFNDMEGRAEDISSNELLPTPEEYPYRYNNDYCSACHGP---------GNFLCCETCPNSFHFT---CPICNE................................ 308
58 -12.500[U] KOG2066 Vacuolar assembly/sorting protein VPS41  ali follow..  572.............................................................................................QLYAEYDQKKLLPFLRKNANYNVNKARKLCSDKGYIEETIYLLAKSGNHYDAVKMMVREYRNMEKVIDYCKDQNDPDLWIHLLGVVAEFPAHFSQLIIEASNCLDPLLIMDKLPDDSD--IPNLSEALDKLLVDYTNHAELQQCCYDSTLNDLNVLTQGLISAADESVS----------NIVSRCSLCTKKFSDIKVFKCGHICSTSEMERRQSIEEGLCIACSDQ-IELINV........................ 807
59 -12.400[OD] COG5194 Component of SCF ubiquitin ligase and anaphase-promoting complex  ali follow..  14  49...............................................................................................................................................................................................................................................................................DIAVDNCAICRNHIMEAAWGVCNHA---LHCINKWIKTRDACPLDNQPWQ............................. 115
60 -12.300[K] KOG4215 Hepatocyte nuclear factor 4 and similar steroid hormone receptors  ali follow..  20  28..............................................................................................................................................................................................................................................................GNDTSPSEGTNLNAPNSLGVSALCAICGDRATG--ASSCD--CSCRQCV---KDKRNQCRYCR--LKKCFRAGMKKEAVQ................ 122
61 -12.200[O] COG3058 Uncharacterized protein involved in formate dehydrogenase formation  ali follow..  14  168...............................................................................................................................................................................................................................................................WAQMANLIPGKARAEYGEQRQYCPVCGSMPVSSMVQIGTTYLHCNLCETEWHVVRVKCSNCEQSGKLHYWSLDDEQAAIKAE............. 253
62 -12.100[DO] KOG1493 Anaphase-promoting complex (APC), subunit 11  ali follow..  21  65..............................................................................................................................................................................................................................................................................LQGGEDTCGICRMEFESAVLGICRHACIDKWIAAPTNQPRAQCPLCRQDWT............................. 132
63 -12.100[R] KOG1313 DHHC-type Zn-finger proteins  ali follow..  12  82...........................................................................................................................................................................................................................................TLAISTLSTFILVAFKCAGKPTNILYGTHPGVGNGALNNYTFCNYCSKPKSP----RTHHCRTCGMC---VLDMDHHCP-CKYFIAFLISAVI...................... 176
64 -12.000[R] KOG0490 Transcription factor, contains HOX domain  ali follow..  24  4....................................................................................................................................................................................................................................................................................HCAGCERPILDRFLLNV-HICVCCECKTNLSEKGTKCAGCAQGISPVRKA........................ 80
65 -11.900[T] KOG0297 TNF receptor-associated factor  ali follow..  22  26.............................................................................................................................................................................................................................................................................TKLEAKYLCSACRNVLRRPFQAQCGHR-YCSFCLASLSSGPQNCAACVHEGIY............................ 78
66 -11.900[K] KOG4577 Transcription factor LIM3, contains LIM and HOX domains  ali follow..  19  1........................................................................................................................................................................................................................................................MMQSATVPAEGAVKGLPEMLGVPMQQIPQCAGCNQHILDKFILKV-HSCLCADCQMQLADRGTKCTACQQGIPPVRKA........................ 105
67 -11.900[K] COG5175 Transcriptional repressor  ali follow..  17  12................................................................................................................................................................................................................................................................AIHNALSNFDTSFLSEDEEDYCPLCIEDITDKNFFPC---CICQFCYNNIRQNNGRCPACRRKYEELKMERAKLARKEKERKHREKERKEN... 120
68 -11.800[R] KOG1312 DHHC-type Zn-finger proteins  ali follow..  16  111............................................................................................................................................................................................................................................................DSKDHKSGSTEEYPYDYLLYYPAIKCSTC------RIVKPSKHCSICNRCVLVA---DHHCI-CLQFYLFLISN........................ 186
69 -11.600[K] KOG2845 Activating signal cointegrator 1  ali follow..  10  2.....................................................................................................AVAGAVSGEPLVHWCTQQLRKTFGLDVSEEIIQYVLSIESAEEIREYVTDLLQGNEGKKGQFIEELITKWQKNDQELISDPLQQCFKKDEILDGQ-------KSGDHLKRGRKKGRNRQEVPAFTEPDTTAEVKTPFDLAKAQENSNSVKKKTKFVNLYTRERQDRLAVALPGRHPC--CLGQ---------KHKLICLICGRIVQEGSGPCLFCGTLVEEQDILQRDSNKSQKLLKKLMSGVENS... 237
70 -11.500[R] COG3582 Predicted nucleic acid binding protein containing the AN1-type Zn-finger  ali follow..  18  2.....................................................................................................................................................................................................................................................................SAAIEKETGMLDVGKHCAYC--RQLDFLPFHCSF---CNECSNHRLKEDHHCR.................................... 51
71 -11.500[O] KOG1814 Predicted E3 ubiquitin ligase  ali follow..  15  157....................................................................................................................................................................................................................................................................AFDKNAKLLEFQIRKFQCNVCFDEFNGT-LTRCGHV-SCQSCLRDYMFSQIKCI-CGKDAPKELESIVGVQLTNRYKELEEKR....... 255
72 -11.500[S] KOG4367 Predicted Zn-finger protein  ali follow..  28  2.............................................................................................................................................................................................................................................................................EEMEEELKCPVCGSFYREPIILPCSH-NLCQACARNILVQTPTCPQCHRSLEGVIDRYQQSKAAALKCQLCEKAPKEA... 178
73 -11.400[O] KOG0006 E3 ubiquitin-protein ligase (Parkin protein)  ali follow..  8..........................................................................NSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQSIVHIVQRPWRKGQEMNATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGK--RVQCSTCRQATLTLTQEFFFKCGAHPTSDKETPVALHLIATNSRNITCITCTDVRSPVLVCNSRHV-ICLDCVTRLNDRQ-PCVAPNSLIKEILGEEQYNRYQQYGAEECVLQMGPRPGC 309
74 -11.400[K] KOG4216 Steroid hormone nuclear receptor  ali follow..  18  77................................................................................................................................................................................................................................................................LREFFSFLLPALRKAQIEIIPCKICGDKSSG--VITCE--CSCKNCL---RTSRNRCQHCR--LQKCLAVGMSRDA.................. 167
75 -11.200[K] KOG2169 Zn-finger transcription factor  ali follow..  14  373............................................................................................................................................................................................................................................FVHRVNSDILFKRLNQNVSRHRSLEVTKQEVIKKLSGGEDDIAMDLCKTR--MTTPCTHL--CFDLLSYLMMNEKKCPVCSSNFLDML-----AKVDKNTTEVELKED----GS 503

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 6 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.