current user: public

If you have questions about the server, please let us know.

Query: [ET] COG0834 ABC-type amino acid transport/signal transduction systems, periplasmic component/domain, from VFDB

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260
# E-value Template Links and tools%idFirst MKKLVLSLSLVLAFSSATAAFAAIPQNIRIGTDPTYAPFESKNSQGELVGFDIDLAKELCKRINTQCTFVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADSRLVVAKNSDIQPTVESLKGKRVGVLQGTTQETFGNEHWAPKGIEIVSYQGQDNIYSDLTAGRIDAAFQDEVAASEGFLKQPVGKDYKFGGPSVKDEKLFGVGTGMGLRKEDNELREALNKAFAEMRADGTYEKLAKKYFDFDVYGGLast
1 0.000e+00UniRef50_A0A235CFG5 Amino acid ABC transporter n=21 Tax=Proteobacteria TaxID=1224 RepID=A0A235CFG5_9GAMM  ali  37  1MKKT----SLVLLLGTLCHAPAWAGEQIRIATEGAWPPFNYVDEQGAVSGFDVDIARALCSRMQTECDIVVNDWDGMIPGLRTRKFDAIVSSMSITEERLRQVDFTDRYYSGGLRFVGPRGAEVDVSPEALKGKVVGAQRATIASQYLEDHLAD-VVQIKLYDNQENVYLDMQSGRLELFLSDELPTHQWL-QTGNGQQFEFKGGSFAREDI----IGIAVRKGDP-LRNRLNQALSAILQDGTYQSINEKYFPFSIY.. 247
2 0.000e+00UniRef50_A0A1B2D348 ABC transporter substrate-binding protein n=18 Tax=Burkholderiales TaxID=80840 RepID=A0A1B2D348_9BURK  ali  45  23...........................LKVAIDPTYEPFTYKTPDGKPTGFDVDVANAICAELKRNCVFVEQVWDSMIPGLQARKYDVIVSSLSITEERKRVIDFSDRYYKTPSAIVVKKGTP-YTGPASLKGKRIGVLKGSTQEKWAMGELKPAGVTVVPYEAQDQVYLDINAGRLDGTVADKVEVHGGFLRKPEGKDYGYVGHDQYETKYYGDGIGIGMRKGQKELKEQINAAIKTIRSNGTYNTIAKKYFDFDPYG. 253
3 0.000e+00UniRef50_A0A0M6YVN0 Histidine-binding periplasmic protein n=148 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A0M6YVN0_9RHOB  ali  37  1MRVLRMAAAAVAILAVVGGAEAKDWSKVRIGTEGAYPPFNSLTADGQLIGFDVDIAKALCEEMKVECEFVTSDWDGIIPGLQAGKFDAIIASMSITEERKQKVDFTNKYYNTPPAIAVPKDSKIATSDADLKGIALGAQSSTTHSNYAEEKLPS--ADLKLYPTPDEYKLDIANGRIDAVVDDVVVLSDWLA-TDDGACCKILGTLTPDLVINGEGAGIAIRKEDGELKDMMNEALAAILANGKYKEINDKYFTFDVYGG 258
4 0.000e+00UniRef50_A0A1S8YHD0 ABC transporter substrate-binding protein n=1 Tax=Izhakiella australiensis TaxID=1926881 RepID=A0A1S8YHD0_9ENTR  ali  45  1MKLLPLAALSLFAVATL----AQAQGELRFGIDPTFPPFESKAPDGSPQGFDVDIGNAICAVAKVKCVWVQTSYDSIIPALQARKFDAILSAMAMTEKRRKQVAFSDMVYNTPSALVVKKGSNIEPDIEGLKGKTVAVAQGTTQETYAQQVWQPKGIQVISYPNQEEIYPDLIGGRIDTTLTSAASAETGFLKSPPGADYALSKTRLYSKKYFGEGVGIGLRKDDNANLKLINDALAQLHKDGTYDKIAKKYFSFNVY.. 254
5 0.000e+00UniRef50_A0A2P6K4Z0 ArtJ n=1 Tax=Nephila clavipes TaxID=6915 RepID=A0A2P6K4Z0_NEPCL  ali  33  17.................FGTSAVAADKLKLGTEGAYPPFNLIDASGKVTGFDVEIGQALCAKMKAECEVVTSDWDGIIPALNAKKFDFLIASMSITDERKQAVDFTDAYYTNKLQFIAPKSADFKTDEASLKGKVIGAQRATIAGTWLEDNLG-KVVDIKLYDTQENAYLDLASGRLDGVLADTFVNWEWLK-SDAGKDFEFKGDPVFD----NDKIGIAVRKGDP-LREKLNTALQAIIEDGTYKQINDK......... 243
6 0.000e+00UniRef50_A0A1Y2R6M3 ABC transporter substrate-binding protein n=30 Tax=Betaproteobacteria TaxID=28216 RepID=A0A1Y2R6M3_9BURK  ali  45  1MKHLLLTLSLIGAATLVACGKTETXPELKVAIDPTYEPFTFKTADGKPTGFDVDIAEALCNEIKRKCTYVEQVWDSMIPGLQAKKYDVIVSSMSITEERQQVVDFTDKYYFTPSRIVVKTGTPF-TDLASLKGKKIGVLKGSTQEKYAMGELKPAGASIVPYEAQDQVYLDIKSGRLDGTVADQVEVNGGFLSKPEGAGYGFVGPVLNETKYFGTGVGVALRKEDTALKDQLNTAIKAIRGNGVYETVSKKYFDFDVYG. 279
7 0.000e+00UniRef50_A0A242NUG3 Histidine ABC transporter substrate-binding protein HisJ n=7 Tax=Gilliamella TaxID=1193503 RepID=A0A242NUG3_9GAMM  ali  52  1MKNLFKVVSALALLSCACLSDAKLPESIKIGSDTSYAPFDFIDKNGEITGFNIEITKALCEKANIKCEFQSTDFDALIPSLLSRKIDMISSSLMMTEKRKKQIAFSDEIFLTNSRLITKQGADLLPTVESLKGKRVGVEQGTSQEHFVNDKWRPNGVIIVPYQNQLQVFSDLVAGRLDAALQDEVTGSYAFLKQPQGKDFAFAGEVLNDKGYFDVGVGLGFRKKDDELREAFNKALVEILNDGTYQKINDKYFDFNVY.. 258
8 0.000e+00UniRef50_A0A285FY76 Amino acid ABC transporter substrate-binding protein, PAAT family n=2 Tax=Halobacteroidaceae TaxID=53434 RepID=A0A285FY76_9FIRM :  ali  32  41......................QAEGKLVVGMDAAYKPFEYQDKNGEIVGFDVDVLKEVAKKLDIKLDLQNTSFDGIIPGLQAKKYDLIMSAMTITEERKKAVNFSDPYFNAGQVIAAMGDNSSVKGVKDLEDKIVAVQLGTTGDLKVSEMEGVK--EIKRFDTIPEAFIALQNGQVEAVVNDLPVTAAYIKEHPEVK--------IVGEPFTTEYYGIAFRKEDTELKEKINEALAELKQDGTYDEIYAKWF....... 261
9 0.000e+00UniRef50_A0A2A6GTN0 Nickel transporter n=5 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2A6GTN0_9RHIZ  ali  38  25........................EETLRIATEGAYPPFNQTEPDGTLSGFDIDIAKALCDDLKIKCEIVKQDWDGMIPGLLARKYDLVVASMTITDDRKKRVDFTQKYYQSPNVFSAKKGSSFVLTKEGLAGKSIGVQRGTIHACFVQKFFTDS--DVKLYAGQQEAFSDMIAGRVDLVFSEAIGTNEQLLKLPDGKDFALVGDPQIDPDCLGEGVGIALRKRNDDLRERLNKAIADIRGNGTYAKINAKYFTFDIFG. 257
10 0.000e+00UniRef50_A0A259UAV9 Glutamine-binding periplasmic protein n=36 Tax=Bacteria TaxID=2 RepID=A0A259UAV9_9FIRM  ali  28  3.KKWIAVVALLALTMGLVGCGSSAAKVLKVGAEATFPPFEFQDENNKYVGFDVDLMKAIGKQMGMEVQIVNTGFDGLIPALEGSQIDVIASAMSITAERANKVAFSKPYYKSGLSIVVKADNSTINNFKDLEGKRIAVQIGTTGAENAKKI---KDAKVREFNSASEAYLELKAGGADAVVNDLPVNEYYLAK-GGSKDAKLVG-----EVLNAEEYGIAVAKKNTELANKINKALDELKQNGEYAKIYEKWFGK..... 255
11 0.000e+00UniRef50_A0A158B9P7 Histidine-binding periplasmic protein n=37 Tax=Proteobacteria TaxID=1224 RepID=A0A158B9P7_9BURK  ali  51  9.RKLAAFAVLGAAVVTLNAQAADDMKPLRFGVEASYAPFESKSPSGELQGFDIDIGNAVCAKLKMKCVWVENSFDGLIPALQARKFDGINSDMTITDKRKLAIDFTDPIYTVPNQLVAKKGSAIQPTVDSLKGKRVGVLQGSIQETYAKAKWATAGIDIESYQAQDQIYADLAAGRLDAAFQDAEAASKGFLKRPQGAGFAFAGPAVADDKLLGSGVGFGVRKNDKALKDALNRALKELKDDGTIDRFAQKYFDVKV... 264
12 0.000e+00UniRef50_A0A285FXN7 Amino acid ABC transporter substrate-binding protein, PAAT family n=4 Tax=Orenia metallireducens TaxID=1413210 RepID=A0A285FXN7_9  ali  33  2MKKIIL-LTLVFALFIMAGCSSQEQGTLVVGMSADYKPFEYHDKGDNIVGFDVDVLKEVSKKLNLKLELKDTAWDGIIPGLQAKKYDLIMSAMTITEERKKAVGFSDSYFNAGQIIAVLDGNNNIKSVEDLKGKKVGVQLGTTADLEASEM---EGVEVKRYEKIPQAFIELNNGRVDAVAADLPVVAKYTLEH--------SGVKIVGEPFTTENFGIAMRKGDTELLEKINTALAELKQDGTYDEIYAKWFK...... 252
13 0.000e+00UniRef50_I5CGK6 Cationic amino acid ABC transporter periplasmic binding protein n=13 Tax=Burkholderiaceae TaxID=119060 RepID=I5CGK6_9BURK  ali  46  1MKKPLVC---LALLLAALSVHAKELTELKFGVDPTYAPFESKAPDGKLVGFEIDLGNEICRRLHAKCVWVETAFDGIIPALQGRKFDAILSAMSVTPKRETQVAFSTTLFNTPSSLIGRAGAGLQPSAESLKGKNIGVAQGSTQEAYGKAYWAPAGINVVSYANQELVYTDLRSGRLDATLTDMISGSEGFLKTPQGQGYAFLGGPVNDAKTLGKGAAIGLRKDDPQLREMINQAIADMIKDGTYQKIERRYFDFDILNG 257
14 0.000e+00UniRef50_A0A1G7RMA8 Amino acid ABC transporter substrate-binding protein, PAAT family n=9 Tax=Proteobacteria TaxID=1224 RepID=A0A1G7RMA8_9PROT  ali  40  32..........................EITIGTEGAYPPFNYIGDDGELKGFDVDIAKALCEEMGADCTFETQSWSGIIPGLNAKKYDAIIASMSITEKRDEKVDFTNRYYKTPARFIAAKDMDVEISESGLEGKTVGVQRATVSADFVKDKFGD-VANIQTYDTQEEATLDLVSGRVDLVVADAVKLKEGFLASDQGQAFEFKGPGFSDPKWFGEGIGIAVREGEDTLRECFNKAIAGIREDGTYDKISQDNFGMNIYGG 264
15 0.000e+00UniRef50_A0A0B8PRQ9 Lysine-arginine-ornithine-binding periplasmic protein n=171 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0B8PRQ9_9VIBR  ali  42  1MKKLLMALAFAATL----GSTAVAAKEVRLASDFTYPPFNYKNAEGQPVGFDIEIADALCKEAELKCTWVSQGWDSLIPSLLARKSDVIMASMRITEERKQRILFTDKYYQTPARFVAQADADFAMDAEGLKGKVIGVQQGTIHDRYVTDKFG-KIADIKRYNGQDEVYIDMQNGRLDVTFGNADQLELAFLGKDIGKGFEFKGEAVTDKAYIGEGTALALRKQDKELAEKFNQAIEKIRANGTYDKIAAKYFNFDIYG. 254
16 0.000e+00UniRef50_A7HLX2 Extracellular solute-binding protein family 3 n=10 Tax=Thermotogae TaxID=200918 RepID=A7HLX2_FERNB  ali  32  1MKKFFTMVIAVLLVVLTVTSFAKQRGKLIVGTEPTFPPFEFVDEKNQVVGFDIDIAMELAKRLGVKLEIVSLPFDSLIPALQQGKIDLAIAGMTITKERAKVVDFSKPYFEANQAIVVRKDSKFEKKLEDLVGQKVAVQLGTTGDLVVSDI---TGINVVRFQKFTDAFLELQNGRVDAVVLDEAPAKAYVKK--------FSKFSISSIVDTGETYGIAVKKGNKELLNFVNQTLDIMKGSGQYNKLLQKWF....... 249
17 0.000e+00UniRef50_A0A2C9BEY4 Lysine/arginine/ornithine transport system substrate-binding protein n=11 Tax=Burkholderiaceae TaxID=119060 RepID=A0A2C9BEY4_9BUR  ali  49  10...LAVALCAAASMLVAVQVQAKEISTIRFGVEASYPPFESKTADGRLQGFDIDLGNALCAQLKAKCVWVENAFDGLIPALQARKFDAIDSAMNINAKRSEQIDFTQPLYRTPAQLVARAGSTLQPTAESLASHKVGVLQGSIQEQYAKQAWATKGVNVVSYQTQDLVYADLSAGRLDATFVDATAASLGFLNQPAGKGFAFAGPSVKDAKVIGTGVGIGVRKGDKELVDALNGAFLELKRNGTYQKLLKKYFTVDL... 263
18 0.000e+00UniRef50_A0A1C0A5S0 Glutamine ABC transporter substrate-binding protein n=14 Tax=Halobacteroidaceae TaxID=53434 RepID=A0A1C0A5S0_9FIRM  ali  31  41......................EEEGKIVVGMDAAYKPFEFQDENGEIVGFDVDVLKAIADKLGIDLDLQNTSFDGIIPGLQANKYDLIMSAMTITEDRKKAVNFSDPYFDASQVIAVMEDSNDIKSVDDLQGKVIAVQLGTTGDLEVSEMEGIK--EIKRFDTIPEAFIALQNGQVAAVVNDLPVTKAYIKEHPEVK--------IVGEALTVEQYGIAFRKADTELMEKVNEALAKLKQEGTYDKIYAKWF....... 261
