current user: public

If you have questions about the server, please let us know.

Query: [O] KOG4400 E3 ubiquitin ligase interacting with arginine methyltransferase, from VFDB

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .
# Score Template Links and tools%idFirst MARITNMGKRKRFLEATPYESKVLEQPKNSSNTNEESSSQDNMKASFGSSKRYDERQKKKRSEYRRLRRINQRNRDKFCFACRQQGHIVQDCPEAKDNVSICFRCGSKEHSLNACSKKGPLKFAKCFICHENGHLSGQCEQNPKGLYPKGGCCKFCSSVHHLAKDCDQVNKDDVSFGHVVGVAGTTGADEDVYHEYAKTVAAPTKKRPVKPVKKLVTFLast
1 -69.000[O] KOG4400 E3 ubiquitin ligase interacting with arginine methyltransferase  ali  100  1MARITNMGKRKRFLEATPYESKVLEQPKNSSNTNEESSSQDNMKASFGSSKRYDERQKKKRSEYRRLRRINQRNRDKFCFACRQQGHIVQDCPEAKDNVSICFRCGSKEHSLNACSKKGPLKFAKCFICHENGHLSGQCEQNPKGLYPKGGCCKFCSSVHHLAKDCDQVNKDDVSFGHVVGVAGTTGADEDVYHEYAKTVAAPTKKRPVKPVKKLVTF 218
2 -36.400[OU] COG5082 Arginine methyltransferase-interacting protein, contains RING Zn-finger  ali follow..  26  55......................................................................AIKEAAPKCNNCSQRGHLKKDCPHII-----CSYCGATDHYSRHCPKA-----IQCSKCDEVGHYRSQCPHKW-----KKVQCTLCKSKKHSKERCPSVLPFHTIYCYNCGGKGHFGDDCKE.......................... 179
3 -21.100[T] KOG4825 Component of synaptic membrane glycine-, glutamate- and thienylcyclohexylpiperidine-binding glycoprotein (43kDa)  ali follow..  15  677.DAEMRARRKAATEEAEKQKKEEIKALQGQLAALKEIQAEVQEKESDAVKPKNQDIQGGKAAPAEALGIPDEHYLDNLCIFCGERSHYWKHCLMLTR----CDHCKQTEHLLTECDKKD--GFGKCYRCSEPRHIKHKCNPAKPE--KLANRCPLCHEKAHLMGPCTMNLRKTHILQKAPALQPGKSSAVAASGPLGSKAGSKIPTPKGGLSKS.... 917
4 -16.500[K] KOG1244 Predicted transcription factor Requiem/NEURO-D4  ali follow..  17  273........................................................CDFCLGDSKINKKTGQPEELVSCSDCGRSGHPS-QCIE-----KCCNICGTSEN---------DDQLLFCDDCDRGYHM--YCLTPSMSEPPEGSSCHLCLDLLKEKASIYQNQNSS............................................. 391
5 -14.400[O] KOG2813 Predicted molecular chaperone, contains DnaJ domain  ali follow..  12  136..TLDTFIEEREALTQTVPFTGGEFNGKKHGSEPGLWELDLRPQFPTLFVPYKETQVLVPNSETVEKCTGCTGRGDVVCPTCNADGEPG----YKENQMMKCSTCYGRGLVATICTNCNGKGKLPCPTCQSRGLIK----------------CQTCDSTGSLL....................................................... 283
6 -14.200[K] KOG2845 Activating signal cointegrator 1  ali follow..  15  94.DGQKSGDHLKRGRKKGRNRQEVPAFTEPDTTAEVKTPFDLAKAQENSNSVKKKTKFVNLYTRERQDRLAVALPGRHPC-DCLGQKH------------NNCLICGR-------------------IVCEQEG----------------SGPCLFCGEQDILQRDSNKSQKLLKKLMSGVENSGKVDISTKDLLPHQELRIKSGLEKAIKHKDKLLEF 272
7 -14.000[L] COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain  ali follow..  10  2.......................................................................RNTMIQSCNECKGKGY-------RVKSYKICSACHGTGFRARQRFDLEDSHEVPCEVCRGKGEVEVR------------ETCPTCGGKGEVNISCGRMMKGRDEYCPECQKKEKVYILHPACTMDDLEVGS................ 130
8 -12.700[R] KOG4602 Nanos and related proteins  ali follow..  15  216.............................................................QDQGLGAPGANGGLGTLCNFCKHNGESRH-----------------SSHQLKT----------------PDGVVV--CP--------RHYVCPVCGATGHTLKYCPLNGGQQSLY.......................................... 294
9 -11.700[R] KOG4299 PHD Zn-finger protein  ali follow..  12  189.KPLFSGKLTFKANIPVPTSEVVTENNVTRNVTVYSNQKHLGNESENFNDMEGRAEDISSNELLPTPEEYPYRYNNDYCSACHGPGNFL--C---------CETCPNSFHF--TCIDPPIEEKNLCNECKHH--LCFRCHKSALVSQS---ACDYCNSYWHP--DCPLATLPSNLRKWKC--PNHSDHVTPRYRLPEKAKVIRVGLPRGFKNKGNIVI 489
10 -11.300[O] KOG0006 E3 ubiquitin-protein ligase (Parkin protein)  ali follow..  11  292..................................................................AEECVLQMGGVLC-GCGAGLLPEPDQRKVTCEGGNGLGCGFA-----------------CRECKEAYHEGECSAASKETIKKTTKPCPRCHVPVEKNGGCMHQPQCRLEWCWNCGCE................................... 424
