current user: public

If you have questions about the server, please let us know.

Query: [S] KOG4367 Predicted Zn-finger protein, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650    .  660    .  670    .  680    .  690    .  700    .  710
# Score Template Links and tools%idFirst MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSPRKVSTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRNMVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGTLTPRMTTDFDLSLDNSPLLQSIHQLDFVQVKASSPVPATPILQLEECCTHNNSATLSWKQPPLSTVPADGYILELDDGNGGQFREVYVGKETMCTVDGLHFNSTYNARVKAFNKTGVSPYSKTLVLQTSEVAWFAFDPGSAHSDIILSNDNLTVTCSSYDDRVVLGKTGFSKGIHYWELTVDRYDNHPDPAFGVARMDVMKDVMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTEGGITKGATIGVLLDLNRKNLTFFINDEQQGPIAFDNVEGLFFPAVSLNRNVQVTLHTGLPVPDFYSSRASIALast
1 -138.000[S] KOG4367 Predicted Zn-finger protein  ali  100  1MEEMEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDYDYLDLDKMSLYSEADSGYGSYGGFASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKAAALKCQLCEKAPKEATVMCEQCDVFYCDPCRLRCHPPRGPLAKHRLVPPAQGRVSRRLSPRKVSTCTDHELENHSMYCVQCKMPVCYQCLEEGKHSSHEVKALGAMWKLHKSQLSQALNGLSDRAKEAKEFLVQLRNMVQQIQENSVEFEACLVAQCDALIDALNRRKAQLLARVNKEHEHKLKVVRDQISHCTVKLRQTTGLMEYCLEVIKENDPSGFLQISDALIRRVHLTEDQWGKGTLTPRMTTDFDLSLDNSPLLQSIHQLDFVQVKASSPVPATPILQLEECCTHNNSATLSWKQPPLSTVPADGYILELDDGNGGQFREVYVGKETMCTVDGLHFNSTYNARVKAFNKTGVSPYSKTLVLQTSEVAWFAFDPGSAHSDIILSNDNLTVTCSSYDDRVVLGKTGFSKGIHYWELTVDRYDNHPDPAFGVARMDVMKDVMLGKDDKAWAMYVDNNRSWFMHNNSHTNRTEGGITKGATIGVLLDLNRKNLTFFINDEQQGPIAFDNVEGLFFPAVSLNRNVQVTLHTGLPVPDFYSSRASIA 710
2 -37.200[O] KOG4185 Predicted E3 ubiquitin ligase  ali follow..  12  2.....SFIDCEICDEEFSTPRILRCGHTTCHGCAEKLL-----------------------------------------------------------------------------------RNSTILCPFCREATNVS--AVKDLQKNFALLQAVEHTKTK-------------------------------------------------------TEEKDSIDAPPKCASHQYNLIEPTCRSSDKLMCRTCEEFGAHAGHKKGLLQSEAAKLRQFLSGKLSRSEELASQIETNIEKIGRAQLTNIDVFQEKKDSIVSYYTTLRMTLDALENEALEKLQNIAEANFSRNEILVAELSESLEKQKSKSAELKLFMEMSN-ADLLAVNSVMDASNETEIWNDVSPGITNVEPEVFDATLAFPEIDRLAIQVSKVSRMNSLPWEFEEASVGDENLLAA------------------------------------------------------------------------------------LININDSLTTTHLTIRVNYHLRVQCNYHICTCKFMLISGHIIITSYKSAR---AYHRGAIISDSEMYRIFLIFSCLVGH-----EANCIAKAPMKETIISERSMPLAVKCSKECLNPPVEKPEDSRVTGYIQKN-YTEGCSIGCKRGPGGTIKLASGETVP-----PPQL. 514
3 -27.400[O] KOG2177 Predicted E3 ubiquitin ligase  ali follow..  14  6LQVFQRELTCPICMNYFLDPVTIDCGHSFCRPCFYLNWQDM---------------------------------------------------------------------------------AVVAQCSKCKETTW------RNLNTDICLKNMASIARKA-------------------------------------------------------SLRQFLSSEEQICGMHR-ETKKMFCEVDKSLLCLLYSNSQEHRNHRHCPIEWAAEERRSLWEKACENLRNLNMETTRTRCWKSFGDILQRYESLLLQVSEPVNPDFSAGPIIGLMDRLKRFRVDF------TLQPERDNSHIFLYGDLRSMNIGCDPQDDPDITA------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------KSECFLVWGAQTFTSGKYYWEVHVGDSW---NWAFGVCNNYWKEKDKIDGEEGLFLLECVKEDTHCSLFTTSPLVVQYVPRPTSTVGLFLDCEGEDNEANEIFGGKNSRKPKKAKQENQPVNSKSESEQWHMPQCVSS........... 379
4 -21.900[DKL] COG5220 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3  ali follow..  13  5.GARKVDEKCPLCQANMKLLINPECYHKMCESCVDRIFTTGPAQ---------------------------------------------------------------------------------CPTPGCNKILR------AKFREQTFEDAQIEREVDVRK----------------------------------------------------------RISRIFNKGQQEFDSLQAYNDYLEEVEILTFNLIYKIDVEE---TEEKVKQYEKQNRDSIAANSARAAAEAR---ILAQNEILLKRQKQEAREAAIREHQKEKERREQVEQQIIFDLATSGKDPNKIIQLSDSLKKQQENIASSVSNISRSSSILLSD........................................................................................................................................................................................................................................................................................................................................... 238
5 -21.400[T] COG5432 RING-finger-containing E3 ubiquitin ligase  ali follow..  19LYQLDTLLRCHICKDFLKVPVLTPCGHTFCSLCIRTHLNNQPN------------------------------------------------------------------------------------CPLCLFEFR------SLLRSEFLVSEIIQSYTSLRSSLLD-PKPTPVPENEEVPGPENSSWIELISESESDQIVATSERKLAKRSMTDILPLSSKPSKRNFAMFRSERIKKKSKPNEQMAQCPICQQFYPLKALEKTHLDECLTLQSLGKKPKISTTFPTESNPHNKSSQIKQKLSSLGLSTNGTRQNMIKRYNHYEMLWNSNEAELKRQLLSWDVSHNKT-SNGKSSSYRKLLENFKNDKFNRKGWMVMFRKDFARLIREAKMKIKTGSSDSSGSVGHSNDG............................................................................................................................................................................................................................................................................................................ 423
6 -21.400[L] KOG0287 Postreplication repair protein RAD18  ali follow..  19LYQLDTLLRCHICKDFLKVPVLTPCGHTFCSLCIRTHLNNQPN------------------------------------------------------------------------------------CPLCLFEFR------SLLRSEFLVSEIIQSYTSLRSSLLD-PKPTPVPENEEVPGPENSSWIELISESESDQIVATSERKLAKRSMTDILPLSSKPSKRNFAMFRSERIKKKSKPNEQMAQCPICQQFYPLKALEKTHLDECLTLQSLGKKPKISTTFPTESNPHNKSSQIKQKLSSLGLSTNGTRQNMIKRYNHYEMLWNSNEAELKRQLLSWDVSHNKT-SNGKSSSYRKLLENFKNDKFNRKGWMVMFRKDFARLIREAKMKIKTGSSDSSGSVGHSNDG............................................................................................................................................................................................................................................................................................................ 423
7 -18.300[O] KOG2231 Predicted E3 ubiquitin ligase  ali follow..  40.YTGNDDNACVVCFKNVEIFSIGDCDHPVCYECSTRMRV-----QQNECPICRHVLSK-----------TLDKLPYRELEANNRSDLYSKKYRIGFCTAEIRQQFFKLLDHPCPKCLRNHVRSKLLYCDLCVETLNIFTFERRCYTQAELQLHN-DPDNRSHRGHPLCEYCNKDRDELFRHLRR-EHYFCHFCCNEFYNDYADLAEH---------------RAEHFLCEEGK-------CATEQFVGAFRNEI--EYKAHVANVHGKSLNKQQAKQTRTLQVEITLGPRGRSGQTEQGITSVRTRNDEHNDYQNDLPSITQRHVSIDAGNEEQFPTLRGASTAPSVSLVRPPPPSMRNLSGTSGLARTKENFPALGGGNG......................................................................................................................................................................................................................................................................................................................................... 405