19 0.000e+00UniRef50_S6IF59 Lysine-arginine-ornithine-binding periplasmic protein n=3 Tax=Pseudomonas TaxID=286 RepID=S6IF59_9PSED  ali  46  1MKKYLLGLTLLACPFVTWAASTD----LRFGVDPTYPPFESKNPDGSLTGFDIELGESICAELKRRCVWVETSFDGLVASLKGRKFDGILSAFSITEDRKKEVAFSDTLYDTPAHLVAAQGSPLRPAAETLKGKRIGVQQGSVFEVYARKIWGSKNVEVVPYQSSDLAYQDLINGRLDAVFDDAIAVSEGMLKKPMGKGFAYAGDVVKSVEVFGPGTGVGLRKNDTALKQDIDQALQTIRQNGTYQRLADKYFDVDI... 253
20 0.000e+00UniRef50_A0A0K2SNS0 Uncharacterized protein n=1 Tax=Limnochorda pilosa TaxID=1555112 RepID=A0A0K2SNS0_9FIRM  ali  32  28........................QQTLRVGSDVAYPPFEYVDESGEYAGFDMDLIRALGEKMGVKIEIVNTAFDGIIPALVMGEFDAIISAMTITAERAETVSFSDPYFTTGQVIATRPDETEIAGPDDLKGKVVAVQLGTTGQFEAEKIQGLKRLD--TYQFVDQAFSALANRSADAAVVDELVSIEYMKQHPDA-------IRVVGEPFTTEDYGIAVRKSDTELLEKINRALAQLRADGTYDELYQKWFGVN.... 251
21 0.000e+00UniRef50_UPI000A050EE7 hypothetical protein n=1 Tax=Leeia oryzae TaxID=356662 RepID=UPI000A050EE7  ali  36  12..KKLLTLSLLAMAVVSGSANAKDWKNIRVGIEAAYPPFNELTADKKIVGFDKDLSDAICSYLKANCTYVIQDWDGMIPGLLAQRFDTIISSMSSTEERKQKVSFTRPYYNTPAFFLVRKDSNNVDSPAAMKGKRIGVQSATIFQNYADAFYKPAGATVTPYQTLDQVYMDLTSGRLDAVLFGSIE-HDTFLKSKDGAGYKMAGKPLLDPKWFGEGAAIAVRKDDEDLRKQLDAAVEALHKNGTYDKIRKKYFSYDI... 266
22 0.000e+00UniRef50_E8LXS1 ABC-type transport system periplasmic substrate-binding protein n=1 Tax=Vibrio brasiliensis LMG 20546 TaxID=945543 RepID=E8LXS1_9VIBR  ali  39  1MKLAKLVALSCTALSLAMAQAQAAPLKVGIGTE-SYPPFAVPDANGQYSGWEIDIANEICKQAKLECEIVATAWDGIIPSLVAGKVDIIAASLSITDERSKVIDFSNKYYQSGASLAVAAGSDITPTAESLAGKKIGVQSGSIHQSYVLKHFKD--AEIKEYQTQDEANQDLFSGRIDATLADATVLGEFLTTREGELCCSSAGLVKNDEAILGKGIGFGLRKGNDELKAKLDQAIVDIRQNGTYDKITNNYFNFNIYG. 256
23 0.000e+00UniRef50_A0A1H8TLU4 Amino acid ABC transporter substrate-binding protein, PAAT family n=1 Tax=Salinihabitans flavidus TaxID=569882 RepID=A0A1H8TLU4_9  ali  37  16...................GQAAQADPIRIATEGAYPPFNYVDESGELKGFDVDIAKALCEEMDAECEIISQAWDGMIPGLRAGKYDAIVASMSITEKRKNAVNFTRPYYQAGAILVGPEGSDIALDPEKLNGKTIGVQRATTYANLMREKYPE--AEIKLYDTVENHNLDLKSERLDGVVAQRVFMHNWLEE-EGNDGFEFKGDPVLDEDYIGEGAGIAVDKSNPELLERLDTALAAILENGTYDELNSKYFPFSI... 250
24 0.000e+00UniRef50_A0A1F4K257 Uncharacterized protein n=3 Tax=Burkholderiales TaxID=80840 RepID=A0A1F4K257_9BURK  ali  43  1MK--LRHLFAIMGLGCAVCAQAAEPKELRIGTDATYEPFEYKAPDGKLVGFEIDLANALCAEMKRRCVFVESPWDAIVPSLMAKKFDMIMSGMTVTDERRKKVSFSDKITDIPYRVIVKRGSGMDGSPGSMKGKKVGVLKGSTEADFAEKYYAKAGATVQRYESTQDSYLDIASGRLDAIVGNLVEMKMGFLAKPEGKPFEFAAYEMKDQAILGYGTGVALRKQDSQLKAELNAAIKAVHANGTYQKIAGRYFDFDVYG. 257
25 0.000e+00UniRef50_R4WGF7 Cationic amino acid ABC transporter periplasmic binding protein n=567 Tax=Bacteria TaxID=2 RepID=R4WGF7_9BURK  ali  50  87....VLGATLALGSVALNAQAADNMKELRFGVEASYAPFESKTPEGTLTGFDIDIGNAVCAKLKMKCVWVENSFDGLIPALQARKFDGINSDMTITDKRRAVIDFTDPIYTIPNQLIAKKGSAIQPTVDGLKGKRVGVLQGSIQETYAKAKWAPAGVDVQSYQAQDQIYADLASGRLDAAFQDAEAASKGFLKQPQGAGFAFAGPAVSDDKLLGAGVGFGVRKNDRALKESLNRALKELKDDGTIERFAAKYFDVKV... 339
26 0.000e+00UniRef50_A0A0W7Z1I5 ABC transporter substrate-binding protein n=11 Tax=Betaproteobacteria TaxID=28216 RepID=A0A0W7Z1I5_9BURK  ali  46  23...........................LKVAIDPTYEPFTYKTADGTPTGFDVDIANAVCNEIKRKCVFVEQVWDSMIPGLQARKYDVIVSSLSITDERKRVIDFSDRYYKTPSAIVVKKG-TEYTGPASLKGKRIGVLKGSTQEKWAMGELKPAGVTIVPYEAQDQVYLDINAGRLDGTVADKVEVHGGFLRKPEGKDYGYVGPDQYDEKYYGEGIGIGMRKGQKELKEQINQAIKTIRSNGTYDTIAKKYFDFDPYG. 253
27 0.000e+00UniRef50_A0A0F5AUC0 Nickel transporter n=113 Tax=Proteobacteria TaxID=1224 RepID=A0A0F5AUC0_9GAMM  ali  38  1MKKWLVA-AAVMAAVGSTSVAAKDWKVVRFGIEGAYPPFSWTTNEGELKGFDVDMANALCEEMQAKCKIVAQDWDGIIPSLLARKYDAIIAAMSITEERKRKVDFTNKYALIPNKFVAEKGTDLTFTKEGLEGVKIGVQRATTHDKYLTDNYGDS-VDIVRYGTFDEAYLDLKAGRIESILGDASALQQGLLDKEGGDEFAFIGPSLTDPEWFGEGFGIATRKQDKELTKKLNQAIDSLREKGVYDEIAAKYFDYDVYG. 257
28 0.000e+00UniRef50_A0A1A8TGV5 Putative ABC transporter arginine-binding protein 2 n=5 Tax=Proteobacteria TaxID=1224 RepID=A0A1A8TGV5_9GAMM  ali  33  4..KKIVLGSVLVTGALLSSVMVQAQETIRFATEGAFAPFNYMDNTGKPVGFDVDIAHALCKDLKAKCEIVTQDWDGLIPGLKVHKYDAIIASMSITPEREKVVAFTNKYYSGGVRFMGLVGKNF--NLKDLSGKTIGAQRATVAAQYLEDHYGKT-ANIKLYDNQDNVYLDLESGRLDIVLSDELPTYNWLKTSGKGGKFEFKGKAF----LKTDRIGIAVRKGDTKLKDQLNKAIKDIRENGTYQKINAKYFPFSIY.. 252
29 0.000e+00UniRef50_A0A1H1ES17 Amino acid ABC transporter substrate-binding protein, PAAT family n=2 Tax=Pseudovibrio TaxID=258255 RepID=A0A1H1ES17_9RHOB  ali  33  1MSFTRLALAAILSISAVSASQAGDATKLRVATEGAYPPFNYTGADGVLVGFDVEIGNALCAQMKVECEWGTQEWDGMIPGLVAGKYDAIIASMSITEERLERISFSRSYYNTPSTIVVPKGSEITVTVAALSGRLIGAQGGTTHSVVAEEIYTDS--NISLYPTSEEYKLDLENGRLDAVIDDLGALEGWI-NSEAGSCCKIIGTLPIQTELHGQGIGVGVRKGQEELADRFSQAILAIRENGTYTKINDKYFSQDAFG. 257
30 0.000e+00UniRef50_A0A259UQW6 Glutamine-binding periplasmic protein n=48 Tax=Firmicutes TaxID=1239 RepID=A0A259UQW6_9FIRM  ali  26  1MSKKLIALSMVTMVFGLAGCGGADQKVLKVGSETTFAPFEFQDEKTKYIGFDMDLIKAVGKQMGVEVQVQSMGFDGLIPALEAGNIDAAISGMTITDERAKKVNFSKPYYKSGLSMVVKADNNTLKSFKDLEGKRIAVQIGTTGASEAKKI---KDVKVREFNNAPEAFIELNSGGVDAVVNDLPVNEYYIAQAGGKDA------KIVGEPLNSEEYGIAVAKKNTELAEKINKAIDELKKNGEYEKIYVKWFGK..... 256
31 0.000e+00UniRef50_A0A1M5GH52 Polar amino acid transport system substrate-binding protein n=6 Tax=Rhizobiales TaxID=356 RepID=A0A1M5GH52_9RHIZ  ali  36  7.....IALTAATLVAVTLSAEAKDWSTIRIGTEGAFPPFNFIDSDKQLQGFDIDVAKAVCANLKATCTFVAQDWDGIIPALQAGKFDAIFASMSITDERKQVVDFSRAYYSTPSAFIAVKGSGIDVSPEGLKGKTLGAQSSTIQSGYLEKAYP--GFEVKLYPTQDEVNLDLASGRIDALLVDKIVGMDWLKTKDGGCC------EIVADVPLGGGVGAAVRKEDTDLRDAISKAVEAIKADGTYDKINAKYFPFSI... 251
32 0.000e+00UniRef50_A0A1G4QQK8 Amino acid ABC transporter substrate-binding protein, PAAT family (TC 3.A.1.3.-) n=1098 Tax=root TaxID=1 RepID=A0A1G4QQK8_9RHIZ :  ali  42  23.......................EMKKVRIGTEGAYPPFNSVDSAGKLVGFDIEIGEALCAKMKVECTFVAQDWDGIIPALLANKYDLILASMSITDERKEKVSFTIPYYLTPGSFIAPKDTAIDIAPAALKGKTIGAQSSTTGATYLEDKYKDS--EIKLYPTQDEANADLAAGRLDAVLADKFVLYEWLEKSTDGKCCKFVGPDLKD--VNPQGTGIAVRKEDNELREALNKAIQEINADGTFAKINAKYFPFPI... 253
33 0.000e+00UniRef50_A0A1H4F8R5 Amino acid ABC transporter substrate-binding protein, PAAT family n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A1H4F8R5_9BURK  ali  44  1MKLKLSLCLAVAFAGLAGTAHAAD--TLRFGVEAAYPPFESKSPSGELQGFDIDVGNAVCKKMNVKCVWVENSFDGLIPALQARKFDVINSAMNITSKRKQSIDFTPPVYVVPIVMVAKRDSKLLPDVKSLQGKRVGVLQGSSQEDFLKQHWATAGVSIVSYQDQDQVYADLVAGRLDAAVQEAQTVQDGFLDKPEARDFAILGAPLSDPATLGEGTGLGLRKGDQALKSKVVAALDSLKKDGTLSALSQKYFKRDI... 255
34 0.000e+00UniRef50_I0GIQ2 Putative glutamine ABC transporter substrate binding protein n=2 Tax=Caldisericum exile TaxID=693075 RepID=I0GIQ2_CALEA  ali  34  99...........VTLTFNSLARVKRAGVIVFGSDTTYAPFEWIDPQGNAIGFDVDLANLLASKIGVKVQIVTADFSGIIPALQTGKFDAIISAMTITDERKKEVDFSDPYYNSGQVIAVQSSNNSITKPEDLVGKTVGVQTGTTGEEAAKKI---KGAIVKSYPDIQLALSDLEIGRIDAVINDLPVSLYYAKTHPKVK--------LVGSLFTTEQYGIAFRKDEPELRDAINNALKEIKSNGEYVILYKKWFGTD.... 333
35 0.000e+00UniRef50_A0A212RWT4 Amino acid ABC transporter substrate-binding protein, PAAT family n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A212RWT4_9PROT  ali  40  1MKLVVATCAAVLALALNTVSQAKEWKTVRVGLEGDYPPFSSVGPDGKIVGWEVDYMNLLCEHMKVKCTPVQQDFDGMIPALQAPKFDAIMASMSITDVRKKQIAFSVSYYNTPTRFVAKKGANIEISPAGLKGKKIGVQRSTIQDNYLTDNYA-SVAEIVRYGSQDDMFLDLVAGRLDLGLGDSLQISDGFIKTDRGKDFEMIGPNLTDSKWFGDGVGVGLRKQDDDLKKMFDTAIAETLKDGSYQALEKKYFDIDIYGG 261
36 0.000e+00UniRef50_A0A1N6MBL9 Histidine-binding periplasmic protein n=87 Tax=Proteobacteria TaxID=1224 RepID=A0A1N6MBL9_9VIBR  ali  57  1MKRITNLSLLLLTLAAPF-VQAADQPLVRLGVEPGYAPFEMKKPDGTLTGFDIDLGKEICKRMEARCVWVESDFDGLIPSLKAKKIDAILSSMSITPQRQQEIDFTDKLYGTPARLITPKGVDLQPTAASLGGKRVGVFQGTTAETYAKEQWAPKGVDVVTYQNQDLVYADLVNGRLDAAFQDAVAASDGFLNRPVGKGFAFSGPEVNDEKYFGVGAGIGVRKTDQALKNQINAALSDMLKDGTYDAIAKQYFDFDIYG. 258
37 0.000e+00UniRef50_A0A2J7YHW4 Histidine-binding periplasmic protein n=38 Tax=Proteobacteria TaxID=1224 RepID=A0A2J7YHW4_PSEPU  ali  42  7.....LACLAVAFSVLFGAGVQAEQQHLRIATEGTYPPFSYL-QNGQLAGFDVDIANALCERIQARCEIVSQGWDGMIPGLMSGKYDAIVASMAITEERKQKIDFTDKYYATPARFVAEKNSGIDTSVEGLAGKVIGVQGSTTQGTYLEDRYKDS--EVKIYKTVDDAAMDLASGRLDAVFSDSAILYPWL-QTSIGSCCDFAGQEVRDEKYFGAGKGIGVRKEDQALRDQLDTAVKALVADGTYQKINQKYFPFAIY.. 256