11 -11.200[K] KOG2461 Transcription factor BLIMP-1/PRDI-BF1, contains C2H2-type Zn-finger and SET domains  ali follow..  10  465.....................................GGSAHTSSFHQLPFVNHSSSSHNDSSPNYVQQQENGKTRYACKDCNKT-HVR----HTGERPFKCEICTKEAHLQKHHLVHTGERPHRCDICDKNGQKPYTCDVCDAKANERPYSCGTCGKK-TTCKEEDMKLMDIKGEIDEGSMNSELKRPLMPIETIYSKYNLPNASLLGQGPS..... 715
12 -11.200[R] KOG3002 Zn finger protein  ali follow..  14  1MAPGGSALKEALESNSTGVDYEVKMAKVEANSKPTKSGSGSIGKFHSSNGVYELLECPVCTNL------------YPPIHQC-PNGHTLSSC--KLRVQNTCPTCRYELGNIRCLALEKVAESLECLGCQDLKH-EQHCRFRSYSCPYAGSECSVTGDVDHLKDD..................................................... 168
13 -11.100[S] KOG3899 Uncharacterized conserved protein  ali follow..  16  285.............................................................AQVAQNPIFPDDATTEKCFACMLN-KIHKQCADFDANGACCSNC--------YC------RPMWCVECLARWFAARQSDVDREVWLEQKCTCPMCRAK------C.................................................... 379
14 -11.100[O] COG3058 Uncharacterized protein involved in formate dehydrogenase formation  ali follow..  17  186..........................................................................QRQYCPVCGSMPVSSMVQIGTTQGLRHCNLCETEWHVVR----------VKCSNCEQSGKLHYW---DDEQAAIKAESCDDCGT............................................................ 260
15 -11.100[O] KOG0715 Molecular chaperone (DnaJ superfamily)  ali follow..  22  181.........................................................................DAYVFCDSCDGLG------HPSDAAMSICPTCRGVGRVTIP------PFTASCQTCKGTGHIIKE-------------YCMSCRGSGIVEGT..................................................... 247
16 -11.000[TZR] KOG1704 FOG: LIM domain  ali follow..  17  202..............................................................................HFQC-------AQCNDVRANKPVCLKC------------HSSSSTFSCTTCRLS-HASAEC------------CCCVCSKNKYSRVGCGY.................................................. 292
17 -10.900[T] KOG3575 FOG: Hormone receptors  ali follow..  15  19.............................................................MSSFPEPSPSSKRPTENCKVCGDRPRY---------GASACLGC--TVFFRRAVVKNLK------YKCMKEQ----NCLISCT----YRNACRYCR------QKC.................................................... 96
18 -10.900[O] KOG2231 Predicted E3 ubiquitin ligase  ali follow..  12  3.................................NGKPRSSARPSFHRRPKDGVANTTTDNAAVKPEALESYTGNDDNACVVCFKN-FSIGDC-----DHPVCYECSTR-CQQNECPICRHVLSKPCPKCDAPNHVRSECVETLNRSHRGHPLCEYCNKRYVDRDELFRHLRREHYFCHFCDADGEFYNDYADLAEHFRAEHFLCEEGKCATEQFVGAF 276
19 -10.800[TZ] KOG1044 Actin-binding LIM Zn-finger protein Limatin involved in axon guidance  ali follow..  18  3.....................................................GTRCHGCGEFEGEVVTALGKTYHPNCFACTI-------CKRPTTFSSNCAGCGRDIKNGQALLALDKQWHLGCFKCKSCGKVLTGCEKDYQGLF--GVKCEACHQF-H---SC---------RCSRCNQ.................................... 164
20 -10.800[S] COG4306 Uncharacterized protein conserved in bacteria  ali follow..  14  10.................................................................................CTNGHVATTAAQKHELWEAFCSHSGEA--------------ILQYPKCSARGDDYVEGVLGFGGDYEPPTFCNNCGSR........................................................... 77
21 -10.800[R] COG5222 Uncharacterized conserved protein, contains RING Zn-finger  ali follow..  14  178..........................................................................PGYMCYRCGGRDHWIKNCPTNSDPNRIRRTTGIPKKFLKSIEIDPETDDLKCPLTGG---TSKCCNID----------SKEALENALVESDCPN-----------CETRDILLDSLVPDQDKEKEVETFLKKQEELHGSS.... 364