8 -18.200[T] KOG0297 TNF receptor-associated factor  ali follow..  15  25GTKLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLASILSSGPQ----NCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKEYESCHEGRCPL------------MLTECPACKGLVRLG-------------EKERHLEHECPERSLSCRHCRADVKAHHEVCPKFPLTCDGCGKKKIPREK--FQDHV-----------KTCGKCRVPCRFHAIG-------------CLETVEGEKQQEHEVQWLREHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTA-TFENIVCVLNREVERVAMTAEACSRQHRLDQDKIEALS-SKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSP............................................................................................................................................................................................................................................................................................................... 379
9 -17.600[O] KOG0824 Predicted E3 ubiquitin ligase  ali follow..  11  15AINSTIDKECAVCYSEMILPTTIPCGHKFCFICLKGVSVSNNG-----------------------------------------------------------------------------------DCPICRGPID------QIFKKPLQAVDLKMDIPGTPSAA--------------------------------------------------------APDPVVKQEVDDEDVKPDVKKLQEELKKQQAAAAAQKMFWLYRGRHQGWWRFDPRIEKEIEEAFTHQMPMTEVTICGNPYIVDFSQMCQYPKNQ---------NYSRNVKRVNSTDFDSLNVKGMSGVFVATTSPPAAAN............................................................................................................................................................................................................................................................................................................................................................. 224
10 -17.300[BK] KOG2626 Histone H3 (Lys4) methyltransferase complex, subunit CPS60/ASH2/BRE2  ali follow..  11  10...........................................................................................................................................................RQAAPKTAPTTVC-YCDGKRESVEVVCSTCLKWFHGRCLKEFHEFSRNSN----------------------------MICYTFTCKQCRP--------------------AEDWKAKKADLVQMCVTV------LATLSAERLKADGKLSAEHVPEDFTYLSLKDEIVPYMNENWYMLTAI-----------------------KQKKEWHQNLAPTLLKEKNIFVQHNDDDDLFALAEKNLSLLGPLHEAVKLIG--------------------KRPIERENREPRHIELPPIEGPKTRGASKRRHAEAPVTGKKQKLAADYSSTAAPNGVQIDIPFSKDNYRYYLTEVDPNVPEDPAWNQNQSSAYVIPSFHYRELLNPTVNVSSNDRAFQLSINGNSITGF-EGYSMARASHGVSKGTWYFEVNFDDQPDDSHIRIGWSQSYASLQACVGYNKFSYGWR--SKHGTKFHEAKGKKYHFGGFKQGDVLGCLIHLPGSYIEFFHNGKSCGKAYENIYAGAYYPSISIFKSATATMNLG---PKFRNLPRGAT 519
11 -17.000[R] COG5236 Uncharacterized conserved protein, contains RING Zn-finger  ali follow..  56.DTDEENELCVICARKLTYVSLTPCHHKTCHICGFRQRA-----NKKSCLICRTENE----------EVMFTDRIDGDISDKYNFCEKNEKYGINFTSEEVATETLNLLKFFCPLSYNEHLKSNRMICLICATHKHAFPCELEIFTQNQLRNHQTKGNSEGFKGHPMCAFCSGKDDELYIHMRN-QHEKCHICDKMNPASPQYFKDYNQL--------FDHFKHSHYVCTVQT-------CLDNKFVVFKDELELQAHQEHGNILKGKPKFFQSELSTFISAPSRVIRERDDYDLPSISSLPGSSSGSRTDVRSASSPEES------RLRLAERAKYYLENSKEDFNKFSSYNEDYSKGRLSAEKLLESYKLLFTKPNADNLAETFPKNSSKYNNLNAIYEQREQTLARQTSLPSLSSDSSLSMSIGRGHWGGTNDGGSAGAALGVRNIKNLPTLKSPSASYDPFATTVKKNTLRPVQNIKRTTPQSVSYRTSTNTVAFSPTYLESKKGSSSTSLNNSKDKLKSLNQLPPPKPKVQIPGLNRPQIADPKQWGKKSSTQDTNVHDNLRELNTTSGGNKK-------KGKQKQLLFHIGV................................................................................................................ 639
12 -16.700[O] KOG3800 Predicted E3 ubiquitin ligase containing RING finger, subunit of transcription/repair factor TFIIH and CDK-activating kinase assembly factor  ali follow..  12  2........ECKKCKSNELVMMINECGHPLCKNCVDNIFALNSG-----------------------------------------------------------------------------------NCHVCNRVLRKNN-------------------------------------------------------------REQIYEDPLIDKETFLRRKLRKIYNLKQDDFENLREFGDYQERKFFEPLKFPVKIKISNFRRFKNFKNFFYEFSIRYSNSPSFSWSNPEFSAQNSKIAPSNVNETNAEIQAFEEKHKEQIDRNKRRLDDDQKWIEDQLREERAMKARMTDHMEMD-QEAASAVTDTRKIMDELRDSNVAAEILDRERKKQIEKELEEKEEQEKRKRRNKE............................................................................................................................................................................................................................................................................................................ 288
13 -16.700[R] COG5141 PHD zinc finger-containing protein  ali follow..  10  167LTIIELDGRCVICNE--NSNAIVFCVHQFCKKCLLA-------------------------------------------------PHEVICCAFCPDRDGAFCTTLD-CHTIC--------------------AIAIPEISFHDTSRLDLVRNIASIPKSR---KLVCCICKLRWGT----CVQCSD---KNCYAAYH--ITCARRAGFFYKIYSHSASYDSVDMETYCDKHQATKAPDFVPEGPWKSHPLPAFIVDKVTKVLLSYNVKRQDLPSIVTDICKHMKRRSRKDAPLLKSQLLMDSLENLPVRASKDRVREVAKALQDQY-QSLLTLVESTAKRQLLKCQLSNLRKKFLNLNYFPAQRLLQDTLVKIIDLDVDGLFNMPVELKRQVFS........................................................................................................................................................................................................................................................................................................................... 568
14 -16.400[T] KOG1701 Focal adhesion adaptor protein Paxillin and related LIM proteins  ali follow..  13  415........RCARCGENVVEGTGCTAMHVTCIICNNKLRGQPAVEKKAYCEPC---------------------------------INTLEQCNVCSKPIMER----------ILRATGKAYHPHCFTCVMCHRSLD-------------------IPFTVDAGGLIHCIED---HKKFAPRCSVCKEPICEDC----------------GLLSEGDNQGCYPLDGHILCKTCNSARIRVLTAKASTDL.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 612
15 -16.000[O] KOG0006 E3 ubiquitin-protein ligase (Parkin protein)  ali follow..  10  201IATNSRNITCITCTDVRSPVLVCNSRHVICLDCFHLYCVTRLNDRSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRCGAGLLPEPNGLGCGFAFCRECKEAYHEGEC--SAVFEASGTTTQAYRVDERAAEQARWEAASKETIKKTTKPCPRCHVPVEKNGMKCPQCRLEWCWNCGCEWNRVCMGDHWFDV..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 437
16 -16.000[O] KOG0827 Predicted E3 ubiquitin ligase  ali follow..  14  3......NLNCVICAELFGEVFATVCGHMFHHNCLNQWLDRSK------------------------------------------------------------------------------------TCPQCRNKCTTRN-----------IFRVYFNLANLDVSHIDVGSLQEQLDNAML----------------------KMVEKERNKDEQQIRDLKETQKKCLKTIAGLEQKVQ-------------------KKDFLISSYVEQIGVLKSDAHV-VDGLRKENKTLKSQIQSMEGISAILAAGSADADRLLKNE-HVLANWVSTLKREL-----RQCESKKTELRNVVKVVQNDLRKEIELKRYAHNIPNVFIIDMCSFDCSKLEERVSHLESDLYQAQEKLQAFENKTAYLDSPNASCGLNS.......................................................................................................................................................................................................................................................................................... 290