38 0.000e+00UniRef50_A0A2J7RTM7 ABC transporter substrate-binding protein n=11 Tax=Proteobacteria TaxID=1224 RepID=A0A2J7RTM7_9ENTR  ali  47  5...MTVVTGAIALTMMLNTAHAAEQKTVKLGLSPAYAPFESKTPDGKLVGFDIDIGNEVCKRIQANCVWVEMSFDGLIPALVSKKIDIINSSMNITEKRQKSISFTNPIYIMPIQLVARKNSGLLPTVESLKGKSVGVQQGTTQEDYAKAHWANAGVNVVTYQDQDQVFMDLSADRLDGAVQESQTAQQAFLSKDEGKEFSFAGDSLKDPVTLGQGTGIGLRQKDTELQQQVNNALNEMKKDGTLLKLSTQYFNRNI... 258
39 0.000e+00UniRef50_A0A2X3Z9P3 SIS domain protein n=2 Tax=Pseudomonas taetrolens TaxID=47884 RepID=A0A2X3Z9P3_PSETA  ali  36  297MKNVIRFASACAMVVAVASNAHAD--TLTIATEGAYPPFNTINSDGTVSGFDVDITKALCERMNAQCTIVAQDWDGIIPGLMAKKYDAIVASMIVTDERKKKIAFTNHYYRTPLSIAVPKDSDITDAQTNFKGRTIGAQGAATQGIYAEDHYEKAGAKLNLYPTLDEANSELKSGRVDAVIADKFPLLEWINKSSDD-CCKIIG----DVDGTMADASIAVRQEDNALRERFNKALDEIVADGTYKKISSQYFDFDIY.. 547
40 0.000e+00UniRef50_A0A2K1FKD7 ABC transporter substrate-binding protein n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A2K1FKD7_9PSED  ali  40  1MKKLHGVLAVVLGLAALTA-QARDWKDIRLATEGAYSPFNEIGPDGKPRGFDVDIGNAICVQMKARCTWIVQDWDGMIPALLANKFDAIAASMTITPERQQKIAFTEKYYSSWVQLIARTGAPYDAAPATLKGVRIGVQRETTHEKFAREVLAASGAEIVSYPSLEEAYMDLKNSRLDATLQDTIPGLEGFIRKPDGKGFALVGEQLNDPRYFGAGQGIGLRKEDDDLRQAMNRALKEVIDNGQYETLRKKYFDVPI... 257
41 0.000e+00UniRef50_A0A0B6RQB9 Lysine-arginine-ornithine-binding periplasmic protein ArgT n=1697 Tax=root TaxID=1 RepID=A0A0B6RQB9_BURGL  ali  49  20..............STLSGAHAADLKQIRFGVEASYAPFEYKTPDGKLAGFDVDVGNAVCAKLKVPCVWVENDFDGLIPALQARKFDAINSDMTITPQRAHAIAFTDPIYSIPNQLIAKKGSGLLPTPASLKGKRVGVLQGTIQESYAKARWAPAGVEVVPYQTQDLAYADLQSGRLDATFQDSEAAAKGFLSKPQAAGFAFAGPQVVDAEILGSGVGYGLRKNDTALRAALNQALKELKADGTIDTLAKKYFSVPV... 262
42 0.000e+00UniRef50_A0A1E5E2I6 Nickel transporter n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1E5E2I6_9VIBR  ali  40  1MKKWFLA-ATIAAATLSGAAQAKDWDTVRFATEGAYPPFNYTNSSGELVGFDVDLANALCKEMETKCKIVAQDWDGIIPALLARKYDAIIAGMSITEERKKKVAFTHKYALIPNKFIAKKGANLDFTKEGLKGVKIGVQRSTTHDQYIEDNYKD-IVDVSRYGTFDEAYLDLESGRIDAVFGDASALQSGMLDKKDG--YEFTGPSLTDKQWFGDGFGIAVRKQDQDLATKLDKAIDSLRAKGIYQQIAAKYFTYDVYG. 255
43 0.000e+00UniRef50_A0A0Q4N4X6 ABC transporter substrate-binding protein n=42 Tax=Proteobacteria TaxID=1224 RepID=A0A0Q4N4X6_9GAMM  ali  43  7.KTRLRQAAALSLLAVCSFGAQAKIDQIRFAVDPTYPPFESKTADGKLVGFDIDLGNALCAQLQAKCVWVESQFDGIIPALKARKFDAILSDMGITEERLKQIDFSVPLYDTHAQLIARKGSGVLPTAESLKGKNVGVQQGTVQERYALAKWQPHGVNVVPYGDQAQVESDLVAGRLDVVFTDAAQAAIGFLKQPQGQDFALAG-PIVEDPIIGPGTAIGLRKGDTELKNAIDGAFAEIKKNGTFDTIQKKYFATDIS.. 262
44 0.000e+00UniRef50_A0A0U1Q2H8 ABC transporter substrate-binding protein n=6 Tax=Burkholderiales TaxID=80840 RepID=A0A0U1Q2H8_9BURK  ali  45  4..KWLALAVGSAMAFASVSASAQD---LRVAVDPTYEPFVYKNEQGELVGFNIDFSHAICEELKRNCVFVEQVWDAMIPGLQSRRYDVIISDMSITEERKKVIDFTDRYYKTPGTIVVRK-SLDYQGHDSLKGLRLGVLKGSTHERYAEGELAPKGAQIISYEAQDQVYLDINAGRLDGTVADKVEVTGGFLSKPEGQDFKTVGPDLLEEKYFGAGMGIALRKGQDELREQLNAAIASLRSSGKYQQIASKYFDFDVYG. 256
45 0.000e+00UniRef50_A0A1M7TUW1 Polar amino acid transport system substrate-binding protein/arginine/ornithine transport system substrate-binding protein n=1 Tax  ali  41  1MKNTIAAALAAFGLLTGAAGAAD----LRICVEGAYPPFSETTPSGELKGFDIDIAKALCDEMGKTCELVKTEWDGIIPALLERKCDAIIASMSITPERQKVIDFSDKYYNTPARFVARKGANIEFTPEGLKGKVVGVQRGTIHQDFMEGEFP--GVELKLYGTQDEAYLDLAAGRVDALMADSVAIDDGFLKTEAGKDFEFVGPAYSVPKYHGEGAGIGVRKGDP-MKDEWSKAIKRLRESGKYDEIMHKYFDYDIYGG 253
46 0.000e+00UniRef50_P30860 ABC transporter arginine-binding protein 1 n=3393 Tax=root TaxID=1 RepID=ARTJ_ECOLI  ali  39  1MKKLVLAALLASFTFGASAA-----EKINFGVSATYPPFESIGANNEIVGFDIDLAKALCKQMQAECTFTNHAFDSLIPSLKFRKYDAVISGMDITPERSKQVSFTTPYYENSAVVIAKKD--TYKTFADLKGKRIGMENGTTHQKYIQDQHPE--VKTVSYDSYQNAFIDLKNGRIDGVFGDTAVVNEWLKTNPQ---LGVATEKVTDPQYFGTGLGIAVRPDNKALLEKLNNALAAIKADGTYQKISDQWFP...... 242
47 0.000e+00UniRef50_A0A1S1WVP5 ABC transporter substrate-binding protein n=27 Tax=Proteobacteria TaxID=1224 RepID=A0A1S1WVP5_9NEIS  ali  41  1MKKALIASASFALVASLSA----QAETLRFGIDLNYPPFSKQGADGKPQGFDIDMANALCKEMKVTCQIVPQDWDGLIPALNANKFDAIISSMQITPERQKAVDFTHKYYNIASRLVAKEGTKV--DAASFKGKKIGVLRASTQEKFAKDFWGKNGASVVSYAKSPESFLDLKSGRVDAVFVDGAVGEGEFLKTPQGKGYAFVGPNYSEVKYFGLGAGIAVKKGNKALADRLNKAIDQVRKDGGYKKVQDKYFSFDVYGG 254
48 0.000e+00UniRef50_A0A127L0A0 ABC superfamily, histidine transport protein n=21 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A127L0A0_9ENTR  ali  90  1MKKLVLSLSLVLAVSSVSTVFAAIPQKLRIGTDPTYAPFESKNAQGELVGFDIDLAKELCKRIKTQCTFIENPLDALIPSLKAKKIDVIMSSLSITEKRQQEIAFTDKLYAADSRLVVAKDSDVQPELDKLKGKRVGVLQGTTQETYGNVNWAPKGVEIVSYQGQDNIYSDLTAGRIDAAFQDEVAASEGFLKTPQGKAYKFGGPSIKDEKLFGVGTGMGLRKEDNELREALNKAFAEMRADGTYEKLAKKYFDFDVYGG 260
49 0.000e+00UniRef50_J0UPJ4 Cationic amino acid ABC transporter periplasmic-binding protein n=12 Tax=Alcaligenaceae TaxID=506 RepID=J0UPJ4_ALCFA  ali  40  1MNKILARLLMVAFCTALAPVAHADPSEIRFATEAGYPPFEYLDPSGQLQGFDIDIGNEICKRLQAKCVWIDQSFDSLIPGLQARKFDLANSTMTATEARAKVIDFSEPMYIVPVRLAARKGSGLEPTAESLKGKRVGVQQGTTMETYARQNWANNGVTIVAYPSYTDAFNDLAGGRVDATFQEAQNAIEGFLNKPAGADFELTGSTVDDSPILNEPIAMGIRKGNKKLKKTVDEVLREMKADGTMQAFADKYFQKD.... 257
50 0.000e+00UniRef50_UPI000B5A9526 amino acid ABC transporter n=1 Tax=Granulosicoccus antarcticus TaxID=437505 RepID=UPI000B5A9526  ali  36  1MKIRHLSAIALTCAVASSTVSAED---LRLGTEGAYPPFNFIDASGEIKGFDVDIGLALCEKIEANCSVVAQDWDGIIPGLLANKYDFIIASMFITDERKKQVDFSDPYYLAAMTHVVAKDSDITESNEALADMVIGAQSGTTQADYAEATYPD--ADVRLYPTQDEVNLDMASGRIDMVVGDMLPMLDWVNKADDGACCELIGEPITDPAFVGDGVGIALRQDDDELRERLNGALLEIRADGTYQAINKKYFDIDVY.. 254
51 0.000e+00UniRef50_X7F7E2 ABC transporter substrate-binding protein n=9 Tax=Proteobacteria TaxID=1224 RepID=X7F7E2_9RHOB  ali  37  1MTKFSATAGVVAVLTMAGAAGAQDPDTLVIGTEGAYPPFNFTESDGSVTGFEVDLANAMCAQMEITCEWVTQDWDGIIPGLQAQKYDAIIASLYITDERREVIAFSDKYYQVPSRFVVPEGSALEISAEGLSGAVVGTQRATSFERYMNANMPD--VDLRLYGTMDEAYLDLTSGRLDAVIGDVVAIQDGFLGTPDGTGFELRGPEFTDPEFFGYGAGVGVRQDDQHIADAFSDAIEALRENGTYQDISEKWFGLDVYGG 261
52 0.000e+00UniRef50_P02910 Histidine-binding periplasmic protein n=761 Tax=root TaxID=1 RepID=HISJ_SALTY  ali  98  1MKKLALSLSLVLAFSSATAAFAAIPQKIRIGTDPTYAPFESKNAQGELVGFDIDLAKELCKRINTQCTFVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADSRLVVAKNSDIQPTVASLKGKRVGVLQGTTQETFGNEHWAPKGIEIVSYQGQDNIYSDLTAGRIDAAFQDEVAASEGFLKQPVGKDYKFGGPAVKDEKLFGVGTGMGLRKEDNELREALNKAFAEMRADGTYEKLAKKYFDFDVYGG 260
53 0.000e+00UniRef50_B5Y810 Glutamine-binding protein n=2 Tax=Coprothermobacter TaxID=68335 RepID=B5Y810_COPPD  ali  28  1MKRTF-VLLLVVGAILLGCSSQQSANTLVVGTAADFPPLEFIDENGNFAGFDIELMNAIAEKIGYEVKWENADFAGLVASLQTGKYDAVISAMTITASRQEEVDFSRPYFRSDQAVVVQESNVGILSREDLADKTIGVQLGTTGELLARELVSDKGG-VYTYESPDQAFLDLNTGRLDAVVNDLPVSSYFLLRNPNL------PLKVAFTIETEEYYGIAVKKGNTELVEKINNALIQLKEEGKYAELYQKWF....... 245
54 0.000e+00UniRef50_R9VJM9 Zinc transporter n=86 Tax=Gammaproteobacteria TaxID=1236 RepID=R9VJM9_9ENTR  ali  88  13............AFSSVSNVFAAIPQKLRIGTDPTYTPFESKNAQGELVGFDIDLAKELCKRINTQCVFIENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIDFTDKLYAADSRLVVAKDSDVQPELDKLKGKRIGVLQGTTQETYGNVHWAPKGVEIVSYQGQDNIYSDLTAGRIDAAFQDEVAASEGFLKTPQGKAYKFGGPSIKDEKLFGVGTGMGVRKGDTELRDALNKAFAEMRADGTYEKLAKKYFDFDVYGG 260
55 0.000e+00UniRef50_E0SL83 Periplasmic-binding component of an ABC superfamily histidine/lysine/arginine/ornithine transporter n=583 Tax=cellular organisms TaxI  ali  73  1MKKMLKLLPLAL-VFAAGSALAEVPKNIKIGTDPTYAPFESKDASGQLVGFDIDLAKELCKRIEANCTFVESDFDALIPSLKAKKIDAIISSLSITEKRQQEIAFTDKLYAANARLIAKKGSPILPTLEALKGKRVGVLQASTQESYANQYWQPKGVDVVAYQNQDLIYADLTAGRIDAAFQDEVAGSEGFLKQAAGKEYAFAGPAVKDDKLFGVGTGMGLRKNETELKAALDKAFATMRKDGTYDKLAKKYFDFDVYG. 258
56 0.000e+00UniRef50_A0A231UWM6 Amino acid ABC transporter n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A231UWM6_9RHIZ  ali  36  1MLLRRTFLALSVVALTVPAALAQDKMSLKIGSEGAYPPFNQLNSNNELEGFDIDIARALCEEMNAECEFVTQDWDGIIPALQAGKFDAIVASMSITPERQEQVSFSEPYYTNSLRLVAASDGDIDATAETLADKTIGVQQGTVAETFMTEEMGD--VTMKPYPTQEEAYLDLKNGRLDGVVADFGVQDEFIKQNEG---YEVVGEPLLQD----DQIAIAVRKDEQDLADKFSAAIKAIRDNGTYQKINEKYFGFDIYGG 252
