current user: public

If you have questions about the server, please let us know.

Query: [K] KOG4319 DNA-binding nuclear protein p8, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340
# Score Template Links and tools%idFirst MRRRFLLPVHGPQQRNVCFWGLDGGLLAELETFFRTNRNSRRSGWVFQESACADAWPQTAGQCQQAGPQAQTRPPTPISYKEELYRCLYYYCLRYFPACGVGRSKGLTLSEQALRTKRLSPGGHASRRICCHHWGTLAQECSSMGAGGTQGVALAMARGCCCLGMTWSEKVVGGNEKALAGQKQPCGVPEWQQARAARVIHPRDSYEKPRPTERHSVQSTADEKATTPKRVPSFPTFRVFRGEPVWVPQCLKGSREAVPGAVAQCAAVAWRAPHQTMAMASQAWKLPGPVPATTFHAPLAQVQVLASRSSGAAQVHGTRPCTELPAMSLSLPLRYTPENILLast
1 -157.000[K] KOG4319 DNA-binding nuclear protein p8  ali  100  1MRRRFLLPVHGPQQRNVCFWGLDGGLLAELETFFRTNRNSRRSGWVFQESACADAWPQTAGQCQQAGPQAQTRPPTPISYKEELYRCLYYYCLRYFPACGVGRSKGLTLSEQALRTKRLSPGGHASRRICCHHWGTLAQECSSMGAGGTQGVALAMARGCCCLGMTWSEKVVGGNEKALAGQKQPCGVPEWQQARAARVIHPRDSYEKPRPTERHSVQSTADEKATTPKRVPSFPTFRVFRGEPVWVPQCLKGSREAVPGAVAQCAAVAWRAPHQTMAMASQAWKLPGPVPATTFHAPLAQVQVLASRSSGAAQVHGTRPCTELPAMSLSLPLRYTPENIL 341
2 -15.000[R] KOG2350 Zn-finger protein joined to JAZF1 (predicted suppressor)  ali follow..  616LYRNFILHMCSLFDYGL----IAA-KLQGLLSKYAAGQELMQRQREEQLKYWLDVGMHKKQEDPKTLKSPQKPAPPADQASTSSASTSGSGSGSSSMQPPKRMPAHLKRGSAASSPGVQSKGTENGTNGSNSSSSNSKNVAKKSADQPLSTLANTRERRSEYGQKRNVSGSRLAATPASKRKLSSKDVEQAADAPEVLTHSDNAVDVGIIDDECGGFGAVGVMNGVASPVANNSEMDTEAEVEAEPTATKAITIHCQQPVTTPVAAAATANERLPGVAPHRRGPR-RADRREEELVASAPGYRCRPSMRGADAGAAAAAAAAPTHPHPHRPPPPPPPQ... 955
3 -7.740[R] KOG4377 Zn-finger protein  ali follow..  11  2................................................................................................................................................................................................................PKAQHSPQ---------------AIFTSFKLERSEYSGPGARLPGGSSSTVAAEDRLSLADHDGSATDLTPSRYRKRGRVWAPTSSLEQPSKRIVNQPTHFGARSETESRSSRHESLAQPTLQPSEPL..... 115
4 -7.390[K] KOG0709 CREB/ATF family transcription factor  ali follow..  515......................................................................................................................................................................................................STSSSSASSVASSTSTSSATSPIYRTSRTLGAFEDQCDASSDDSNCANMPSLVPMKMSAQPPKRKIVTMNGQPRVTYRAVPASSTMDRPIKYEVLNDYIKMEEESTIRLPNSWSTAGPRLHPQVNASSRTVRPLTVATPVH.. 674
5 -7.010[S] KOG4556 Predicted membrane protein  ali follow..  40...QIVLLISG-QKRNVLWY-LSAGLPYSSSFFLRFTPYCDAEFDVIRKKWVQK-------KKPIRSNSQSINHYAQICASKVAKAPSSTNNSSSGYLNSQYDDLGSSREKVKVTEKKEVKGQFERNSKKKKKNPRPEMPAPDCAPCSSNRSSEEESNLEDVYTQPIKKKIMPLRRPDLEEENRGTNVTSLVSFDPKSATLLRIRQHLEAEPSDRDTPDYDMYERLRSRSSGHSEVAPASTIPLSSDYKSRNASQDSVPSMFAPMLNSPAPSSTTSGSSSRTSGASLAHKTHIVGKGGISLSTVDPSPILSPGIRLSEQLGAKNQSYKSAFRVQKTEN... 437
6 -6.880[R] KOG2714 SETA binding protein SB1 and related proteins, contain BTB/POZ domain  ali follow..  11  498..QVFIVP-TGKR---ICIQAVDCTTVRECEGSSRMGSRPRRYLFTGHTNGSIQMWDLTTAMDMVNKSEDKDVGGPTEEELLKLLDQCDLSTSRCATPNISPATSVVQHSHLRESNSSLQLQHHDTTHEAATYGSMRPYRESPLLARARRTESFHSYRDFQTINLNRNVERAVPENGNLGPIQAE----------VKGATGECNISERKSPGVEIKSLRELDSGLEVHKIAEGFSESK-------------RSSEDENENKIEFRKKG-------EGGGFLGRKKVPYLASSPSTSDGGTDSPGTASPS----------PTKTTPSPRHKKSDSSGQEYSL 815
7 -6.800[R] KOG1777 Putative Zn-finger protein  ali follow..  11  1...........................................................................................................................................................MSSSSSPFFHPPPQQVMDDTTQQSPSYSQN------------SNSPSQHTFESMEPAAGGSTSMRYSPSGSSEADNPTLGLF----SAQASYPYSLRKRRPCLTKDEDLCFPITAATADETPQPTMKKFKLECLSPGEARDFSIEDESGTNLEAKMETTECEPEEEEAVEEEDQQDHINRLPEELL 170
8 -6.680[E] COG0506 Proline dehydrogenase  ali follow..  13  5.......PVSGSNTNKPC---LHTGLICVLPSFSKKRKHLPCPHLKPCISSADLLRYYRIQTAPMPSEPPEKLWRIQKMFHFAF................................................................................................................................................................................................................................................................. 79
9 -6.610[S] KOG4610 Uncharacterized conserved protein  ali follow..  10  165...RWLLP-KGDLTRDQLSQLL--GTAADIIEFFDSYKDDSIAKIGFLVFLTLGIWSWSLMQFTIVLSATRGRRPRGSGSHHDVWGIVLNVILQDAP-------TCKNSLVIILQLYRLYVVNAEFWKNRRESRMAKSRQFQSRRKVQDADQNSIYMISNERGGDVKKKIKRAKDKDYAEQEAVYSKKKKDKKDKKKRKRKDTGYSTASSQNLYSTKASGTDKDTRRKDKKGKKSKRTCSSSPSDCDLAKKQKRKNADKNDKKKSRKIEAVVEESSSSSSSSSDSSNSTLPSYEVIDEKKARRRKHRGSSSDTSSGDSSSSSSSSSSSDSS.......... 523
10 -6.590[S] COG3462 Predicted membrane protein  ali follow..  22  7..KCFF--IHSIMERRI-IWVL--GLVAVVAAVAIITS............................................................................................................................................................................................................................................................................................................... 42

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.