17 -14.900[R] COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers  ali follow..  14  246.KKEDIPFVCLICKKDYRSPIATTCGHHFCEQCAITRYRKTP------------------------------------------------------------------------------------TCIQCGADTK------GLFSVDKNFDRLLKNRKSKNDEAVK-GFESNNSATTEVSERKDREASFQGFADTLAK-----PNTSAQQKMPSLGDNSNTIISKYFIREITESNIVHFKRLVRVVL.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 400
18 -14.700[O] KOG1814 Predicted E3 ubiquitin ligase  ali follow..  12  169....IRKFQCNVCFDEFNGTQLTRCGHVSCQSCLRDYYTMCIQEGMFS----------------------------------------------------------------------------QIKCIDCGKDAVLTLKELESIVGVQLTNREEKRRYENDSNIIFCPRCQRDPGQKLAICQKCDFAFCSFCQATWHRYGKRIIDRLVEQVKNDEEAEKWVLLNGQRCPERIDGCCHMNC-LCGTHFCFLCGAY--MEQNPYKHFNDPVSSCYGMLFASAAEKQRFSEN.................................................................................................................................................................................................................................................................................................................................................................................................................................... 433
19 -14.700[O] KOG0320 Predicted E3 ubiquitin ligase  ali follow..  33  261....EELYKCPICMDSVREPVSTKCGHVFCRECIETAIRATH------------------------------------------------------------------------------------KCPICNKKLTARQ........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 313
20 -14.700[R] KOG3953 SOCS box protein SSB-1, contains SPRY domain  ali follow..  20  65.........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................WTWSKRHRSKEVVLRGPNSRTPNWSKGTAGVQGKRSLNNGRHYWELHVSQRVFGTSIMFGIGTKSARLHNMLGENEHGWGL---SHKGVLWHEGVALLYTKRRENQPTQIGVLFDGIEGTLTFYKDGKCLGVAGLDQIDEPLYPIVCSTAAKTMTLKCTRREFVNLQD..... 242
21 -14.600[K] KOG2461 Transcription factor BLIMP-1/PRDI-BF1, contains C2H2-type Zn-finger and SET domains  ali follow..  376KSLQLKLVDTSMFVSPVAQTTAA--GRS-AATAGAHFGNYAALSKPLYTSASPAFGGG------GMGGGFGMGGSAHTSSFHQLPFVNHSSSSHNDSSFNGVPNYVQQQEN-CKDCVRTHTGERPFKCEICTKEFTQL----AHLQKHHLVH--------TGERPHRCDICDKHNGQKPYTCDVCDAKFCGTCGKKTHWKT-----TTCKEEDMKDSMRDDLMDIKGEIDELNSEL-KRPLMPIETIYEQQAMMYGNTMGHMGQGSHLQGPPPPPQHFQMDHSGMQNGGGIPHQHQLIQGGPSSGSGQQQHPQHNGIHR....................................................................................................................................................................................................................................................................................................................................................................................................... 799
22 -14.300[R] KOG0804 Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein)  ali follow..  149.KLTKVAQCRMLC--MYAVPAQVEVRESFMCISLPKVVRDPAPNQYMLIIKFKEHNDAVT-------DRIECTTSNDLFSSDDTSLTELPTCAVCLERMDDSVLAILCNHSFHARCLEQWADN---TCPVCRYV------------------------SPEVVAEQRCNDCGMSND--LWICLICGNIGCGRYAEQHAQRHWELTSHTYSADGKLVEYQRESNASFDDKNQKGGDKLEGIKLEYTLLLTSQLEDQRKYFEGLRHDMEQTMSKMEKTAYAQVENLEHQLTERSTELKSLKGDLDDTVTARKVAEKRATQTNEKVNKLANEDEREINQMLRKDQQVWKGQVEKLIESQKTARTEYEKKIEDLQSQVN--DLLMHFETQNKLKEQLDA........................................................................................................................................................................................................................................................................................................................... 559
23 -14.300[S] KOG3990 Uncharacterized conserved protein  ali follow..  10  8........ACSKCFSRHLYEELSS--QQLCKGCRGST--------------------------------------------------SVGKCTYCRSEFQPATK----SQSACKKCEHYLGKYGK-ACECCKIVAAFGGS--------------------------KCMRCASYEAKPPVQCDECKKLLCWLCACAYKRALLKAQQEGRIPMSKSGANNSGVNAVSGAGLDLPDKISRGNGGNGTIAAPAAITVDTNSSDHAITYLKERIASLEKRLNQKDKELLEK----DKQLTELKGKNFEKENDMRNRLKEVERLHDMKVDNLNRKIASVLKELAVLKKSSNKKTAAISKAEKEIIKRENLSPKEEILATTGPEKPTKASSEPADLDKDEKSRDRDEERSEQGDRASV.......................................................................................................................................................................................................................................................................................................... 376
24 -14.100[R] KOG3002 Zn finger protein  ali follow..  14  48SNGVYELLECPVCTNLMYPP-IHQC-HTLCSSCKLRVQNT---------------------------------------------------------------------------------------CPTCRYEL--------GNIRCLALEKVAESLE------VPCRYQNLG----------CQDIF----------PYYSKLKHE------------------QHCRFRS-----YSC-PYAGSECSVTGDIPTLVDHLKDDHKVDMHDGCTFNHRYVKSNPHEVENATWMLTVFNCFGRQFCLHFEAFQLGMAPVYMAFLRFMENEAKKFSYSLEVGAHSRKLTWQGIPRSIRDSHRKVQDGLIIPRNLALYFSGSDKEELKLRVTGRIWK........................................................................................................................................................................................................................................................................................................................... 303
25 -14.100[R] KOG3608 Zn finger proteins  ali follow..  10  126LPALGQNFRCG-CEREFVSIVEF--KHALFEYDIQKTPEDERPKTMCNWAMCHKHMGNKYRLIEHISTH---------------SNKKQVACFHCGELFRTKTTLFDHLRR------QPENNTNSFQCAQCFKF--------------FATKKLLKSHVVRHVNCYKCTMCDMHLKDKPLKCSECDTRCVRESDLAKHVQIVHSKTVHQCEHPDCHYSVRTYTQMRRHFLEVHGNNPILYCHCCERFFKSGKSLSAHLMKKHGFRLPSGHKRFTRVDENGFYRLETTRLESLEVTQQILS-----PQVNDSLAKPGTGSCYEIVDPTNTEFERIIVSNDPNEAQLMGEVVISLPSLAEEL.............................................................................................................................................................................................................................................................................................................................................................. 467
26 -13.800[O] COG5574 RING-finger-containing E3 ubiquitin ligase  ali follow..  17  356.....RDFECAICSNVAYKPVRLGCSHVFCLHCLIILQKQKVD-----------------------------------------------------------------------------------FCPLCRAKEVMKADSRN----DHALMNFMKTYFPREIKEKF-EENENDTFTPSSISVVSGQNNC........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 453