57 0.000e+00UniRef50_I3U9Y2 Lysine-arginine-ornithine-binding periplasmic protein n=18 Tax=Alcaligenaceae TaxID=506 RepID=I3U9Y2_ADVKW  ali  43  47..KHVFGIGLCAIALAVSASAVAADKTIRFGTDATYAPFESTSPSGEIVGFDIDLAKAMCEKMQAKCTFQNQGWDGIIPALRAKKFDVISSSMSITPEREKAVLFTQKIWSTPNMFVAKKGATYQSTAEGLKGLDLGVQQGTIQDKYATKYFKDT--NIKRYKTLEDAYNDLTTGRVNVVFADGGVTTEFV-NSPGGKDFQLVGDPIADPEIFGKGTGFAVRKNDTELRDALNKAFDEIRKDGTYQKIADKYFKYDIYGG 304
58 0.000e+00UniRef50_A0A0T9NY90 Amino acid-binding periplasmic protein n=108 Tax=Bacteria TaxID=2 RepID=A0A0T9NY90_YERKR  ali  44  2MKKTLAALLTGLILSAPVAAQTIE--TISFGVDGGYPPFDVLAPSGEITGFDIDIANALCDNLHAKCVFVKQPFESMIAALNARKFDAIIASLSITDERKKEVDFTDRYYRSAAQLVARKGSPLSPDVASLKGKTVGVQTGSIHETYAKKHWGGQGVKIVSYANQDNVYLDLLSGRINASLQDNIQAASSFIDTPRGQKFAFAGPVIQDETISSD-VGIAVGKDNPALRDALNGAIKAIRADGTYDAIQKKYFSFDIYG. 257
59 0.000e+00UniRef50_E2CLN9 Histidine ABC transporter, periplasmic histidine-binding protein HisJ n=684 Tax=root TaxID=1 RepID=E2CLN9_9RHOB  ali  39  21....................QADDWSKVRIGTEGAYPPFNSLTSDGQLVGFDIDIANALCEEMKVECEFVTQDWDGMIPALQAGKFDAVIASMSITEERKQKVDFTNKYYNTPPAIGVPKDSKLAVTKEDLSGILLGAQSSTTHSNYAEAHFPD--AELKLYPTADEYKLDLENGRIDAVIEDVVVLSDWLA-TENGACCKVLSTLKSDPVINGEGAGIAIRKGEDELKEMFNKAIVAIRENGKYEEINAKYFDFDVYG. 257
60 0.000e+00UniRef50_H0Q3E1 Extracellular solute-binding protein family 3, lysine/arginine/ornithine transport system substrate-binding protein n=45 Tax=Bacteria  ali  40  1MKKYALLCAVVAMTAG--SAVAKDWDEIRMASEGAYPPFNVTAADGSMRGFDIDIGNALCEEMKAKCSWVKQDWDGMIPALVSRKFDAIIASMSITDERKAKVDFTNKYYASPLALIAKKGSPLRPDLASLKGKKIGVQRGTVADNFATKFWEGKGPEIIRYAKQDEAYLDLNSGRMDAAFADFLEAYGGFLTKPEGAGYDVAGERVEEKGVVGEGIGIAVRKKDKDLTEKLNKALVAIRASGKYEEIRKKYFPMDIYG. 262
61 0.000e+00UniRef50_Q7NZR9 Subunit of the lysine/arginine/ornithine transporter (ABC superfamily) n=1410 Tax=Bacteria TaxID=2 RepID=Q7NZR9_CHRVO  ali  52  1MKKALAALAVGLMAASLGA-YAKDWKEIRFGVDASYAPFEYKAPNGQVVGFDIDLGNEICKRMKAKCVWVENDFDGMIPALKAKKFDGVLSSMSMTEARMKEIAFSAKLFNTPTRMVAKAGSGLMPTPASLKGKRVGVEQGTIQEAYAKKHWAPAGVEVVPYQNQTLVLADLTAGRLDASLQDAVQADIGFLKKPEGKGFAFAGKDLVDPQTLGEGAGIGLRKEDKDLKAGIDKAIADMLKDGTYKKIEKKYFTFDVYGG 259
62 0.000e+00UniRef50_A0A0K2DER5 Amino acid ABC transporter n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A0K2DER5_9RHIZ  ali  38  2...RLTIAVAATLLALTGAASAKEWKEIRIATEGAYPPFNFVGSNGELQGFDVDIAKALCDKVGAKCTVVAQDWDGLIPALIANKYDAIAASMSITEERKQQVDFTERYASAPVSFVAPKDTKLTVAPADLKGKIVGAQSSTTHATMLEDVYGPEGVTVKLYPTLDEANADLKSGRVDTVFADKIVLLDWLKK-DGADCCKVLGDVDDKQQYFGEGIGLAVRKGDQDLKELLNKAIADIRADGTYDTIAKKYFDFEIY.. 258
63 0.000e+00UniRef50_A0A0F3K646 Uncharacterized protein n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A0F3K646_9NEIS  ali  45  1MKMKLQSWCAVLLSAVALQAGATDLNNLRIGMDATYPPFESLNPAGQIVGFEADLAAALCKEMKARCSLINQDWDGIIPGLMAKKYDVIMSSMTITAERAKTVSFTERYFRTPQRLIAAKGSPLRFTVEGMKGKRVGVQRGTTADMYLSKFWGPRGMDVVRYEDQDKAYADLVNGRLDASFQDELQVEAGFLKSEPGKGFAFVGPSINGDEVLGSGAGMAVRKEDKALLDKLNKAISAVRANGTFKKLSVQYFGRDIY.. 263
64 0.000e+00UniRef50_G8PXQ5 Arginine/ornithine ABC transporter, periplasmic arginine/ornithine binding protein n=2090 Tax=cellular organisms TaxID=131567 RepID=G  ali  43  1MKKLAMFGALALSVLSLSAV-AEDAKPIRLGIEAGYPPFSMKTPDGKLTGFDVDIGDALCEQMKVKCTWVEQEFDGLIPALKVKKIDAILSSMTITDDRKKNVDFTIKYYHTPARFVMKEGSEVKDPLTELKGKKVGVLRASTHDRFATEVLVPAGINLVRYGSQQEANLDMVAGRLDAMLADSVNLDDGFLKTDAGKGFAFVGPTYEDAKYFGGGAGIAVRKGDKALADKFNAAISEIRANGTYKKVQDKYFAFDVYG. 258
65 0.000e+00UniRef50_I3X9Y0 Histidine-binding periplasmic protein HisJ n=530 Tax=cellular organisms TaxID=131567 RepID=I3X9Y0_RHIFR  ali  41  15............VFVLMAGAALAEGEKVVIGTEGAYPPFNNLEADGSLSGFDIDIAKALCEEMKAECTFVTQDWEGIIPALIAKKFDAIIASMSITEERKQQVDFTKKYYNTPPAIVVPKDSPITATEAALEGKALGAQGSTTHSNYAEAHM--KGAELKLYPTADEYKLDLINGRIDAAIDDVVVISEWLK-SEDGACCKLLGTLPIDPVINGEGAGIAVRKGDDALREKFNKAIDAIRANGKYKEINEKYFPFDVYGS 260
66 0.000e+00UniRef50_V5VBM4 ABC transporter substrate-binding protein n=321 Tax=Bacteria TaxID=2 RepID=V5VBM4_ACIBA  ali  49  5MKKIFVSTTLVLAAVA-TNVQAKDWKVIRFGTESSYAPFEYKTPDGKLTGFDVDLGNAICAKLKAKCVWVENSFDGMIPALKAKKFDGILSSMTVTDERAKQILFSSKIYNTPTRMVAKKGSPLLPTPTSLKGKRVGVQQGTIQETYAKTYWAPKGVSVVPYPTQDLIYQDMMSGRLDATLQDAIMVDGAFLKQPKGKNFSFAGGNVVDVKTLGVGAAIGLRKEDADLKANIDKALAAIIADGTYKKLEKKYFSFSIY.. 261
67 0.000e+00UniRef50_A0A255XXL9 Uncharacterized protein n=3 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A255XXL9_9PROT  ali  35  4..KKIVLALATLGVALTSGAYAQSSKTLHLGTEGAYAPFNFIDKDGKVKGFDIEIGDALCAEMKRKCEWVTQEWDGIIPALKAKKFDAIIASMSINEKRKKEVDFTDRYYFTPGMMIARKGASLKQ--DALSGKTVGVQVETIHAQFMEERYKDKGITLKQYKTQDEANLDLANGRLDVVMADSAVLEDWVKGNGGYAKFERVGEFIRDPIL-GNGAGIAIRKGDKELTTAFNKALAAIKANGTYAKINAKYFDFDI... 255
68 0.000e+00UniRef50_F2KSD6 ABC-type transporter, periplasmic subunit family 3 n=7 Tax=root TaxID=1 RepID=F2KSD6_ARCVS  ali  34  48.......................KPGVLTVGMDATYPPFEYINETDEFEGFDVDLMKEIGKRLGLEVEFVNVAWEGIIPGLVAHKYDCICSAMTITEERKKQIDFSDPYFEAWQVIVVRADCTDITKPEDLAGKVVGVQIGTTGQFVAEDLVKSGNFEIKTYDTTPDALLDLKNGNIDAVIIDNGVAEKAIKNNPDV-------YKTVGGKLSYEEYGIAVAKDNPELLKAINQALKEVKEDGTYDKIYQKWFGE..... 274
69 0.000e+00UniRef50_H2IT38 Lysine-arginine-ornithine-binding periplasmic protein n=11 Tax=Enterobacterales TaxID=91347 RepID=H2IT38_RAHAC  ali  46  1MKKALVLFSIGLAMTGLS-CHASAQQQIRFGTDATFPPFEFKAADGSLQGFDIDLGNAICAQLRAKCIWVENGFDGLIPALQARKFDAIISSLSITDERKKAINFSDKLFNTPAYLVASKDSGLKPLAESLQGKRVGVQQGSVFEAYAKKHWQSQGVELVSYPAAEAVYADLVVGRLDATLDDATVVTTALLDKPQGKHFSLIEPQVKDDAIFGPGTGIGIAKQNSELLEQLNGAIKAIRKDGTYDRLAKKYFNFNVYG. 258
70 0.000e+00UniRef50_Q11I17 Amino acid ABC transporter substrate-binding protein, PAAT family n=179 Tax=Proteobacteria TaxID=1224 RepID=Q11I17_CHESB  ali  38  24....................QAQERMQLKIGTEGAYPPFNNLTADGNLEGFDIDIARALCEEMNAECEFVTQEWDGMIPALQAGKFDAIIASMSITDERKQQVDFTEKYYNTPPAIVVAKDSDIAVTKEDLAGRTIGAQASTTHGNFAEATFQES--EVKLYPTAEEYKLDMTNGRLDAVVDDVIVLQDWL-STPDGECCKVLGTLTPVEEIYGEGIGIAIRKGEDELREKFNAAIQAIRENGKYKEINDKYFEFDVYGG 261
71 0.000e+00UniRef50_UPI000BA9F95E AncCDT-1 n=2 Tax=root TaxID=1 RepID=UPI000BA9F95E  ali  33  21.......................KRGTLRVGTDADYKPFSFKDKNGQYTGFDIDLAKALAKELGVKVEFVPTTWDGIIPALQTGKFDIVMSGMTITPERKKKVDFSDPYMTAGQTILVKKDNDKIKSFEDLNDVKVAVQLGTTSEQAAKEFLPK--AKIRTFENNAEAFQEVVSGRADAMVTDSPVAAYYAKKNPGLAVV------VVDEPFTHEPLGFAIRKGDPELLNWVNNWLKQMKKDGTYDKLYEKWFK...... 246
72 0.000e+00UniRef50_P09551 Lysine/arginine/ornithine-binding periplasmic protein n=766 Tax=Bacteria TaxID=2 RepID=ARGT_ECOLI  ali  67  1MKKSILALSLLVGLSTAASSYAALPETVRIGTDTTYAPFSSKDAKGDFVGFDIDLGNEMCKRMQVKCTWVASDFDALIPSLKAKKIDAIISSLSITDKRQQEIAFSDKLYAADSRLIAAKGSPIQPTLDSLKGKHVGVLQGSTQEAYANETWRSKGVDVVAYANQDLVYSDLAAGRLDAALQDEVAASEGFLKQPAGKDFAFAGSSVKDKKYFGDGTGVGLRKDDAELTAAFNKALGELRQDGTYDKMAKKYFDFNVYG. 259
73 0.000e+00UniRef50_R4WZN8 Amino acid ABC transporter substrate-binding protein PAAT family n=66 Tax=Burkholderiaceae TaxID=119060 RepID=R4WZN8_9BURK  ali  53  1MKKLLAALTMSLLLTAVTSAQAKDYSTIRFGVDASYPPFESKGSDGKLVGFDIDLGNEICSRLKAKCVWVENDFDGMIPALKAKKFDGVLSSMSMTPQRAEQIAFSSKLFNTPTRLVAKKGSNILPTADSLKGKNVGVEQGTIQETYAKTYWAPKGVTVTPYQNQDQVYADLTSGRLDAALQDAVQAEIGFLKTPRGNGFDFAGKDIVDPKILGNGAGIGLRKEDTDLKTQIDKAIADIIKDGTYKKLEKKYFDFDVYGS 264
74 0.000e+00UniRef50_A0A1Y0D2Z3 Nickel transporter n=13 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1Y0D2Z3_9GAMM  ali  39  1MNKLLIAGAIMASLAA-GAVQAKEWKTVRFGIEGAYPPFSWTDEQGQLQGFDVDMANALCEQMQVKCELIAQDWDGIIPALLARKYDAIIAAMSITEERQRTVDFTDRYALVPNKFVAKKGTELELSKDGLKGKKVGVQIATTHDKYLTENFGKE-VSLVRYGTADEAYLDLKAGRVDYVFLDATAIEEGLLNKDGGNEYEFVGPSVTDEKWFGEGFGIAVRKQDSDLKDQLNKAIVDLRANGKYEAVNNKYFEYDVYG. 257
75 0.000e+00UniRef50_Q5E4G4 Lysine/arginine/ornithine transporter subunit n=456 Tax=Proteobacteria TaxID=1224 RepID=Q5E4G4_ALIF1  ali  41  1MKKWLLA-AVVASTALTGAAQAKEWKQIRFGIEGAYPPFSWTEPSGELKGFDVDIANALCKEMEARCKIVAQDWDGIIPSLLARKYDAIIAAMSITEERKKKIDFTEKYALIPNKFVAKKGTKLVMTKEGLKGVTVGVQRATTHDKYLTDNFG-KGVDLKRYGSFDEAYLDLKAGRIDTVLGDASALEEGLLNKPGGTEYEFVGPSLTDPKWFGEGFGIATRKQDKDLTEQLNAAIDSLREKGIYQEIAAKYFNYDVYG. 257
76 0.000e+00UniRef50_D6SQP6 Extracellular solute-binding protein family 3 n=17 Tax=Proteobacteria TaxID=1224 RepID=D6SQP6_9DELT  ali  41  1MRRFFYITALVLLGCMLLAGTSLARDKVRIGTEGAYPPFNYMDSQGNLKGFDIDIAKALCEAANLECEFVTQSWDGIIPALLARDYDAIIASMSITEERKRRVDFTEKYYQTPARFVKHKDRDIEISKDDLEGLSVGVQRATVSANFINDNFDD-VLDIRSYATQEEANMDIVSGRVDLLFADAVVLQTGFLDSEEGQNYEFVGPSYTDEEWFGEGIGIALRQGDDDLRETFNQAIQDIREDGTYQEINDSYFDFDVYG. 258