22 -10.800[R] KOG4399 C2HC-type Zn-finger protein  ali follow..  20  396......................................................................KNVAGYKFCEVCDRY---------VTERNVHCDRCQA-------CTSVEQGKWNHCEKCDK-------CVKPR---------CAQCARCHLYGRCIQKHDE............................................... 467
23 -10.700[T] KOG1701 Focal adhesion adaptor protein Paxillin and related LIM proteins  ali follow..  16  415.......................................................RCARCGENEGTGCTAMDQVFHVDCFTCIICNNKLRGCEP-INTLEQCNVCSKMERILRATGKAYHPHCFTCVMCHRSGLI---CIEDFHKKFAP--RCSVCKEP-H--VHC---------RCEDCGGL................................... 575
24 -10.700[S] KOG2673 Uncharacterized conserved protein, contains PSP domain  ali follow..  12  106............................................................SGSNNVEGGLEIIDDPPRCFNCGAYSHSIRECPRPFDRSAV--SNARRQHKRKRNQTPGSRLPSRYYQ--KPGSLDAETRKL--KELDPPPWLNRMREIGYPPGYFAVEEDDDDHSRITIFGEEETKEEEEVKTEEGEILEK--ASPQEPRKIMTVGF 268
25 -10.500[O] COG0484 DnaJ-class molecular chaperone with C-terminal Zn finger domain  ali follow..  15  142.........................................................................PTYEACDVCNGSG------AKPGTSPETCPTCKGSGTVHIQ--QAIFRMQQTCPTCHGAGKHIKE-------------PCVKCRGAGRNKAV..................................................... 212
26 -10.500[R] COG5141 PHD zinc finger-containing protein  ali follow..  15  193....................................................LDGRCVICNEA-----ECENSNAIVFCDNCNTSVH--QNCPFVPEGQWFCKKC-----------LLAPHEVICCAFCPDRDHTI--CLVRNIASIPKSRVCCICKLRWGTCVQCSDKN---------CYAAYHIT--C---ARRAGFFYKIYSHSASYDSVDMETY 358
27 -10.500[O] KOG1571 Predicted E3 ubiquitin ligase  ali follow..  24  256............................................KQEREEAKIRERLDTERRERRARSRPHTLSQDQLCVVC------------TNPKEIILLPCG---HVC------------LCEDCAQK--ISVTCP--------------VCRGS........................................................... 328
28 -10.400[O] KOG1645 RING-finger-containing E3 ubiquitin ligase  ali follow..  4RRSYPFSGHGGTIARFIEFGEAFGHYGEEEDEEEEDEEEAYVDYGEVQEEDEEEEEEEDSERQTREYIDVLDSPVRVSQNESEGIENQNRRMSNGNKVTLRDCLVLSVGP------------AVANTKS---GILSIVFPVD-MDIPASTSGFSSDEVEGSLR....................................................... 156
29 -10.400[R] KOG4323 Polycomb-like PHD Zn-finger protein  ali follow..  10  116.STKTKNGRIRSSRREDDNRIPFYDLDVAEGAEDDLQEDFHVEGMKTKSGRKIQRPVAYNPNATALKRKSRKVDMVTLCSVCQR-----GHSPLSNR---FCDGCNSPYH--QLCHHPPIDDATVCMKC......................................................................................... 243
30 -10.300[O] KOG0712 Molecular chaperone (DnaJ superfamily)  ali follow..  17  132.........................................................................QKKVICPKCSGRG-------GKEGSVKSCASCNGSGVKTRAMGPMIQRMQMTCPDCNGAGETIRD-----------EDRCKECDGAKVISQR..................................................... 207
31 -10.200[K] KOG4218 Nuclear hormone receptor betaFTZ-F1  ali follow..  14  2........................................SSNSDTGDLQESLKHGLTPIVSQFKMVNYSYDEDLEELCPVCGDSGHY---------GLLTCESC--KGFFKRTVQNNKR------YTCIENQ----NCQIDKT----QRKRCPYCR------QKCLSVGMKLEAV.......................................... 110
32 -10.100[BK] KOG2626 Histone H3 (Lys4) methyltransferase complex, subunit CPS60/ASH2/BRE2  ali follow..  15  14.............................................................................................PKTAPTTVCY-CDGKREL--------GSVEVVCSTCLKWFH--GRCLKEFHEFSRNSNTCKQCRPTAE---DWKAKKADLVQMCVTV----TLSAERLKADGKLSAEHVPEDFTYLSLKDEIVPY 132
33 -9.950[O] KOG2824 Glutaredoxin-related protein  ali follow..  21  206.........................................................FEIGELAKILKEFPMRQPGFVCHCCGDIRFV------------PCSNCSG----SKKLFDEDEDRVKRCPECNENG-----------------IRCPDCSS............................................................ 274