27 -13.500[O] KOG1813 Predicted E3 ubiquitin ligase  ali follow..  16  269.DENALPFACFICREPFVDPVVTKCKHYFCEHCALKHHTKNK------------------------------------------------------------------------------------KCFVCNQPTM------GIFNAAHEIKKRMAEERSKAEQG................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 342
28 -13.300[S] KOG2660 Locus-specific chromosome binding proteins  ali follow..  7KETMRACLSCSICDNILRDA------TTISEKCIYEKITEDEIE----------------------------------------------------------------------------------TCPVCN--IDLGSTPLEKLRPDHNLQDLRAKIKRRKVKAPGIVSLPGKRKERSISSLVVSTPMVSAQAGTTRRRTKAPTRKELRNGSTVKKEESSGDELLESTSSPDTLNKFTQNKRQSKKSCKESISNKENKDGDEPWDSKMDWKPLNFLVEVANGTKPLKSSASQGSGSKSEHANVSRNQFQGSKTKTKNKKRKCKREDDKSNNSLVASNDQEGGTSLPQIPANFLRIRDGNTTVSFIQKYLMR-LESENEIEIKCMGEAVTLTLYNLVDLWLQKSSNHQ.............................................................................................................................................................................................................................................................................................................. 386
29 -13.200[O] KOG1815 Predicted E3 ubiquitin ligase  ali follow..  10  132....DSELTCGICFDSYPPEKIVSCGHPFCTTCISTTINDGPGCLMLRCPDPS--------------------------------------CLAAVGHDMVDKLASEDEKEKYNRYFLRSILANSKPCPRCKRPIEKNQG------------------------------CMH------MTCTPCKYEFCWLCLGAWMDHGERTGGFYACNRYEVAKQEGQSRQKAMADLQQAQMQNVRLIIECRRVL-KWTYAYGYYLPEHEHAKRQFFEYLQGEAESGLERLHQCVEKDLVQFLIAEGPSKDFRTKLAGLTSVTKNYFENLVKALENGLADVDSHAACSSKSTSSKSTGCSSKTREAHSGILILLSCVYAIWIIGFVTSFLEYEKDEQRRVKPIKS........................................................................................................................................................................................................................................................................................................................ 560
30 -13.200[S] KOG4030 Uncharacterized conserved protein, contains SPRY domain  ali follow..  16  21..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................PLKEMPAVQLDTQHMGTDVVIVKNGRRICGTG----GCLASAPLHQNKSYFEFKIQSTG---IWGIGVATQKVNLNQILGRDMHSLVM---RNDGALYHNNEEKNRLPANSLPQEGDVVGITYDHVELNVYLNGKNMH-CPASGIRGTVYPVVYVDDSAILDCQFSHTPPP-ILFEQQI. 195
31 -13.100[T] KOG1829 Uncharacterized conserved protein, contains C1, PH and RUN domains  ali follow..  340....SQQWKCAACNDREQCPRF--CDYYFCSLC--------HGGEKSILPA--NQWSFTELPVSDRAQRFLRAVRESPVFRIRDLPGDLVKKNKALRAVVELRQKLKHMEGFIKICIDASNQVFEFG--LLEHDDLFSLNDLQRIYNKDLLSLLEPLAKRAREHIIHCKKCRLQA----PVCVRCNVSRCEGCGHLSHSP----------------------------KCPRRDVPRDTHCPKCA-------RLKTRANGGEFLDSEISGNLKRADVLGIFGNLKKAGTAL................................................................................................................................................................................................................................................................................................................................................................................................................................... 613
32 -13.000[C] COG1034 NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G)  ali follow..  10  13YEVNGADNLLEACLSLLDIPYF--CWHP-CRQCAVKQYQNAEDTRGRLVMSCMTPAS----------DGTFISIDDEEAKQFR------------------------------ESVVEWLMTNHPHDCPVC------EEGGNCHLQDMTVMTGHSFRRYRFTKRTHRNQDLGPFISHEMNRCI-----ACYRCVRYYKDYADGTDNVYFGRPEDGTLESEFSGNLVEICPT-DMQFAPSICQQCSI-----CNISPGERYGELRRIENRYNNLKDRPRQPVQRRGDDFITLEQAMQGAADILRQSKKVIGIGSPRASVESNFALREL--GEENFYTGIAHGEQERLQLALKVLREGGIYTPALRE-IESYDAVLVLGEDVT--QTGARVALAVRQAVKGKAREMAAAQKVADWQIAAILNIGQRAKHPLFVTN..................................................................................................................................................................................................................................................................................... 435
33 -12.700[TZ] KOG2272 Focal adhesion protein PINCH-1, contains LIM domains  ali follow..  13  7........HCTRCADGFETEKIVNSNHTVCAQCFRPFQDGIEFEGRKYCERDFHVLFAPCCNKCGEFV-----IGRVIKAMSASWHPQCFRCQLCAKELADCGFIKNQNRALCHECNAKVKATGRYVCQKCHGLID---------------EPLRFRGEVYHGYHFSCTACGTENDMNELYCLRCHDKMCGACRRPIEERVVTALGHV----KPFLGHRHYEKRGLAYCETHYHQLFGNLCFVCNQVICSVC.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 289
34 -12.700[O] KOG0823 Predicted E3 ubiquitin ligase  ali follow..  10  111....GGFFDCNICLEKAEDPILTCCGHLFCWGCFYQLPLIYLNIKE---------------------------------------------------------------------------------CPVCDGEVT---------------AEVIPIYGNGDDCDGTKPKLEDCGISL--------------------PRPNAKRVESVRQKIINRGNPFFPGHENEAIEHIRRTIDSI--INNGGDNGGQQQQQQHHHHHHPPFGPLRLLPPYATFPGLLVDTSDIPAPFDDDAFDVDSFVDSLRRNRRRPSPAVRASYQRNRSNNASQTISFRLGSSASSAPREFAVPSSSIMTRSQTVNPTEVVTSSTSASSSRRRTEDVNNRTRSRRRLR............................................................................................................................................................................................................................................................................................................................ 404
35 -12.600[R] KOG4299 PHD Zn-finger protein  ali follow..  10  261....YNNDYCSACHG-------FLC----CETC---------------------------------------------------------------------PNSF---HFTCID--EKNLPDDAWYCNECKHHSLYNELDEQEELESNV-ERDPLLLKSKSGTPILCFRCHKSALVSILACDYCNSYWHPDCL-----------NPPLATLPSNLRK---------KCPNHSDHVTPRYRLPEKAKVIRVGLPRGFKNK-VIDENEDEPSVQTIQLQGKIRVVPSKPFKL-NFLEQIRDNVINLRKMVEQDEQLCIETFSKFDFYATRDCELPLRILCDVANDNLENDDYVLALRDLLRISKWDPNQPVPAPFDLANLLSY........................................................................................................................................................................................................................................................................................................................................ 607
36 -12.500[S] KOG4623 Uncharacterized conserved protein  ali follow..  10  38......................................................................................................DARVNC---FCNG---PYQDRNSWTCPSCEQYNGFTKDG--------YNRDITSQRDCSLGSQKNSSKGSSSICANSYY-PAPKNGLCDQCNEAQRLKVEKLSQF--EPKNE----------------SRFDQELKVYRERLEKRLCSSCE----------RHVNKVLHEKKKMV---------LSSKFLNYIIKGASLLKQPHFNRLAAAQK........................................................................................................................................................................................................................................................................................................................................................................................................... 214