77 0.000e+00UniRef50_D7A657 Extracellular solute-binding protein family 3 n=36 Tax=Rhizobiales TaxID=356 RepID=D7A657_STAND  ali  41  17............MGASLSGASAKEWKTVRIGTEGAYPPFNYI-ENNELKGFDIDIGKALCEKMKVTCTFVAQDWDGIIPALLAGKYDAIVASMSITEERKKQINFSKKYYKTPATFAVPKDSKIDTSPASLKGKTLGAQGSTIHSNYLEDVYAKAGAEVKLYGKQDEANLDLANGRLDAVLADKVVLLEWL-NSKDGACCKFTGAEYTDPKYFGEGVGVGIRKDDPELVAMFNKAIDEIVADGTYKKINDKYFPFSVY.. 261
78 0.000e+00UniRef50_UPI0008DC0510 ABC transporter substrate-binding protein n=2 Tax=Rhizobiales TaxID=356 RepID=UPI0008DC0510  ali  41  2..KTLLAVILLSATTFATAHHSFAEDTLRIATEGAYPPFNQLEPDGSLSGFDVDIAKALCADMKVTCEFVKQDWDGLVPGLLAKKFDVIAASMTITEDRKKRVDFTEKYYQTPSQFSSKKGSGLDVTPDGLKGKTIGVQRGTIQSCYLEKHYANS--ELKVYPSQLEAFNDLVAGRVDIVFSDRVGAQEQLLKGPDGASYELVGPPQKDADCLGEGVGLALRKNSDELRDKLNTAIKHIRADGTYKEINAKYFPFDLYG. 256
79 0.000e+00UniRef50_Q2P9U5 HisJ (Fragment) n=20 Tax=Enterobacterales TaxID=91347 RepID=Q2P9U5_SALTM  ali  96  1...LALSLSLVLAFSSATAAFAAIPQKIRIGTDPTYAPFESKNAQGELVGFDIDLAKELCKRINTQCTFVENPLDALIPSLKAKKIDAIMSSLSITEKRQQEIAFTDKLYAADSRLVVAKNSDIQPTVASLKGKRVGVLQGTTQETFGNEHWAPKGIEIVSYQGQDQ............................................................................................. 164
80 2.000e-98UniRef50_Q6D3S6 Arginine-binding periplasmic protein 1 n=40 Tax=Enterobacterales TaxID=91347 RepID=Q6D3S6_PECAS  ali  36  1MKKLI-----VAALFAVGAASANAADTIRFATEASYPPFEFVDANNQIQGFDIDLANALCKEMQANCTFSNQAFDSLIPGLKFRRFEAVIAGMDITPERQQQVSFSQPYYDNAALFIAQKG--KVADVAALKGKRVGMQNGSTHQKYLLEKHPE--ITAVPYDSYQNAVLDLKSGRLDAVFGDTAVVNEWLKQND---TLATVGENVTDKDYFGIGLGIAVRQNNDELLKKFNDALSKIKQDGTYETIYKKWF....... 241
81 2.000e-98UniRef50_A0A256CC24 Arginine ABC transporter substrate-binding protein n=10 Tax=unclassified Gammaproteobacteria TaxID=118884 RepID=A0A256CC24_9GAMM  ali  37  1MKKLKVFLALATLCVGGVA--MAKDATLRFGTNPEYPPFEYKTETGDVAGFDIDIANAICAELEKKCVYVSQSFDSLIPNLRLKRFDAIISSMDITEERQKHVAFSDPYYLNPSVFVTMKGSNI--TVDDLTGKEIGVLNGSTHQQYIKSKFKDS--NIKNYPQYPNAMSDLEIGRVNVVFGDEVVVAEYIKRNNE---LEVIGEQVNDPEFFGNGLAIAVLPKNTELLNEINGALAKIKEDGRYQAIYDKWFK...... 245
82 2.000e-98UniRef50_A0A077DF50 Uncharacterized protein n=1 Tax=Basilea psittacipulmonis DSM 24701 TaxID=1072685 RepID=A0A077DF50_9BURK  ali  42  1MKAKLLVASLLATVFF---AQAQAAQVLRIGTDPADPPFESYDAKGNLVGIDPEIGDYICKAMNVECEWVTLSFDSMIPALRSKKIDMVLSTMSITPERQKVVSFSEPLYVTSTRLMVAKNSPDIASVEELKGKTVGVQAGTIQSAYAKKYWEPNGVKVVDFDTNQLVKQDLALGRLDASLQD-VAGTIYFLDTPEGQGFKLTGEFVYDKAIFGEGCGIAFRKNDKKLIADVNKALEQMRADGTYAKILEKYFG...... 253
83 2.000e-98UniRef50_A0A1I5XGN9 Amino acid ABC transporter substrate-binding protein, PAAT family n=29 Tax=Bacteria TaxID=2 RepID=A0A1I5XGN9_9FIRM  ali  32  1MKRVLLTLALMVGLLLSACSGAQEAGKFIVGLDDTFAPMGFRDEEGNIVGFDIDLAKEAAKRLGVEVEFKPIDWNSKELELKNKKIDMIWNGLTITEDRKKNMAFTKPYLVNTQIIIVPEGS-SIKSKADLAGKKVGVQMSSSGLEALKKDKEVYDAEVVEYPDYLEAFLDLKAGRIDAVVADEILGRYYIEKRNEN-------FVILDDNFGTEEYGVGLRLEDKQLLEALNRVLDEMKQDGTMSEISKKWFGEDI... 266
84 2.000e-98UniRef50_A0A023C319 Amino acid ABC transporter n=2 Tax=Pseudomonas extremaustralis TaxID=359110 RepID=A0A023C319_9PSED  ali  36  1MKRVIRFASVCAVFAASVGLAQAD--VLKIATEGAYPPFNYVDSDNQLHGFDVDIALALCERMQAQCTLVAQDWDGIIPALMAKKYDAVVASMIDTEERRKKISFTHHYYKTPLSVAVPKDSDISDAQTNFKGKTVGAQSSSTQSIYAEDVYGKAGANVKLYPTLDEANSDLASGRLDGVIADKFPLADWIDK-AGKSCCKMLG----DVNGTQADASIAVRKEDNALRERFNKALDEIVADGTYQKISSKYFAFDIY.. 251
85 2.000e-98UniRef50_A0A066RPX7 Nickel transporter n=5 Tax=Vibrionaceae TaxID=641 RepID=A0A066RPX7_9GAMM  ali  41  1MKKQL-GMGLILAASLISNVQAADRPV-RLASDFTYPPFNYKDEQGTPKGFDIEIADALCQEAKLKCVWVAQSWDGLIPSLLARKSDAIMASMRITEERKKRVLFTEKYYQTPARFVARNNAGISIDKAGLDGKRIGVQLGTIHDRYVTDMYGD-VAKIQRYTGQDEVYLDLASGRLDAAFGNSDQLALAFLDKERGKGFEFVGAAVTDKAYIGEGTALALRKTDKALAEKFNQAIQKIRENGTYDRIASKYFNFDIYG. 256
86 2.000e-98UniRef50_A0A1H3WKF2 Arginine/ornithine transport system substrate-binding protein n=5 Tax=Thiotrichales TaxID=72273 RepID=A0A1H3WKF2_9GAMM  ali  40  2..KLLTTLLSSAVLALAVAGTAQAEDKLRLGTEGAYAPFNTVDKDGKLAGFDIDIGNALCKAMATECEWVTSDWDGLIPALDAKKFDAIIASMSITAERKEKIDFSKKYYTTPIKCIRAVGTDVDPTDEALKGKMVGVQSGVVADNFVRGKFKD-IVEVTAYKTQDEANLDLLAGRVDLVCADSVVLAPVVKDEKNAGKVEFIGGDFNDVEFVGEGVGIGIRKGDTALAEKLNKAIEQIRADGTYAEINKKYFDFDLYG. 258
87 3.000e-98UniRef50_A0A0K9Q858 Uncharacterized protein n=2 Tax=cellular organisms TaxID=131567 RepID=A0A0K9Q858_SPIOL  ali  43  1MKKLPLITALALGLIASSHLLAAE-KTLRIGIEAAYPPFASKTEEGKIVGFDYDIGNALCAQMKVKCVWVEGEFDGLIPSLKVKKIDMALSSMTINEDRKKSVDFTH----------------------NLKGKTVGVQRATTTDRYATEVFEPKGINVKRYSNNEEIYMDLAAGRLDAIFADTIPLNDFL-QMPRGKGYAFVGPELKDPKYVGEGAGIAVRKGNSALVSELNAAIDGIRASGEYQKLSQQYFKSDIYG. 235
88 3.000e-98UniRef50_C1D8T2 AotJ n=7 Tax=Chromobacteriaceae TaxID=1499392 RepID=C1D8T2_LARHH  ali  39  19.................CGSQTAAAEWLRFGIDGNYPPFASFGRDGQLQGFDVDIANALCDAMQRQCLIVPQDWDGLIPALNANKFDAILSSMSITAERRKAVDFTDRYYRLPSRMLAAPGTDTAVG--SFRGKRIGTLLGSTQQRFARSYWGSRGAEIVAYPRITSALDDLAAGRLAGVFVDALAGEAYLSRPGTAPRFTFVGPAFDDPAYFGEGAGIAVRKGNVALQTALNAAIGQIRADGRYDSIRKKYFSHDIYG. 258
89 5.000e-98UniRef50_A0A158JWH0 ABC amino acid transporter, periplasmic ligand binding protein n=31 Tax=Proteobacteria TaxID=1224 RepID=A0A158JWH0_9BURK  ali  33  12....LVTCALTATALVMSGPAFSAGDTLRVATEGTYPPWSFKDSSGQLQGFDVDIANALCVQMKLKCQIVAQAWDGIIPGLQANRYDAIVASMSTTPERRKQVLFTNRYKDTTSSFIAAKDSGIDVSPAGLKGKRIGVQRGSSQHQWLTANGYDKTASLVLYDDTRQPELDLVAGRVDLIIGNKATFYADFFKRPDSKDFAFVGPEFKGGIL-GDGNAIAVRLSDAELCSRINAALAAIMANGTYDQIRKKYFPF..... 262
90 6.000e-98UniRef50_A0A2N7WVD0 ABC transporter substrate-binding protein n=481 Tax=cellular organisms TaxID=131567 RepID=A0A2N7WVD0_9BURK  ali  43  1MNLKLSLCIAAAMTALAGAAHAQSSGTLRFGIEASYPPFESKTPAGQLQGFDIDVGNAVCAKMKVKCVWVENAFDGLIPALQARKFDVINSAMNITAKRKQSIDFTPPIYIVPIVMVAKRDSGLLPDVKSLHGKRVGVLQGSSQEDFLKAHWANAGVEVVSYQDQDQVWADLVAARLDAAVQEAQTAQDGFLDKPAGHGFTFVGEPLKDTATLGEGTGFGMRKGDKALAEKVDAALSELKKDGTLSALSLKYFKRDI... 257
91 8.000e-98UniRef50_C8NC77 Lysine-arginine-ornithine-binding periplasmic protein n=9 Tax=Gammaproteobacteria TaxID=1236 RepID=C8NC77_CARH6  ali  37  1MKKLL----AIALCAGFAGNALAADKPLIFSTDGTYPPFSEMGSDGQMTGFDIDIGKALCEQMKRECRFEPIDWEGLIPALQTKKIDVILASMNDTPERRESIAFTDPYYSNPGLFVRAEGSKIEPTPEGVKGKVVGVLRASIFDNYVTAKFPD--ANIQRYTSQEEANQDALAGRVDLLFADKIVMEDGFLQRDEGKGFEIAGET-NDPEYFGAGISIGVRKDDNALREELNAALKAIKENGAYKKVNDKYFKYDISGG 253
92 9.000e-98UniRef50_G8MES2 ArgT n=42 Tax=cellular organisms TaxID=131567 RepID=G8MES2_9BURK  ali  45  4.KKSASLAMLAALAAVSFSAQAKEITQIRFAVDPSYPPFESKQADGKLAGFDIDLGNALCAQMKVKCVWVENNFDGMIPGLKARKFDAVLSDMGITEERLKQIDFTDPLYDTHAQLVARAGSGILPTPQALKGKRVGVEQGTVQERYAKVKWEPQGVTVVPYGDQEQVEADLVAGRIDAMFTDAAQAAIGFLKKPQGKPFALVGTIVEDKAIIGPGTAIGLRKGDADLKNGLNNAFAEIKKNGTFKRIMAKYFETDIS.. 260
93 1.000e-97UniRef50_A0A1H7EYP7 Polar amino acid transport system substrate-binding protein/arginine/ornithine transport system substrate-binding protein n=4 Tax  ali  36  15.........ICLLAFLCTWAGASGAQTYRIATEGTYAPWSFKDAQGVLQGWDVDIAKALCEKMSARCEIVAQDWDGIIPGLMARKYDMIVASMAITPQRRQRVDFSEKYKETISRFVARKNAPADVSPAALKGKSIGVQRGSIQAAYLADAYRD--ADLKYYDTSQAAELDLVAGRVDYILGNMVTYFVGFMKTPESRNFAFVGPDLKGG-LLGEGNGIAVRKGDTALLSRVNAALAAIRADGTYDRITARYFPF..... 258
94 1.000e-97UniRef50_A0A0J1DL07 Uncharacterized protein n=1 Tax=Peptococcaceae bacterium 1109 TaxID=1655638 RepID=A0A0J1DL07_9FIRM  ali  28  1MKK-LMGLMLCAVLLVVLAQGALAQGKLKVATEAGFMPFEFVAEDGSLMGFDMDLMKAIADKLDMELTIDNISWDGLIPALQNGNYDAIMAGITITPERAQSVAFSEPYFESVLTIVVRSNNNDITDLDSLKGKTVAVQISTTGDYAAEEIEGIGG--LLRYNTVPEAMQNVIMGTAHAMVIDLPVAEAYLAANPN------APLKHVGPVADNEFFGIAVHKENTELLAKINWALAQLHADGTYDAIYNTWFGV..... 246
95 1.000e-97UniRef50_A0A220VBQ3 Arginine ABC transporter substrate-binding protein n=1 Tax=Paraphotobacterium marinum TaxID=1755811 RepID=A0A220VBQ3_9GAMM  ali  38  1MKKIFLILSLFLSSTAFAS------QTIKFATEASYPPFEYTNQKGEIIGFDIDIAKALCSQIKAKCTFTNQSFDSLIPAIKFNRYDAAISAMDITAERSKQVSFSDPYYDNAAEFIAI--NPKDKSINDLKGKRVGVQNGTTHQKYINENLKDIIT--VPYDSYQNALIDLKNGRIEAVFGDTAVLNEWLKKDN---KLHIVGDKVTDKNYFGNGLGIAVNKSNTKLLNQLNKALATIKSNGTYQKIYDKYFK...... 241