34 -9.860[O] KOG0314 Predicted E3 ubiquitin ligase  ali follow..  20  117..........................................................................PGYVCHRCNVSGHFIQHCSTNGNPNEDAFEKEMEGLTSTTRSVGEFPPELKCPLCKE---LASKC---------LKSYCDKCIRDHIIAKSCGATH................................................ 248
35 -9.750[S] KOG4623 Uncharacterized conserved protein  ali follow..  13  38.........................................................................DARVNCWFCNGNVRV----PYQDRNSWTCPSCEKDGDYNRDITSQPAPKNGLCDQCNNESRFDQELKVYRERLEKQFRLCSSCERH........................................................... 173
36 -9.670[C] COG3005 Nitrate/TMAO reductases, membrane-bound tetraheme cytochrome c subunit  ali follow..  19  42........................................................................TSTTEFCVSC----HSMQP-QNASGVRAECHDC----HIEREWARMKENNSATCRSC----H-NPEAARQMKIAAKENQSCIDCKGIAH......................................................... 179
37 -9.620[D] KOG3056 Protein required for S-phase initiation or completion  ali follow..  12  399LNEKFSSSAKRQKIDEDDRELMRKSRIEKIMAATSSHTNLVEMREREAQEEYFNKLERKEAMEEKMLTTYKMPCKAVICQVCKYTAFSASD------------RCKEQKHPLKVVDAEKR----QCKDCGNRTTTVFKLPKQS---------CKNCKGSRWQRTAMIREKK............................................... 546
38 -9.610[KL] COG5151 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1  ali follow..  14  310.............................................................................HCPRCK-----AKVCTLPIE----CPSCSLSTHLAREIPWSANPKSTHCFACQLPFPKPPVSPFDESTSSMR--ACPSCKNH--FCLDCDVFAHEQLHECYGCQCS................................... 419
39 -9.610[KL] KOG2807 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1  ali follow..  14  310.............................................................................HCPRCK-----AKVCTLPIE----CPSCSLSTHLAREIPWSANPKSTHCFACQLPFPKPPVSPFDESTSSMR--ACPSCKNH--FCLDCDVFAHEQLHECYGCQCS................................... 419
40 -9.580[R] KOG0490 Transcription factor, contains HOX domain  ali follow..  19  3............................................................................VHCAGCERP-HI--KC--------QCCECKSEKCFSRECKNDFRRFGTKCAGCAQG-HL--NC------------TCMVCGEELYVIDECKD.................................................. 117
41 -9.510[O] KOG1814 Predicted E3 ubiquitin ligase  ali follow..  14  278......................................................................DPGQKLAICQKCDFA---------------FCSFCQATWHGDLSPCKLEGLNGQRCPTCDRVCHMNCLC---------GTHFCFLCGAYKHFNDP..................................................... 412
42 -9.500[U] KOG2066 Vacuolar assembly/sorting protein VPS41  ali follow..  13  668IIEASNCLDPLLIMDKLPDDSDIPNLSEALDKLLVDYTNHAELQQCCYDSTLNDLNVLTQGLISAADESVS--NIVSRCSLCAQIIINSNQETTKKFSDIKVFKCGHIFH--LACERRQSIEEGLCIACSDQIELIN................................................................................. 806
43 -9.400[R] KOG1819 FYVE finger-containing proteins  ali follow..  19  565.......................................................................PDEDCEQCTACSRRHH--------------CRNCGRI-----------------CHKCS-----CNTISIPEHGYDRKPVVSSPQ.............................................................. 621
44 -9.380[U] KOG2034 Vacuolar sorting protein PEP3/VPS18  ali follow..  10  799...................................EDYNKQIEQLKEEMNDATRGADNIRNDISALTQRYAVIDRDEECGVCKRK-RMAQGYSSAGPLAPYVFPCGHSFH--AQCLITHVTSCAHEEQAEHILDLQKQLTLLGSETRRDASECPFCGELMINEITLP------------------------KPEDSQYSTSWDLRSETNLANQRTISL 992