37 -12.500[O] KOG4159 Predicted E3 ubiquitin ligase  ali follow..  12  1.............MRLFFEPVTTPCGHSFCKNCLERCLDHAP------------------------------------------------------------------------------------YCPLCKESLKEYLA-DRRYCVTQLLEELIVKYLPDELSERK---------------------------KIYDEETAELSHLTKNVPIFVCTMAYPTVPCPLHVFEPRYRLMIRRSIQTGTKQFGMCVSDTQNSFADYGCMLQIRNVHFLP-RSVVDTVGGKRFRVLKRGMKDGYCTADIEEDVKVENEDEIKNLRELHDLVYSQACSWFQNLRDRFRSQILQHFGSMPEREENLQAAPNGPAWCWWLVDPRYQLSVLSM-KSLKERLTKIQH........................................................................................................................................................................................................................................................................................................................ 280
38 -12.400[O] KOG0978 E3 ubiquitin ligase involved in syntaxin degradation  ali follow..  25  838VKNCKNILKCGVCFDRPKEVVIVKCYHLFCQQCIQRSLEIRHR----KCPGCGTA............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 888
39 -12.300[DR] KOG4739 Uncharacterized protein involved in synaptonemal complex formation  ali follow..  13  2.....DWIQCNHCGIKPNQTKLTACGHVFCQNCTKAAFNSQ--------------------------------------------------------------------------------------CYLCKKPL-----------------------------------------------------------------------------------------KVDEINKNLRPDLMELFKDPRQLA-----------SDLVNELKQVVAFQAKQREIYVKCKNAEAKKDTERFAEARSKHVEKTQEIEKRKKAFLEDNVKLKNAKEEKNQLMARLKELREQPSQNLSVNKRRSNTRTEPPFSKI........................................................................................................................................................................................................................................................................................................................................................ 178
40 -12.300[K] KOG2482 Predicted C2H2-type Zn-finger protein  ali follow..  43....SPSVPCIFCEEHFAEQDKL---HRYILYWRKRFTEQPAPFEEQENYFLLCDVLPEDRILREELQKQRLREILEQQQQERNDTNFHGVCMFCNEEFLGNRSVI---HAFNIGLPDNQKKLDNLQCLYCEKTFRDKNTLKDHMRKK-SWEEVQLEDDRELLDHQEDDWSDWEEHPASAVCLFCEKQAETIEKLYVH----MEDAHEF-DLLKIKSELGLNFYQQVKLVNFIRRQVHQCCYGCHVKFKSKADLRTHETKHTSLLPDRKTWDQLEYYFPTYEN--------DTLLCTLSDSESDLTAQEQNENVPIIS--EDTSKLYALKQSSILNQL.................................................................................................................................................................................................................................................................................................................................................................................... 436
41 -12.200[O] KOG0801 Predicted E3 ubiquitin ligase  ali follow..  12  179....KDAGECVICLEELLTIARLPCLCIYHKSCIDSWFEVNR-----SCPEHPAD............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 227
42 -12.000[K] COG5175 Transcriptional repressor  ali follow..  11  28....DEEDYCPLCIEPMDFP--CPCGYQICQFCYNNIRQNPELNG--RCPACRRDENVRYVTLSPEELKMERAKLARKEKERKHREKERKENEYTNRKHLSGTRVIQKNLVYVVGINPPVPYEEVA--PTLKSEKYFGQYG---------INKIVVNRKTPHSNNTTSEHYHHHSPGYGVYITFGSKDDAARCIAQVD---GTYMDGRLIKAAYGTTK---------------------YCLPCPNPNCM----------HEPGEEADSFN--KRELHNKQQAQQQSGGTAFTRSGIHNNISTSTAGSNTNLLSENFTGTPSPAAMRAQLHHDSHTNAGTPVLTPAPVPAGSNPWGVTQSATPVTSINLSKNSSSINLPTL......................................................................................................................................................................................................................................................................................................................................... 371
43 -12.000[TZ] KOG1044 Actin-binding LIM Zn-finger protein Limatin involved in axon guidance  ali follow..  14  5........RCHGCGEFVEGEVV----HPNCFACTI----------------CKRPFP-PGDRVTFNGRDCLCQLCAQPMSSSPKETTFSSNCAGCGRDIKNGQALLALDKQWHLGC---------FKCKSCGKV----------LTGEYISKD----------GAPYCEKD---QGLFGVKCEACHQFITGKVLEAGDKH------H-------------------PSC---------ARCSRCNQMF.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 166
44 -11.900[O] KOG2164 Predicted E3 ubiquitin ligase  ali follow..  10  205CSSDFQLAACPFCLEE-VAARMSRCGHVYCFSCLLRFVETPTAA----------------------------EVKAAETSGTKIVKCGHRSCPICWDSIRDKEFQKLEEGKSVCLRLYQRNNGSILAFPRSCRSFALDGSFHSDEIPNFTMSGAAYARIIIGSHDYMVQQHLLEIEQLQQIAAE-ADTYYERITQILLDRISSLSEDNLCLQSNSLKQLSEVDDLNDVSGSEIADAYLFYQPFAHSHI-------------DIRILKSAFGSYEDELVPRVERISSGHLVNSELRQRFK-YMAHLPEGCEVAFIECDEVLLTFKSEISKRRKQRKAQEMREERYRQRAERDTEEQIYSELNMQRP......................................................................................................................................................................................................................................................................................................................................................... 574
45 -11.900[O] KOG1645 RING-finger-containing E3 ubiquitin ligase  ali follow..  97.NGNKVTLRDCLVLSVWKFGANTKSGILDSIVFPVDTCMDIPASTS--------------------------------------------------------------------------------GFSSDEVEGSLRD--VRKIYASRVADEAHKRILFLEAKLRSIEQKTASWSNKEVQWKITEAELRLEVTKLKKKIANMESTTKGSQSQSNVASQEKYIPAHNIYQEHHGQSPSCSFRHQGDLLINGGRIFDIDGGRQILLYARRLSGVGGTFVLTQMSLHSPCEIDDILLPRTTRAIKDLHLSPHNNGLAVFGSLGKKLSVISLESHNTVLSYDLPAA............................................................................................................................................................................................................................................................................................................................................................................... 362
46 -11.800[R] COG5222 Uncharacterized conserved protein, contains RING Zn-finger  ali follow..  22  282.KDLPDDLKCPLTGGLLRQPVKTSCNIDFSKEALENALVESD-----------------------------------------------------------------------------------FVCPNCETRDILLD----SLVPDQDKEKEVETFLKKQEEL................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 360