96 1.000e-97UniRef50_A0A2D7VJB6 Uncharacterized protein n=15 Tax=root TaxID=1 RepID=A0A2D7VJB6_9GAMM  ali  41  3.KKKLTMLGLAGVLALVTGTAAAGGHGLRVGVEGAYPPFSWKEADGTLKGFDIDMAMEVCKRLNRECVLVEQEWDGMIPALLAKKFDTIIASMSITEERKKKIDFTVKYYNTPAKLVAKKGASFDGTAAGLNGKRLGVQRATTHQCSAEKLFP--GAELVLYATQEEVWQDLAAGRLDAQLSDSLQAYEGFLALDAGSGFDFLGDAIDDVECQGVGAGFAVRKEDSALRDQLSQIILDIRADGTYKAMNDKYFAVDIYG. 258
97 2.000e-97UniRef50_UPI00082AF12C amino acid ABC transporter n=3 Tax=Proteobacteria TaxID=1224 RepID=UPI00082AF12C  ali  32  1MKKTIFNTLLVGSLSISPFLHA---DTIKIATEGAYPPFNYVDSNNNLHGFDVEITNALCKKMNAECTILAQDWDGIIPGLIAKKYDAVIASMINTPERRLKVSFTNHYYNTPLSLAVKKGSDTTMDNFDARGLVIGAQSASTQAFYAEDVLAVKGASIKLYPTQDEANADLANGRLDAVVADMIPLMEWVNNHGDD-CCEYVG----DFQGTNSEAAIAVRKADDQLRERFNQAIDAIVADGTYLEISNRYFGTNIY.. 250
98 2.000e-97UniRef50_J5XGY2 Lysine-arginine-ornithine-binding periplasmic protein n=41 Tax=Negativicutes TaxID=909932 RepID=J5XGY2_9FIRM  ali  26  3MKKMLLGAVGLLAAASFAGDSGSASKTLRVGTNADFAPFEFQGENGEYEGFDMDLARAVAEEMGMTADIQNINFDGLIPALVSKNIDIAISGMTINDERKKNVLFSEPYYQSGLTIVVKKDNKDINGFKDLAGKTVAVQIGTTSAKEVKKN---PDIQVKELNSSADTFLELKAGGVQAVVNDRPVNDYYIAKSGEK------DVRVVNELLTSEDYGIAMAKDNQELQKKVDEALKKLKENGKYDEIYKKWFG...... 255
99 2.000e-97UniRef50_W7Q339 ABC transporter substrate-binding protein n=154 Tax=Proteobacteria TaxID=1224 RepID=W7Q339_9GAMM  ali  33  1MKKLLTVSILGLAMAA-GTAQARDYDHVRFGVDIPYEPMEYRDADGELTGFDIELGNALCAEIGVTCEWIEQEWDGIIPGLLARNYDAIMSSMTINEERRQTVLFSDPYITIPGAWFAPVGSEIDENEESLTEKSIGVQRGTTFDNYVTDNYG-SVANVSRYSTADDMVLDLQSQRLDLVFLEFIVGQVTLLENHQGEYQVVGEMVTEPEEYFGEGFGIAFRQRDEALAERFNEALATLKEDGTYDEIFERYFG...... 253
100 2.000e-97UniRef50_B8E254 Extracellular solute-binding protein family 3 n=3 Tax=Dictyoglomus TaxID=13 RepID=B8E254_DICTD  ali  32  29......................KKVGVLKVGSDVAYAPFEFMEGD-KPVGFDIDIAQEIAKALGVKLQVINTSFDGIIAALKAKKFDIIISAMTITEERKKEIDFSIPYYDSGQIIVVRSENKDIKSEKDLKDKVVGVQLGTTGELTAKKLKDQIGIEIRSYETIPEAFMDLELGRLDAVINDLPVSLYYSKNNPKLKC--------VGKPFTIEQYGIAVRKEDKDLLKKINEILINLKKTGKYNQIYKKWFGV..... 253
101 3.000e-97UniRef50_A0A2N9VYI1 Amino acid ABC transporter n=4 Tax=Rhizobiales TaxID=356 RepID=A0A2N9VYI1_9RHIZ  ali  35  1MLKYVLAFAISASLFTAHTAALAGEDELRFGLDGGYPPFASPNPDGQLVGFDIDLGEALCAEMHRKCVWVRQEWDALIPGLDTNKFDAILASMLITPERKEKVSFTNPYYAAKAVFVAPKSNTVAKTPADLDGKTVGVETATAYGTYLQSKYGDK-VMVRDYPTVTEAFADLKAGRIEYVLNDANSSYFAINRDGDDGALKLIGEPLVDSML-GEGVGIAVQKQNTELLKALNTALDQVVANGTYSIINKKYFPYDL... 256
102 3.000e-97UniRef50_A0A1M2YMB9 Amino acid ABC transporter n=54 Tax=Proteobacteria TaxID=1224 RepID=A0A1M2YMB9_9RHIZ  ali  36  8....IAANLVLATLVAVSPAKAEEPLKIKIATEGAYPPFNSVDTAGKLIGFDVDIANALCAELKAECELVAQDWDGIIPGLLAKKYDVIIASMFITEERKQSVDFTKPYYKAAMTYVMKKGDDSVLDKPDLGGKSVGVQAGTTQAAFVEAAHPD--ADIKQYPTQDEVNLDLAGGRLDMQVGDLVPMLEWTEKTEDGKCCALTGKPITDPKYVGEGVGMAIRKEDGALKEKLNGALDAIVANGVYKSINDKYFSLDIY.. 260
103 4.000e-97UniRef50_UPI00041CEB64 ABC transporter substrate-binding protein n=2 Tax=cellular organisms TaxID=131567 RepID=UPI00041CEB64  ali  38  25........................QEVVRIGTTPSYPPFSWVDAQGRLNGFEIELGEALCAQMQVKCEWVLQSWDGIIPALQEKKFDAIIASMSITDERKQVVDFSDKYYNSPAVFIGRKDEAVEISPEGLDGKTVGVQVSTIHANYVEAKY-KGVVTIKTYDTQENANLDLIAGRVDLLLADSVALTDGFLKSPEGADFEVKGQPIRDP-LLGAGAGVAVRKGDP-LAARFSAAVQAIRANGLYKTINDKYFSFDIYG. 257
104 4.000e-97UniRef50_UPI0008D9817B basic amino acid ABC transporter substrate-binding protein n=1 Tax=Acidaminococcus timonensis TaxID=1871002 RepID=UPI0008D9817  ali  29  1MKKVMVLLCALMMLIGAAGCGSAEKKELIVGTEPSFAPFEFPDKSGEITGFDMDLIKAMGKRAGFKVTVKGMGFDALIPALDAGNIDVAIAGMSITDARKQKVNFTDPYYESGLMAIVKKENTTIKSLDDLKGKTIAVQLGTTGAEAAGKI---EGATVKTFDTSDTACLELKNGGADAVISDLPVLQYFLKQGGSAYA------KAVGEPKKGDFYGIATAKKNKALCDKLNKALQDMKKDGEYQKIYDKWFK...... 256
105 4.000e-97UniRef50_UPI000688B398 amino acid ABC transporter n=1 Tax=Marinobacterium jannaschii TaxID=64970 RepID=UPI000688B398  ali  37  4..KKAFAAAMVVATASVGASFAQAGDKLRIATEGAWAPFNFIDASGKPRGFDVDIANALCEKMQAECTIVTQDWDGLIPGLKVKKFDAIVASMSITEDRLKQVDFTDPYYTGGLRYVAAKGSKFDTSRAALKGKVIGAQRATVAGQYLEDNL-DGVVDIKLYDNNDAVYLDLKAGRLDGALSDELPTYEWLK-SDTAKGFEYKGPAFAKD----DKIGIAVRKGD-ELRQRMNKALQEILADGTYDVINAQYFPFSIY.. 252
106 5.000e-97UniRef50_UPI00087B1505 ABC transporter substrate-binding protein n=1 Tax=Pseudomonas brassicacearum TaxID=930166 RepID=UPI00087B1505  ali  49  18....................GAKAEDVLRLGVDPTYPPLEYRDAQGKMIGFDIELGDEICKRMAVKCEYIQSSFDGLIPGLLARKFDGVLSSLSITEQRLKQIDFSAKLSNPSTRLVARTGSGILPTPAGLKGKTVGYQQGTIQESYARTYWKVPGIKLQAYASQDQVYADLVNGRIDASLQDEVQATYAFLKTDQGKGYEFAGPIIVDAKVLGSGTAIGLRKEDQHLKSGIDKAIAGMLADGTYKRIASKYFDFDIYGG 257
107 5.000e-97UniRef50_W0LHB8 ABC transporter substrate-binding protein n=7 Tax=Proteobacteria TaxID=1224 RepID=W0LHB8_9GAMM  ali  45  1MKKTLNTLIATGCLLAAGATFAAEN-SLRFGIEALYPPFESKSASGQLEGFDIDLGNAVCAAAKLECSWVETSFDSLIPALQARKFEAINSAMNITDQRRQAIAFTDSIYQVPNRLIAKADSGLLPDAKSLAGKRVGVLQGSIQENYANAHWAPQGVDVVSYQDQNQVYLDLTSGRLDATLIMAPAGQSGFLAHPDGKGFAFVGEAVQDDKILGEGIAFGLRKDDTARLQQLNAAIAKVKQQGTITELSKKYFG...... 253
108 6.000e-97UniRef50_A0A221AEY8 Lysine/arginine/ornithine-binding periplasmic protein n=230 Tax=cellular organisms TaxID=131567 RepID=A0A221AEY8_9BURK  ali  46  1MKILLMILSAALTLS--SAAFAAEPQTLRLGIDPTYPPMDSKAPDGSVKGFDVDLGNEICKRIHARCQWVELEFSGMIPALQARKIDAVMSSMAITEKREQQILFSSKLFQFKSHLIARQGSPLAGGMNALSGKQIGVQSGTQFESYALKNWAPNGVHVVAYKSQDEVFADLQNGRLDGALLGTVEADYGFLRTPAGKGFAFVGEPL---SMGDHGVGIGLRKDETALQTSINGAIAAMLKDGTYAQIAKKYFDFDPYG. 254
109 6.000e-97UniRef50_A0A155VPQ6 Lysine-arginine-ornithine-binding periplasmic protein n=182 Tax=Bacteria TaxID=2 RepID=A0A155VPQ6_ENTCL  ali  43  1MK----LGALVVGIGLLCSFSSFAATELRYGLEAEYPPFESRNASGELEGFDVELGNAICKAAALKCSWVETSFDALIPGLLAKKFDAINSAMNITEQRRKSIDFTQPIYRIPSQLVGKAGSAVEATPEGLKGKTIGVLQGSIQETYAKEHWEKHGVTVVSYKDQNMAWGDLLNGRIDASLVMSAAGQAGFLSKPQGKGFGFIGKPVSDDTILGSGIGFGLRKGDEATKKQLDAAIDKVRADGTIAKLADKYFGIDVS.. 255
110 7.000e-97UniRef50_A0A1H2ZPF0 Polar amino acid transport system substrate-binding protein/lysine/arginine/ornithine transport system substrate-binding protein/  ali  35  1MFKPLRKMTAISLLAIVSAGTASADDVIRFATEAAYPPFNERAADGSIVGWEIDLGQAMCAKMERKCEFVAQDWDGMIPGLLSNRFDGIFASMTITEERKQRIDFSDKYYQSPARFVAKDGAAIDRAASDLGGLKVGTISGVT-ECFLNKHYPDTETAI--YRSSEDMFLDLQSGRLDAILSESVQADFGLIRENPDDGFAFQGGPALDAECFGEGIGIGVRKDDAELRAALNEAIAAVRADGTYDRLVEEYFGYDIYG. 256
111 8.000e-97UniRef50_A0A239ZC40 Amino acid ABC transporter substrate-binding protein, PAAT family n=76 Tax=Bacteria TaxID=2 RepID=A0A239ZC40_CLOCO  ali  33  1MKKILSILVFLLSTLLIVGCGNKKEGVLKMGLNDTYPPMEFRDEKHNLVGFDVDLGEEIAKKLGVKLEIITNDWSGIILSLKSKKYDMILSTLSITDERKKEINFSEPYIVGGQKLVVKKDEKDIKTVEDLKGKIIGCQMGTTGEVSASKIEGIK--ELKKYDGVTQAFNDLAVGRINAVIADGQVGGYYLKKRGGD-------LVLLDVKLTSEPVGIGFRKEDTTLRDEVQKALDELKKEGTLSKLSEKWFGYDIY.. 271
112 8.000e-97UniRef50_A0A1Y2SRH0 Arginine/ornithine-binding periplasmic protein n=147 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1Y2SRH0_9GAMM  ali  37  21.......................EKTPLRFATEATYPPFEFIDANNKIQGFDVDLANALCAKLNTECTFTNQSFDSLIPSLKFRRFDALMAGIDITPDRQKQVDFTHTYYDNSAIFIAIKG--KFAHIADLKGKQVGIQNGTTHQKYLMEQHKE--IKTVPYDSYQNAILDLKNGRIDAVFGDTAVVNEWLKKNQE---LATVGDKVTDKNYFGIGLGIAVRKGNTELLNKLNNALAEAKQDGSYDTIYKKWFG...... 244
113 9.000e-97UniRef50_A0A0Q8GPR5 ABC transporter substrate-binding protein n=12 Tax=Pelomonas TaxID=335058 RepID=A0A0Q8GPR5_9BURK  ali  45  19....................QAPEWKKLRIGVEGAYPPFSEIGPDGKLKGFEIELVQAYCAEMKAQCTLVQQDFDGLIPALQSRKVDAIFASVSITEERQKVIAFSKPYYATPARLVAKAGAKLDPTAASLKGKKIGVQRGTTHETYATAMFKQS--EIVRYGSQDQVFLDLKSGRLDATLMDAPAADFGFLKKPEGKGFAFAGPAILDDKIFGVGTGVGMRKADEALGKKFNAAIDVLQANGTFKKLADKYFDYDI... 254
114 1.000e-96UniRef50_A0A0J8YE09 ABC transporter substrate-binding protein n=7 Tax=Proteobacteria TaxID=1224 RepID=A0A0J8YE09_9ENTR  ali  43  1MNKVKVLCLTLGMF----SCAAFAADELRYGIEAEYPPFESRNAAGELEGFDVDLGNAICKAARLKCSWVETSFDALIPGLMSKKFDAINSAMNITDQRRQSIDFTQPIYRIPSQLVGKAGSALDATPQALKGKTIGVLQGSIQETYAKEHWEKQGVTVISYKDQNMAWGDLVNGRIDASLVMSAAGQGGFLSKPQGKGFGFIGKPVEDDKILGSGIGFGLRKGDEATKKQLDAAIDKVRADGTIDQLAKKYFGIDVS.. 255
115 1.000e-96UniRef50_A0A1Y0L2V6 ABC transporter substrate-binding protein n=1 Tax=Tatumella citrea TaxID=53336 RepID=A0A1Y0L2V6_TATCI  ali  43  1MKKWILLMLAGGM---SGCYAAEALPSLTVGIDPTFPPFEYMDDSGHLAGFDVQLGKEICQRIQRHCTFISLPFDSLIPALQARKFDIILSSLSINDERRKSIDFSLPLFSTPVYLIAAKSSPLVADAASLKGRRVGVQQGSVFETYADKYWRPQGVDIVTYQSPDQIYTDLTAGRLDASLDDAVSATFSFLKKPQGANYALKGKEVTDLALFGQGTGIGFRKGDDKLQQQVNQAITDIYSDGSFSKLSHQWFTFNV... 255