45 -9.360[K] KOG4215 Hepatocyte nuclear factor 4 and similar steroid hormone receptors  ali follow..  22  34.............................................................SEGTNLNAPNSLGVSALCAICGDRAHY---------GASSCDGC--KGFFRRSVRKNHM------YSCRFSR----QCVVDKD----KRNQCRYCR------KKCFRAGMKKEAV.......................................... 121
46 -9.340[P] COG3303 Formate-dependent nitrite reductase, periplasmic cytochrome c552 subunit  ali follow..  14  191......................................................................PEIVNSIGCADC----HDTTS-ARTEKRAEICANC----HVEYY-LGMHGKNGVTCVDC----HMPKVQGADGKVYTDHDSTCANC----HDQSK..................................................... 377
47 -9.230[O] KOG0317 Predicted E3 ubiquitin ligase, integral peroxisomal membrane protein  ali follow..  12  227GSWIYGRKRTNDSITRSSVGLQERSEHESIEGIPKESQLTHINLSDKNQLPFIPEASRKCI--------CLMNMSDPSCAPC---GHL------------FCWSC-----------MSWCKERPECPLCRQHCQPQEILV.............................................................................. 334
48 -9.210[K] KOG4577 Transcription factor LIM3, contains LIM and HOX domains  ali follow..  20  23.......................................................................PMQQIPQCAGCNQH-HS--SC--------KCADCQADRCFSRACKEDFKRFGTKCTACQQG-HL--HC------------ACIICGDEFYLMEDCKE.................................................. 142
49 -9.210[C] COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB  ali follow..  13  49..............................................................................CGQCGYPGPYAEAISCNGEKINRCAPGGEEAQELTPARMVAVIDENNCIGC---TKCIQACPVDAIVGATRADLCTGCNL----VDPCPT.................................................. 159
50 -9.190[O] COG5243 HRD ubiquitin ligase complex, ER membrane component  ali follow..  11  343........................................................................ANDDNICIICMDELIHSPNQQTWKNKNKKPKRCGHILHL--SCLKNWMERSQTCPICRLP--VFDEKGNVVQTTFTSNSDITTQTTVTDSTGIATDQQGFANEVDLLPTRTTSPDIRIVPTQNIDTLAMRTRSTSTPSPTWYTFP. 485
51 -9.170[R] COG5236 Uncharacterized conserved protein, contains RING Zn-finger  ali follow..  13  2................SESVKENVTPTRNFRRTQGPQNNTKPHNDRKNFRRKQKKNNLSAEPNLTTSSADDTDEENELCVICARKHHTCHICGFRQRNKKSCLICRTNEHLKSE-------NRMICLICATHKHQTKGNSEGFKG------MCAFCSGK-HMRNQ--------HEKCHICDKMN.................................. 256
52 -9.110[C] COG3043 Nitrate reductase cytochrome c-type subunit  ali follow..  17  76......................................................................................HSVEGYQVTTNTNR-CLQC----HGVESYRTTGAPR--------SPTHFMDSDGKVGAEVAPRRYFCLQC----HVPQ...................................................... 137
53 -9.090[C] KOG3458 NADH:ubiquinone oxidoreductase, NDUFA8/PGIV/19 kDa subunit  ali follow..  19  33......................................................................................HLGKQCEQANNEFMLCRACLAEGKAVTSCALDFFRKVKK--TCHEEFTQYATCLDKSSGTMAFS----HCRKTQGVFDKCIKDN................................................ 117
54 -9.040[O] COG0068 Hydrogenase maturation factor  ali follow..  12  90.............................................................HSVSGVVRTEITPDAATCPEC------QREIFDPFSRF-NCTHCGPRLSIIRAIPYDRCNTSMSCPECEDSYHDVEN-----RRFHAQPVACHTCGADGKPVTASMFSMLDDVDAVCTLLQKGHLACDATQEAAVEKLRQRKRRYDK.......... 252
55 -9.010[R] KOG0153 Predicted RNA-binding protein (RRM superfamily)  ali follow..  17  9..................................................................................NRQNWEDAEFP-------LCQTCGDNPYV----RMIKERFGKECKICTRPFTIFRWCPGARMR-FKKTEICQTCARLKNVCQTC.................................................... 82

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 1 8 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.