47 -11.800[O] KOG0802 E3 ubiquitin ligase  ali follow..  12  348.DATSEELRCAICREPMAKAKRLHCNHLFHLGCLRSWLDQGLNEVY--------------------------------------------------------------------------------SCPTCRKPLFVGRTENEVNPRTVEVSSDEQLARQLERQNNPVHALATGLFPAEV----------ENDTSRNLGLDPSWLQTWSSQGSDVAGPSTTSRTVGLGRVQMMMRHLASVGESYAQTALDDAAWSLWPMNPSQASTSSTTVPPGNGGRTGGLHLRTVSNTTNESLTNILAMAETVREVMPHVPDEIIFQFKCILDYL............................................................................................................................................................................................................................................................................................................................................................................................... 594
48 -11.700[R] KOG0490 Transcription factor, contains HOX domain  ali follow..  12  4........HCAGCERPILDRFLLNVLHIKCVQCCE-----------------------------------------------------------CKTNLSEK-------KLYCK---NDFFRRFGTKCAGCAQ----------GISPSDLVRKARSKV----------------------FHLNC--FTCMVC------------NKQLSTGEELYVID----ENKFVCKDDYLSSSSLKEGSLNSVSSCTDRSLSPDLQDSTSSDKETANNENEEQNSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQE-----TGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFRSPRRM........................................................................................................................................................................................................................................................................................................................................................ 258
49 -11.700[K] KOG2462 C2H2-type Zn-finger protein  ali follow..  112TSLLEDEHICPECGKKYSTSSNLA-THR-CPYCEKVYVSMPAHNQGCECQFCGKR---------------FSRPWLLQGHIRTHTGEKPFKCGVCEKAFADKSNLRA---------IQTHSNTKPHTCARCGKAFALK----SYLYKHEESS--------CMKNRGGVPGSGAASGNRPPSSPKRQQAEAAVCAAS-DSAKSTLANKLLQ---------------------KEKDR---QAAMAFQGFPAGPEVTAYSHATSAQEEYEKFKRINVIQPKVMPHRVPSLYQDLLPNRHVPLALPLAMPYHFQGQATSTG----------QSDPTSVQEQPVDFSPKNNFTHSAKTSPFELTGNYAMV........................................................................................................................................................................................................................................................................................................................................................ 441
50 -11.600[T] KOG3512 Netrin, axonal chemotropic factor  ali follow..  432..GQDEDTPSAPSL---KLTMTCACKHNTCERCKPFYFDRPTDNDANECKMCQCNGHARRCRFNLELYKLSGRVSGGVCYNCQH-DTTGRYCHYCREGYYRDATKPPNHRKVCKRCTGKTCNHLSGQCP-CKEGV----------------------------TGLTCNRCARGYQQTRSHVAPCIKVPTNANMIQAESAGGGGGGGTGDYKDGGGSQVEEMKKYCGKCKSPKKLNLNKFCMEDYA-KFSIER-----QNEIYKYEINIQTIFKRNPMSGTTSSLLGRGNMMLLVPRKSIECQCPKIKLNKSYLILGRDSEAAPGYLAIGPSSVVLEWKDEWSLRMKRFQRRARKCS................................................................................................................................................................................................................................................................................................................................................................. 793
51 -11.500[O] KOG4265 Predicted E3 ubiquitin ligase  ali follow..  28  270.ENSDNSNECVVCLSDLRDTLILPCRHCLCTSCADTLRYQAN------------------------------------------------------------------------------------NCPICRLF----------------PGPPADPGGAEEARSPVPRVLQPRPGPE.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 347
52 -11.400[P] COG3303 Formate-dependent nitrite reductase, periplasmic cytochrome c552 subunit  ali follow..  11  81........KFAEKPNQYNS---RSTANGDGENIIYADEENPRLIVLWGGYAFAKEYNAPRG--HFYAVTDVRNILRTGAPKTANDGPQAMACWTCKGPDVPRLIAEWGEKDYFNAKWAKGGPENSIGCADCHDTTSKDFAEGKPIARPHVLRALDALEKATAEKDKAEGRPHNNLSFNTAARTEKRAEICANC----HVEYYFAGDIKQVTFPWDNGQTVDDIEKYYD-GMHGKNGVT--CVDCHMPTCANC-----HDQSK-EKLRDIVTSRKKEVKDVMGRLEDQVVKAHFEAKEAWDAGATKKEAPEVVLRVLASGLDKVADARTKLAVILTKDIEKERKAKEEFLKTVVPQWEQQAREKG---LLVDPPAQK.............................................................................................................................................................................................................................................................................................................................................. 538
53 -11.300[S] COG4306 Uncharacterized protein conserved in bacteria  ali follow..  5...........................................................................................................................................................RAAQICTNGHVATTAADQKHELWEAFCSHSGEATYPKC----------------------SASIRGDDYVEGVLGFGGDYEPPTFCNNCGSRF----ERKIAGTVELVEAGTDLTPDEVQQFRTDLTQLTKDSPKTQVTCLRFKKVMAKVRTSVASGVRDI------VVDVLSEAAKKAI....................................................................................................................................................................................................................................................................................................................................................................................... 158
54 -11.300[O] KOG4628 Predicted E3 ubiquitin ligase  ali follow..  11  227.NANNKYDTCVICLEDFIE-RVLPCSHPYHTHCIDPWLTENRR----VCPICKRKVFTKGEARASRSRQPSLDNVTDTDDDTTPLLQQ.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 312
55 -11.300[R] KOG1842 FYVE finger-containing protein  ali follow..  15.DVVRQGFICPFCMEDFGEYERLI-DHP--VSNVKGFFDKAKRGIQKLDAKKSIADLASNVETEFTETTEKLVERAPLPRIPKPLPPDEILPGTRRSKTREFLST---------------------------RELNINEVAVRTNMLIIRLDRLINGGPLDDAEAVCCPLCASR-TRRRHHCRLCGRVLCHSCSKLSQKSMDKMKRAMAGAVQKVHSAATGEEIIAGALNEQDLSEHMRVCNLCLRDLHFRESQMDKKEPPEFVQQYDLMKVMIEEVKNLVKHGEELRSKCLEIQKSIDYVSKKIAEKEQQLRKNIRLYAVQALQLIIKRKERRAKDFARVNRQTDHPLYEQREQLRKFLFQASATGKL--------DEMDILERNKEIEEEMMRLGLS....................................................................................................................................................................................................................................................................................................................... 562