116 1.000e-96UniRef50_UPI000379964F hypothetical protein n=1 Tax=Orenia marismortui TaxID=46469 RepID=UPI000379964F  ali  30  1MKKIFSLMIIMSLIIGCTSNQANDKKTLQVGVEGTYPPFNFETEDGKLTGYDVEVAREIANRIGYKIKFIPTKWSGMFGALEAKKFDIIVNQVAITPERQEKYDFSEPYVYSGAQLIVKSNNNKIRSLKDLKGKKVGVGLGSNYEQIIKEFDQNNKIEVKTYEVLLDTLNDLDIGRIDAALNDKLAAGINIKKTG-------LDLKVTGKVVKKVVNGITLRKGNKQLLNKINNALAEMKSDGTLKEISLKWFGVDVS.. 255
117 2.000e-96UniRef50_A0A0M6YBJ0 Lysine-arginine-ornithine-binding periplasmic protein n=3 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A0M6YBJ0_9RHOB  ali  35  1MNK-LQTIVAVFAVSVNTGAAAQEV-TVRMGTEGYYPPFNYFDSAGQIKGFDIDIGNALCEKMKVKCEWVTTDWEGIIPALNANKFDTIVASMSITDERSKIVSFTEPYYFNPGQFVTAKDSGLKGAPSDLTGKTIGTQSGTLEVKVLEQYFPES--EIQLYPTLDDSLLDLETGRVDAVYASAFVLADWLA-TETGSCCNFVGQMFREKS--NKGTGIAVRKDDEDLRIALNKALAEIMADGTYEEIRSRYFDFDI... 251
118 2.000e-96UniRef50_F5SGU9 Glutamine ABC superfamily ATP binding cassette transporter, binding protein n=30 Tax=Bacillales TaxID=1385 RepID=F5SGU9_9BACL  ali  29  60...FFLSMILVFALLAAACGGGKSAGTLRVGTDAQYPPFEKQEGNGEITGFDIEIISAVAKAEGMKVSVKHTGWDPLFEAVKRGKIDAGISAMTITEDRLKSYDFSDPYFEAKQLLLVPVNSK-VKTLKDLKGKQIGVQSGTTGEEVTKKAFGKTYSGIRGYDDTPAAIEDLVNGRVDGVVADNGVVRFFMKQLDDRKF-----KVIEDPSFEAEHYGIVVKKGNTELLDKINSGLKKIKEDGTYDQIHSKYFGK..... 308
119 2.000e-96UniRef50_UPI0004A36A43 ABC transporter substrate-binding protein n=1 Tax=Tatumella saanichensis TaxID=480813 RepID=UPI0004A36A43  ali  41  1MKKGLT--LSLLLSVGAFSHLSYAEQTLSFGVDPTFPPFESKAADGSLQGFDIELGNAICAQAKVKCQWVQLGFDGSIPALQAKKFDAILSAMSMTEKRRQQVDFSNMIYSTPSAVLAPATSPISTDIRSLRGKTIGVAQGTIQESYAQSQWASQGVNIVSYPNQMDVYPDLVAGRLDASVANAVSAQQGFLKSPEGKGFVIK-QMLNNKAILGAGVGIAVRKGDSEHLNLINTALAEIHANGTYDKLEKKYFAFKVY.. 255
120 2.000e-96UniRef50_A0A2C8F224 Amino acid ABC transporter periplasmic amino acid-binding protein n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2C8F224_9PSED :  ali  38  5.KKFLLAAAATLVF----SANALAVDKYKVGIEGAYPPFNNKNESGQVVGFDYDIAMALCAKMKAECEVVTSDWDGIIPALNAKKFDFIVSSLSITDERKQAVDFTDPYYSNKQQFVASKEVDFKTDIDSLKSKQLGTQRATQAATWLEDNV---GGDIKLYDTQENAYLDLASGRVDALLADKYAIYDWLKSEPGLK-YEFKGEPIND----SDKVGIALRKNDDTLRNKLNRALKEIKEDGTYKKINDKYFPFSI... 248
121 2.000e-96UniRef50_A0A0A5FYU5 Glutamine ABC transporter substrate-binding protein n=3 Tax=Bacillaceae TaxID=186817 RepID=A0A0A5FYU5_9BACI  ali  30  1MKKLLTLLIAVLTVSLLTACGSSDGETYTVATDANFKPFEYKNPDGEMEGFDIDLMKAIAKEAGFNVEFKTMQFDGLITGMQSGRYPLAIAGISITEKRKESISFSDPYYDSGLILMVNSDNNEIKSIDDVDGKTVGVKTGSTSEAYLKEN---TDAEVKAFPNIINAYMDVKNERLDASLYDLPNVKYYIQQNGEGK------LKTVGDVLEGQSYGIALPK-DSDLVDDVNKALQAVKDSGKYDEIYKKYFG...... 255
122 2.000e-96UniRef50_A0A1I2MNB2 Glutamine transport system substrate-binding protein n=2 Tax=Planifilum fulgidum TaxID=201973 RepID=A0A1I2MNB2_9BACL  ali  29  1MKRMGLIFLISVLALSVSACGSGEKGKITIGTDTSFVPFEFLNQDGEYEGFDIDLVKAIAEKIGIEYELKPMDFNGLIPALQTGNLDMAIAGMTITDERKKVVDFTRPYYDAGLYILVRSDEKSIKGVEDLKGKVVATKQGTTSFNYASKLDGLK--EVRPFPNIDQAYMELEKGSADAVIYDSPNVLYYIKTKGKGK------VKAVGDLLQAESYGIAFPKGSP-LRDKVDEALGELMEDGTYEKLYVKWFG...... 258
123 3.000e-96UniRef50_A0A235B7V0 Basic amino acid ABC transporter substrate-binding protein n=6 Tax=Bacillales TaxID=1385 RepID=A0A235B7V0_9BACL  ali  27  11.....AILSLFLVITGCGAESSNDTGVLKVGTDAAYPPFEKQEGDGTITGFDIEVMKAIAAAEGFEIEVEHTGWDPLLEGLKNGKLDAGISAITITEDRKKNYDFSDPYFEAKQLILVPESSKSD-SLQDLKGKKIGVQAATTGEEVVKKAFGKTYQGLRGYDSTPAAIDDLGNGRVDAVVADNGVVKEYMKRLPEGQF-----KIVEDDSFEPEQYGIAVQKGNQEVLDKINSGLKTIKKDGTYDQIYKKYFGE..... 257
124 3.000e-96UniRef50_A0A1Y3Q692 Uncharacterized protein n=2 Tax=Firmicutes bacterium ZCTH02-B6 TaxID=1861639 RepID=A0A1Y3Q692_9FIRM  ali  33  27............................RVGSDVTYPPFEYVDEQGAFVGFDMDLIREVGKRLGMDVEIINTAWEGIIPGLLAGHYDVIISAMTITDERAQAVDFSDPYFATGQVIVVRADDDTVRQPSDLAGKVVAVQIGTTGQFAAERI--DGVARIDHYPTMPEAFLALRLGRADAAVADELVAYEEAQANPGV-------LKVVGTPFTVEYYGIALRKGRADLLRDINRALAQIKADGTYDEIYDKWFG...... 244
125 4.000e-96UniRef50_A0A037UUL8 Amino acid ABC transporter n=2 Tax=Rhodomicrobium TaxID=1068 RepID=A0A037UUL8_9RHIZ  ali  37  23.....................ASAQTKIRIATEGTNPPFSIIDASGEVTGFDVDIAKALCAKMQTECEIVEQDWDGIVPSLLAKKYDAIVASLNITEDRKNVVAFTKPYYRSPSVFVVRKGDAKDVSPKALTGKPVGVQTATNHSAFLEDKYHRSI--VRLYNTVADAYRDLSAGRVDYVLYDKLAVYDWLK-SPEGQCCEIAPTELADEAYFGSGVGIALRKGDDALVKRFNDALDGIVKDGTYAKINAKYFPFPVF.. 257
126 4.000e-96UniRef50_A0A095ZBE6 ABC transporter substrate-binding protein n=8 Tax=Oligella TaxID=90243 RepID=A0A095ZBE6_9BURK  ali  39  1MKKITSLVAASLVALASFSAAAQDKAELRIGAEAAYAPFEYKLPSGELAGYDIDIGNAICEKLAMQCVWIEQPFDSLIPGLLARKFDLVHSAITVTEERKKVISFTDPLYEVTSQLVAAKDSGIDGSDESLKGKTVGVLQGSVQETYARKRWDRSGVRVTSYVEQSQTIADLKVGRVDAILFESPNAVEGLLNTAEGAGFIFVGEPIVNDPIMNNEIAIGIRKEDTELKSKIDGALKALKDEGVLDELAKKYF....... 254
127 6.000e-96UniRef50_A0A2G6EU89 Nickel transporter n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2G6EU89_9GAMM  ali  37  7........FLLVAALTVSANVAFAEKTLKIGVEGAYPPFSEVNKDGEIVGFDIDIANALCAEMKRKCEMKKIAWDGMIPALKGRKIDAIIASMSATEKRKKSIDFTDRYYRIPVKVVRKKGAAVEFNKEGMKGKIIGVQKSTPFSEHLGDLFGD-VAEIKRYPSTDEALVDLQAGGVDVVAAESLVLQEGFLNRDVGKNFELFGPDLIDPKYYGEGIAIGIRKNQEELKQAFNAAIKAIRANGKYKEINDKYFDIDVYG. 256
128 7.000e-96UniRef50_A0A1Y0L7C3 ABC transporter substrate-binding protein n=2 Tax=Enterobacterales TaxID=91347 RepID=A0A1Y0L7C3_TATCI  ali  47  1MKKIVSAVFLAGLFCVSATASAQE--VLRFAVDPTFPPFEFKGADGSLQGFDIDIGNAICKQAQVKCEWTELGFDALIPALKAKKFDAILSSMSRTEKREQQIAFSDMIYHTPNALVVPEGSKITDDVATMKGKTIGVAQGTTQEAWAKAKWAPAGVQVVSYANQDQVYPDLVAGRLDGTLTDAVTADNGFLKTPQGKGY-FISAKPEDKAFFGQGSGIGLRKGDTARLTLINNAIAAIHKSGEYDRIEKKYFTFSVY.. 255
129 7.000e-96UniRef50_A0A0C1G8Y1 Uncharacterized protein n=11 Tax=Bacteria TaxID=2 RepID=A0A0C1G8Y1_9RHOB  ali  39  1MSLKTKLLATVLSATSLFAGGTAMADTLRMGVEGAYAPFSKKEADGTLSGFDIDIALALCAELNRECELVEQEWDGMIPALIANKYDAIVASMSITEDRKKKVDFTEKYYFTPSRFIAKEGTEIELTQEGTKGVKIGVLRGTTLQCHVEKMYPD--ADIKLYNTQEDVFADLVAGRLDLQLNNTLQAIDGFLNTPQGEGFAFLGEDVDDIECMGEGTGIAVRKGDP-LAEELSAAIKAIRANGTYDEINDKYFDIDIYG. 256
130 8.000e-96UniRef50_A0A1G9WXF8 Polar amino acid transport system substrate-binding protein n=29 Tax=cellular organisms TaxID=131567 RepID=A0A1G9WXF8_9FIRM  ali  25  3.KKTIAFVLAGILVLALGQQQAGQAKVLRAAGEATFAPFEFQDEKNELTGFDVDLIKAIGKQMGYEVQYQNQSFDGLIPALDSGNIDIAISGMTITSERAQKVNFSKPYYKSGLTILVKKDDDSIKGFKDLAGKNIAVQIGTTGSMEAKKI---PDAKVREFNSAAEAIMELKAGGVDAVVNDMPVNEYYLVQSGGQEA------KSVGERLTSEDYGIATAKKNTELNEKINKALDELKQNGEYEKIYVKWFGV..... 254
131 9.000e-96UniRef50_A0A095XR77 Glutamine ABC transporter substrate-binding protein n=3 Tax=Firmicutes TaxID=1239 RepID=A0A095XR77_9FIRM  ali  25  10...MLVICSLALLIAGCGGNSADKDKVLRVGAETTFPPFEFADEKGNYSGFDLDLIHAIAADLGYKVEFKSMGFDALIPALNSKQIDVIISAMSITDERKNVVLFSDPYYKSGVAIVTNKTNQDIQGKADLEGKTIACQIGNTGSMLASEI---SNAKVINFDGANQAFLQLKNGGADAVMIDLPVAQDYMKKDADKA------FQVVGDVLEAEDYGIAVSKENQELMKKINASLKKLKDNGEYQKIYEKWFGT..... 257
132 9.000e-96UniRef50_A0A060AYT5 Nickel transporter n=67 Tax=root TaxID=1 RepID=A0A060AYT5_9GAMM  ali  36  1MKKLLTVSVLGLAIAAASSAQARDYDHVRIGVDVPYEPMEYRTADGELTGFDIDLGNALCDQMGVTCEWVEQEWDGIVPGLLSRNYDAIMSSMTINEERRQTLLFSDPYITMPGAWFAPADSDLEATVETLEGLSIGVQRGTTYDNFATDTFGDT-ATINRYSTADDMVLDMDAERLDAVFLEFSVGKSTLLENED-SDYKVVGEMVTEPKVFGEGFGIAFRQRDEALAEKFNEALAELKEDGTYDEIFARYFGE..... 255
133 9.000e-96UniRef50_A0A1B0VJC0 Amino acid ABC transporter substrate-binding protein n=25 Tax=cellular organisms TaxID=131567 RepID=A0A1B0VJC0_FERIS  ali  35  29......................KKRGKLIVGTEPTFPPFEFVDEKNQIVGFDIDIANELAKRLGVKLEIVSLPFDSLIPALLQGKIDLAIAGMTITEERAKVVDFSKPYFEANQAIVVRKDGKFEKKLEELVGKKVAVQLGTTGDLVVSEI---NGIQVVRFQKFTDAFLELQNARVDAVVLDEAPAKAYVKKFP-----KFVISSVID---TGETYGIAVRKGNKELLNFVNQTLDILKSSGTYNKLLQKWF....... 249
134 1.000e-95UniRef50_D7DUB2 Extracellular solute-binding protein family 3 n=1 Tax=Methanococcus voltae (strain ATCC BAA-1334 / A3) TaxID=456320 RepID=D7DUB2_METV  ali  30  35......................EEPYVLTVGSSVDFRPFEYMDENGKPTGFDMDIIHEIGRRLDMEIEIIDSQFGGLIPALNTKKFDCVISAMTITENRSKEVKFSEPYFEAGQILSVNKDNNEITTLEDLSDKKVGVQIATTGDLIASENASKYNYEVKQYNKIGDAFMDMKNGKIDAVLVDNVVATEYFQENPGL-------YKLTGDLMTSESYGIATRLDDTELSEKIDKALADMKADGTYDEIYNKWFGDN.... 261