56 -10.800[O] KOG1873 Ubiquitin-specific protease  ali follow..  11  5..............................................................AKKKARAPTKEIQTMEISKKVSEEPPSQAGEIAEGDVKAVKETQACVH---EKVLDKIKSSRQIKCAECNEGVYGKRG---------------TKAKGSKGKKDFSSSDPKSNNKAIWLCLECGCYVCGGVGLPNGP-----QSHVLRHSRV---------------TRH-ENPQLRWCFPCQLLL----PVEKEDNGEKKDVLSEVVKLIKGRSLNNLVNLGNTFNSIMQNLLSLDRLRD-LKENGSGVGGPLASSLRKLFTETKPEARAFFGSFCSDQHDSHELLRCLLDSLSTEESALRKKRGVSDNDEKSTTLIESV-FGGETSSIVSCMECGHSSKVYEPFLDLSLPVPFKKSPPKK.............................................................................................................................................................................................................................................................................................. 394
57 -10.800[K] KOG1244 Predicted transcription factor Requiem/NEURO-D4  ali follow..  14  211.............................CDICGKRYKNRPGLSYHYAHSHLAEEEGEDKEDSQPPTPVSQRSEEQKSKKGPDGLALPNNYCDFCLGDSKINKKT---------------QPEELVSCSDCGRSG-----------HPSCLQFTPVMMAAVKTYRWQCIECK--------CCNICQLLFCDDCDRGYH----------------------------MYCLTPSMSEPSWSCHLCL--DLLKE.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 380
58 -10.800[C] KOG2282 NADH-ubiquinone oxidoreductase, NDUFS1/75 kDa subunit  ali follow..  11  41VMVEPGTTVLQACEKVMQIPRF--CYHE-CRMCLVEI---------------------------------------------EKAPKVVAACAMPVMKGWNILTNSEKSKKAREGVMEFLLANHPLDCPIC------DQGGECDLQDQSMMFGNDRSRFLEGKRAVEDKNIGPLVKTIMTRCI-----QCTRCIRFASEIAGVDDDMQVGTYIEKMFMSELSGNIIDICPV-ETRKTESIDVMDAV-----SNIVVSTRTGEVMRILPRMHEDINE-------ISDKTRFAYDGLKRQRLTEPMVRNEKGLLTYT-EDALSRVAGMLQSFQGKDVAAIAGGLVD-----AEALVALKDLLNRVDSDTLCTEEVFPTAGAGTDLRSNYLLNTTIAGVEEA....................................................................................................................................................................................................................................................................................................................... 397
59 -10.800[T] KOG4345 NF-kappa B regulator AP20/Cezanne  ali follow..  12  4TKDDAQKWKCETCT-YENYPSSLKC--TMCQA--KPLLNEDIFRLSPAQESCTVAEEAAAVESPTPSSTCYSLQPQSQARQSNVADSEKWPCKVC--TYLNWPRSLRC--VQCCT--ASHRLSLSRGIDDAQQQMQLQLQPQQQRESSSSAAVPPQQQKQCYVSKWACNSCTYENWPRSIKCSMCGK--VDTVSVNNSFNKKHIYQLGSSETINNCDTLQERQERRQRQIRRQVDWQWL-CLGVNYSAVEAYLSCGGNPARSLTSTEIAALNRNSAFDVGHTLIFHREEMLPMLLDQISGSGPGIKRVPSYVAPDLAADIRHFANTLRLRKSGLPAEIEELPIPIQEQLYDELRDAQKQLETPPPALNWSLELWNRSAGDCLLDSAMQLRRALADTLHQ....................................................................................................................................................................................................................................................................................................................... 547
60 -10.700[IG] KOG1340 Prosaposin  ali follow..  11  429.ALVEGGELCTLCEYMLTDDEIKHTVENICAQC-RNFVEMYGDAVIALLVQGLNPRDVCPLMQMCPKNLPKKEDVEVFNPQPASDEQDPPTCPLCLRDNKSKDNIKKVLNGLCSHLPNEIKE-------ECVDFV------------NTYSNELIDMLITDFKPQEICVLCPKTTYALWDNCLICEELVCDKCHKVIDKYGD-----KIADLLLKEMDPKLICTELGMCILADLDDLPPTCVLCEFIMCNQCDTFVDGYASAVLKLLSDVPPKQQKLQLCFSVAVTDEVLECGVCHGVTQALLPFLRKDNVSEVTALQMTSVGCENLPA---KYYKICSEMISIYGSSIKNLAKRPYIDQSHICAEIGKCFESEKSSLAFARISA..................................................................................................................................................................................................................................................................................................................................... 953
61 -10.700[R] KOG4377 Zn-finger protein  ali follow..  13  306..........................................................................................................DCGFERC----GYRNHQSHFHCRDCHYSFCDKTRFVQHTARHERMDTLMGDDFRQFRANMQCGVTASSRKTSHFHCRKCDYVCTDSNKVVAHRRL-----HL--RQDYVRNAGFRKVGGNEQCDSYAQRHTHYHCVTCDGGVLSRAQLAAHKHRTG................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 483
62 -10.600[O] KOG0317 Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein  ali follow..  22  278.FIPEASRKCILCLMNMSDPSCAPCGHLFCWSCLMSWCKERPE-----CPLCRQHCQPQE.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 331
63 -10.500[O] KOG1571 Predicted E3 ubiquitin ligase  ali follow..  36  282.HTLSQDQLCVVCSTNPKEIILLPCGHCLCEDCAQKISVT--------CPVCRGSIV............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 330
64 -10.300[R] KOG3183 Predicted Zn-finger protein  ali follow..  12  13...........................................................................................................CSVDYCKQ----------FTCDRCLQVY-----------------------------------CLDHRSYMKHDCPK-TVVICPLCAKGVRLNPDEDPNITWEKHVNTDCDPSNYEKAVKKCRELLTFSNTIKCRDCSIDHCL------KHRDHSCSGPKKPESSFSFM-----GFLSTNTKEAPASSSSSSRWSSLFASAEASISRLGNDISQKLQFASGNDGNSEKTQERNGKQNCGKVTVDVCPKCSRGFRDPVDLLKHIDKDHRGTSKA.......................................................................................................................................................................................................................................................................................................................................... 249
65 -10.200[K] KOG4577 Transcription factor LIM3, contains LIM and HOX domains  ali follow..  23..PMQQIPQCAGCNQHILDKFILKVLHSSCLKCAD-----------------------------------------------------------CQMQLADR-------SVYCKEDFFKRFGT---KCTACQQGIPPTQVVRKAQDFVYHLH-------------FACIICNRQATGDEFYLMEDGRLVCK-------------EDYETAKQNDDSEAGAKRPRTTITAKQLETLKNAYKNSPKPARHVREQLSSETGLDMRVVQVQNRRAKEKRLKKDAGRHRWGQFYKSVKRSRGSSKQEKESSAEDCGVSDSELSFREDQILSELGHTNRIYGNVGDVTGGQLMNGSFSMDGTGQSYQDLRD......................................................................................................................................................................................................................................................................................................................................................... 304
66 -10.100[D] KOG2186 Cell growth-regulating nucleolar protein  ali follow..  4.......FQCDDCGENLKKPRL-MCTAT-CIDCGNMFGQVSVHYH-------NQCITEAEKYGPMVRSNGESSKQKHDFDINAELFNSQWFCSLCNATMTCEQDYFAHVYG---------------------KKHQEKANEVADMDYSKQQSEHPAVDKNNLTQQPDLDIYVGLSNDYPWFCSLCDINATSEQTLLAHAN----KKHR-TQHSTVDKKDYSKQQIEVDINVGLSNCYPWFCSLCNVKATCQQNLLSHANGRKHRENVELFDATQQQQLEKTTVDKKDTTVNASDGNSEQKKVDLLVSSGVANGYSQAHKKRKLETCDETWKREVVQAEEAKGGGEQKS.......................................................................................................................................................................................................................................................................................................................................................................... 333
67 -10.100[O] KOG4275 Predicted E3 ubiquitin ligase  ali follow..  22  644VEKLATDELCKICMDAPIECVFLECGHMACTSCGKVLNE----------------------------------------------------------------------------------------CPICRQY----------------IVRVVRFFRA...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 700
68 -10.000[OU] COG5082 Arginine methyltransferase-interacting protein, contains RING Zn-finger  ali follow..  11  51...............................................................................DDKDAIKEAAPKCNNCSQRGHLKK---DCPHIICSYC--ATDDHYSRHCP----------------------------------KAIQCSKCDEVGHYRSQ-CPH-KKVQCTLCKSKKHSKERCPSIWRAYILVDDNEKAKPK----------VLPFHTIYCYNCGG-FGDDCKEKRSSRVPNEDGSAFTGSNLSVELKQEYYRHMNRNSDENEDYQFSESIYDEDPLPRPSHKRHSQNDHSHSGRNKRRASNFHPPPYQKSNVIQPTIRGETLSLNNNISKNSRY......................................................................................................................................................................................................................................................................................................................................................... 290
69 -9.930[K] KOG3815 Transcription factor Doublesex  ali follow..  14  19...........................................................................................................................................................................PRAPLQRTPKCARCR----------NHGVLSWLKGHK-------------------------------YCKDCT---CEKCILIIERQ--RVMAAQVALRRQQANESLESLIPDSLRALPGPPPPGDAVAAPQPPPASQPSQPQPPRPAAELAAAAALRWTAEPQPGALQAQLAKPDLTEERLGDGKSADNTEV......................................................................................................................................................................................................................................................................................................................................................... 169
70 -9.870[R] KOG4398 Predicted coiled-coil protein  ali follow..  10  4.......................................................................................................................................SSSSDESCKAPDNFRISSASTNGEDEESDVAGYTTKRRPTAATKELLKDANAK-CPLCHSCSAS--------------------------------------RFHCRNC-----AERPESLTEKQQRYINLQAGLKTFSTRYERLIGQ-HRSNEDRLMAIKAKRKQLELLQQLISGTGQRLGERRDELRRANAEKRKNL-----PKYPDKVKMLENYVLDRVEKIEKLRETHLGLLDSIKQAARRSIQQLVTYV................................................................................................................................................................................................................................................................................................................................. 233
71 -9.830[L] KOG1002 Nucleotide excision repair protein RAD16  ali follow..  11  574....KSEQECGLCHDPAEDYVVTSCAHVFCKACLIGFSASLGKV---TCPTCSKLLTVDWTTKADTEHKASKTTLKGFRASSILNRIK-----------------------------------------------------LDDFQTSTKIEALREEIRFMVER--------DGSAKAIVFSQ--------------------TSFLDLINYTLGKCGVSCVQLVGSMTMAARDTAINKFKEDPDCRVFLMSLKAG-------VALNLTVASHVFMMDPWWNPAVE-----RQAQDRIHRIGQYKPIRVVRF---IENTVEERILRLQKKKELVFEGTVGGSQEAIGKLT--EEDMRFLFTT............................................................................................................................................................................................................................................................................................................................................................ 833
72 -9.790[S] KOG4696 Uncharacterized conserved protein  ali follow..  10  2.......LSCNICGETVTSEPDMK-VHM-CPFCKLSGVNYDEMCFHIE----------TAHFEQNTLERNFERINTVQYGTSDNKKDNTLQCGMEVNSSILSGCA--------SNHPKNSAQNLTKDSTLKHEGFY---------SENLTESRKFLKSREKQSSLTEIKGSVYETTYSPPECPFCGKIEEHSEDMETH-----VKTKHANLLDIPLEDCDQPLYD---------------CPMCGLICTNYHILQEHVDLHL-QGMDRVQCSGDLQLAHQLQQEEDRKRRSEESRQEIEEFQKLQRQYGLDNSGGYKQQQLRNMEIEVNRGRM---PPSEFHRRKADMMESLALGFDDGKTKTSGIIEALHRYYQNAATDVRRVWLSSVVDHFHS........................................................................................................................................................................................................................................................................................................................... 351
73 -9.740[O] COG5540 RING-finger-containing ubiquitin ligase  ali follow..  13  313.RRATFGVECVICLESFTK-VALPCKHEFHRPCIAKWIVDYRH----ACPTCNTEVPPPK.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 370
74 -9.730[O] KOG0944 Ubiquitin-specific protease UBP14  ali follow..  11  23.QKIFKD-QCAYCFKDPHGKISLKNYHAFCREHAEIYGTTSGNTLFVQFESTKKIIEERTDGEPTSKMTKLTIDSDPKFEFEDEYSQQVKNVQNLPEIAEAIAQIANTTSAERLSLLSSTSNAWDAEIKLITKHQNLEQQD-------------NGKHLALTGWTCEVEGCGLNDN----LNLTDGAVRCGRSQFLSDGKKTNGNGHMQDYFDSTRFPLVVKLGTISS----NLELIDVYSYDEDDAV------LEKHLKHFGLDPTKMEKTAKSTMNSVLQALVTVDSFQTRYGE--QGLETLVNCPLDKLHNDFNAQFSKVVRAMLSGDYSSEMD-PTNNHIKPLQFKRVAAG-TSKQQDVEEYIRFLFEKIAENSRTEVIDPTDSFKFKAINRFE........................................................................................................................................................................................................................................................................................................................ 453
75 -9.730[O] COG5207 Isopeptidase T  ali follow..  11  35.AVVSKD-ECIYC---FESPICLNCFQATCNRHVPLHIRVTEYACDTIHSVEKPKQENVEENNNNKKIKLQVIETSEDDTHNTIWSLQRFNGENVPRTVLSKSTDSDISSTALEKI------EKILKAKSQDFEDKKNSWVLEISTCPHTENFQIPSKPENTVNLNQCSSCDLTQN--LWLCLHCGNIGCGR--ALDH--YRSNNNHPLA----------------IKLGSLSSSTYDLYCYACDDET----LQVEQNENWQFRMVDSSGKEFEKLLINLLNSVIQSLVNGGVPNWSLDFLGSKFPLDVVYPDNNLKCQWIKLLNAMKCEPELYPNGIKPTT---KKCIGQNHQEFSSNRQQLTFLLDLLDKKFFSSSSSGIPNPNDLVRFMMEDRLQCNICGKVKYSYEPTEAIQIPLEENDEPQDMLERIKA.................................................................................................................................................................................................................................................................................... 512

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 1 8 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.