135 1.000e-95UniRef50_A0A1M3PGK2 Amino acid ABC transporter n=1 Tax=Rhizobium sp. 60-20 TaxID=1895819 RepID=A0A1M3PGK2_9RHIZ  ali  32  2..KSTRTLVAATALLASTAVGAFAKDAYKIATEGAYPPFNFVDPSGKLQGFEIELGNAICAKMEAKCEWVIQDFDGTIPGLLAGKFDFAMTSMSITPERKKTIDFSDKYYSTAAVFTVPKNSTIDVSPQALQGKTIAAQSSTIHAAMLEDKYAS--VTTRLYPTLDEAFMDLKSGRVDAVFGDKLATAPWLK-SEAGDCCHTVGGDITDPSF-GPGVGVALKQGNDELKARLNKAIKDVVDDGTYKSINDKYFPFSIY.. 254
136 2.000e-95UniRef50_UPI0005518CD2 cysteine ABC transporter substrate-binding protein n=1 Tax=Deinococcus sp. YIM 77859 TaxID=1540221 RepID=UPI0005518CD2  ali  35  47........................AGTLQIAMEGTYPPFTFRDEQGNLTGFDVDIARALAEEMDLRPEFVLTEWSGILGGLQADKYDVILNQVGITPERQETIGFSEPYAYSQPQIIVRKGSDFQQTLEDLRGKRVGVGLGSNFEQQLREV---GGIEVVTYPGAPEYLADLAAGRIDAAYNDRLLVGYLINKD----NLPVEGAGVVGEP---EPVGVAFKKTNTALGEAINRALKEIKANGTYARISEQWFGEDVS.. 271
137 2.000e-95UniRef50_A0A286G5I9 L-arginine-binding protein /L-ornithine-binding protein n=2 Tax=Rhodospirillaceae TaxID=41295 RepID=A0A286G5I9_9PROT  ali  42  25.........................KEVTVGTEAAYAPFEYVDTNGQIVGFEVDLGNAICAAAELKCNWVNVPFDALIAQLQEKKIDAIMSSMSITEKRQQTIDFTKKYFQVPNAFVAKKGSDLEISEEGLKGKVIGVQSGTTNADYLKAKYEDS-VEIRRYPTQEEVTMDLVNGRLDAMVVDSVIGSEWFKK-PDGQGYGFVGPMLRDP-LFGQGVGVGLRKGDDALKAQFEKGIDTVMAAGIPQQLSQKWFGVNIY.. 254
138 2.000e-95UniRef50_A0A1K3E6G1 Glutamine ABC transporter, glutamine-binding periplasmic protein n=53 Tax=Bacteria TaxID=2 RepID=A0A1K3E6G1_MYCTX  ali  40  1MKKL---VIAALIGAFAFSAAAAEKEKIRFATEASYAPFETVNEKNEIVGFDVDLAQAMCAKINAECTFTNQAFDSLIPSLKYKRFDALMAGIDVTPERQKQVDFTNTYYDNSAVFVAVAGKFD--SIDSLKGKQIGIQNGTTHQKYLMEQFKD--MKIVPYESYQNAVLDLKGGRIDAVFGDTAVINEWLKSNDNLK---TVGERVTDPEYFGTGLAIAVRKGNSELKDKLNKALGEVKADGTYDTLYKKWF....... 243
139 3.000e-95UniRef50_A0A2U2SGY0 Uncharacterized protein n=1 Tax=Ardenticatenia bacterium TaxID=2099665 RepID=A0A2U2SGY0_9CHLR  ali  29  164................AATEAPAKVTKIKVGTNAEYPPFEFVDESGKIVGFDPDLMAAIAKAAGFEVEWVNTRWDGIFVALASGEFDAVMSAATITEERKKTVDFSDPYFNAGQVLSVKIGSP-YKTPADLAGKKIGVQLGTTGDIWATENTK---AEIVRYDEVTLAFQALANGDVDAVIADGPTSLDIIKANPEMK------VQVVGEPFTEEYYGIAVNKKKPEVLAAINAGLKAVKESGEYDKIYEKWFG...... 391
140 3.000e-95UniRef50_A0A0P8B4N5 Arginine/ornithine transport system substrate-binding protein n=15 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0P8B4N5_9ALTE  ali  36  1MKKLIVAASCVLAMIAGTA--QAQDRNLRVAFDIPYEPFEYRDENGELTGFEVELATAMCEELNANCEFVIQAWDGMIPGLLARKFDIIMSSMSITPERAERVLFSEPYYITPGGWFGPESDTDVTDMDAMRGKNVGVQRGTTMDTYVTENMG-GVVSIKRYTTAEDMVLDLEGQRLDAVFVDYPVGEQTILNRDG---YKEVGESVK----LGDGVGVAMRKRDTQLAEDINAALKKLKEDGTYDAIMNKYFSYDI... 248
141 3.000e-95UniRef50_A0A2V1GTD9 Arginine ABC transporter substrate-binding protein n=1 Tax=Flavobacteriaceae bacterium Hp12 TaxID=2171752 RepID=A0A2V1GTD9_9FLAO  ali  34  17.KKIISSVALAIGLSLTVSQSVGAADNIRFGTEPTYPPFEFLDDNNQMTGFDIELAKAICADIQANCEFKNQAFDSLIPGLKFKRFDAVISGMDITPARLEHVDFSAPYYENSAVFITAKAKNL-KNIADLSGKVIGTQNGSTHQAYMINKLESNGVKIRTYDSYLNALLDLKNGRTAAVFADTAVAREWLAK-PSNVDFVITGAEIKDPDYFGIGMGIAVRKND-GLKAKFDASLAKLKTNGVYQKLFTKYF....... 265
142 3.000e-95UniRef50_H0J004 Extracellular solute-binding protein n=60 Tax=Gammaproteobacteria TaxID=1236 RepID=H0J004_9GAMM  ali  35  1MKKLLTVSVLGFAIAAASSAQARNYDHVRIGVDVPYEPMEYRTADGELTGFDIDLGNALCEKIGITCEWIEQEWDGIIPGLMSRNYDAIMSSMTINEERRQQVLFSDPYITMPSAWFAPSSLDIEANEETLAGKTIGVQRGTLQDNFVTDNF-NSVANISRYSTADDMVLDMQAQRLDIVFLDFPIGQSTLLNN-DNADYVVVGERISEPKYFGDGFGIAFRQRDEALAEKFNDALAELKDDGTYDEIFERYFSED.... 256
143 4.000e-95UniRef50_A0A017RWY7 Amino acid ABC transporter substrate-binding protein n=22 Tax=Bacteria TaxID=2 RepID=A0A017RWY7_9CLOT  ali  29  1MKKIFVTFLVTVIVLGFIGCSSKKSGILTMGLDDSFPPMEFRDDNNNLQGFDIDLGNEIAKKLGVKAEFITTDFNGIILALTTGKFDMVLSTLSITDERKQTIDFSEPYIMEGIIVAIKGGNSTINNLEDLKGKIIACQMGSTSESAGQKISGIK--ELKKYDKITEAFHDLSIGRIDAVVVDELVGRYYMSKKSG-------EYEVLKDKLNDEPVGIGFKKEDVELKEAVQKAIEELKKDGTLSKLSIKWFGVDIY.. 262
144 4.000e-95UniRef50_A0A0A2TES0 Glutamine ABC transporter substrate-bindnig protein n=18 Tax=Bacillaceae TaxID=186817 RepID=A0A0A2TES0_9BACI  ali  28  1MKKLFTLVIALLSFSLLAACGGGDKETYTVATDANFKPFEFKDETGEMKGFDIELMKAIADEAGFNVEFKSMQFDGLITGMQSGRFPLAIAGISITDERKESIAFSDPYYDSGVVLMVNKDNNDIKSIDDVDGVTVGTKTGSTSESYLKQN---TDAEVKAFPDIINAYMDVKSGRLDAALYDLPNVKYYINQSGEGK------LKTVGDVLEAQSYGIALPKE-SELVEDVNKALQAVKDNGTYDEIYEKYFG...... 254
145 5.000e-95UniRef50_A0A1A9HK61 Uncharacterized protein n=14 Tax=Proteobacteria TaxID=1224 RepID=A0A1A9HK61_9BURK  ali  42  30.......................DWKKIRIGVEGAYPPFSEVGADGKLKGFEIDLALALCAELKAECTLVQQDFDGLIPALQARKVDAIIASVSITDERKKVIAFSNPYYNTPARFTAKSDAKFDFSPAGLKGKKIGVQRATIHEKFAADTFKQS--EIVRYATQDQAFLDLKSGRVDLTLADLVAADMGFLKTPAGKGYAFVGPSYDDVKYFGTGSGVGLRKADEKLGKKFNDAIAAVKANGTFKKLNDKYFEYDISG. 264
146 6.000e-95UniRef50_A0A1M7ZDK1 Polar amino acid transport system substrate-binding protein n=5 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1M7ZDK1_9RHIZ  ali  38  27......................SAQQVLRIGTEAAYKPFAYVLPSGELTGFDIDITNALCKQMKVECKIINQSYDGLIPALLVKKIDAIIASMSITPDREKSIDFAGPYYNTPALFVGAKGDAMTISAEGLSGKTVGVQRGTTMADYMAAKLPS--VNVQFYDTLDNATLDLVSGRIDLVFADSVVIDEWLK-TPQGANFQVEGDPIYDNATLGVGAGIGIRKGDTALKDQFNTALKEIIASGEYEQINKKYIPFSI... 258
147 7.000e-95UniRef50_F2NPC8 ABC-type transporter, periplasmic subunit family 3 n=2 Tax=Thermaceae TaxID=188786 RepID=F2NPC8_MARHT  ali  32  28....................QIQADGTIVIGTEGAFPPFNFFDE-GNLVGFDIEIGQALAERLGVKYEWKAQAFDTLLIALNQGRFDFVIASHTITPERAQAVDFTKPYYCTGNLIVALPGGP--RTPEELKGKVVGVQVGTTYFEYAQTIEGIK--EIKTYQTNPDALQDLLNQRIDAWITDQFTALEAMKQRDVELQLS--------DLLVREEIGIAVAKGNETLLAALNNALDEILADGTYAAISEKWFGQDI... 251
148 8.000e-95UniRef50_UPI0009302D46 nickel transporter n=2 Tax=Cardiobacteriaceae TaxID=868 RepID=UPI0009302D46  ali  36  1MKKVWLLSLL------FGASVYASEEKIIVATDGTYPPFSEMDDKGQMIGFDIDIAKALCAQMQVQCEFKQIEFDGLIAALKTGKADALVASLNANDERRKSVAFSKPYYGNPGVFVRAKGSNLEFDKASLKGKVIGVLRGTTFDEYASHEMKDWGLAINRYASQEEANLDMRAGRVDVLFADKIALQDGFLDREGGEKFELFGDELNDEKYFGEGIGIAVRKDEPQLAQRFSDAIEAIVANGEYKKVNDRYFSYDIY.. 252
149 8.000e-95UniRef50_A0A0G3BU14 ABC transporter substrate-binding protein n=22 Tax=Betaproteobacteria TaxID=28216 RepID=A0A0G3BU14_9BURK  ali  30  15.......ASMLLAGLLLSACGKQAEKVYVVGTDAAYAPFESQNETGEIVGFDIDVVKAVAAKAGFEVKFVNTPWEGIFNTLTQGDRDFLVSAITITDERKQSMDFSQPYFDARQLIAVRDNSKVAK-FDDLKKLKVGVQTGTTGDEVTSKLLGKNSPNVKRFESTPLALKELEAGGVDAVVADNGVVENYVANNPTAKF-----KTVSDPGFTPEQYGLAVRKGNTELMEKLNKGLADIKADGTYDQIYAKYF....... 276
150 9.000e-95UniRef50_A0A1H0A6A0 Amino acid ABC transporter substrate-binding protein, PAAT family n=1 Tax=Desulfonauticus submarinus TaxID=206665 RepID=A0A1H0A6A  ali  29  1MKRLLAFLFSVLFLSLISTSYAKDKGILVIGLDDAFPPMGFRKADGTLTGFDIEAAETLGKRLGIKIKWQPTAWDGVIHSLYAKKFDCIWNGMTITPERAKKVNFTKPYIMDGQVVVVRFNENKIKTFKDLKSAIIGVQKGSSAVEAVKK-LPVSPQEIREYDSNPKAFLDLEAGRLDAMVVDNVAGRYYISVRPGK-------YKILPGFITKEPFGVAFRKEDKELLKVIQSEIDKMVADGTMAKISVKWFGEDI... 258
151 9.000e-95UniRef50_A0A0N1DD49 ABC transporter substrate-binding protein n=9 Tax=Pseudomonadaceae TaxID=135621 RepID=A0A0N1DD49_9PSED  ali  43  1MNKKVASALTLASLFVAL--GAEAEPTLRFGVDPSYPPFEKKMPDGSLSGFDIDLGEAICANLQVKCVWVEQNFDSMIPALKAKKFDAILSAFSATPVRRQQVDFTNKIYVAPSALIAKTDSGILPDDDSLKGKSVGVIQGSLQEAYAKSVWAPKGAQIQSYQTQDQIFQDLITGRLQASFQAAVQGDIGLLQTPRGTGYAFAGPPITDKSIIGDGVAIGVRKGQDDLVQKINASIVAIRQSGEYDKIASRYFSFNVYG. 257
152 9.000e-95UniRef50_E3HB72 Amino acid ABC transporter substrate-binding protein, PAAT family n=7 Tax=Bacteria TaxID=2 RepID=E3HB72_ILYPC  ali  31  1MKKIVLIFLATIALLGCGKKSTKEQGKFIVGLDDTFAPMGFRDESGEIVGFDIDLAKEVASRMGVEAEFSPREWSSIVFELKSGNIDMVWNGMTITPERQEQIAFSEPYFANDQIIMTLADSP-IQTAEDLKGKIIGVQLGSSSYTLVMKNPISESAEIKKYATNAEALMDLEAKRIDAVVMDVIVGEYYAAKKEAREGKDI--FKSLDKALGKEDFGVGLRKEDKKLKKEIDKILDEMKKDGTFDTIHDKWFG...... 258
153 1.000e-94UniRef50_A0A1I7DM56 Amino acid ABC transporter substrate-binding protein, PAAT family n=8 Tax=Proteobacteria TaxID=1224 RepID=A0A1I7DM56_9RHIZ  ali  37  17.................SGAVGASAEPLKVGIAAEYPPFASPDASGKWDGWEVQVAEALCAEAKLECVITPISWDGIIPALTTKKIDMIAASMSITAEREKTIAFSDKYYNTPTGIIGPKSETFDASPEGLKGKIIGVQVSTVHEVYAKKHFGPTAAEIKIYQTQDEANADLAAGRIDAVQADSIALNDFLKTDQGKECCDMKGTVADDLEVLGPGVGVGLRKEDTELKEKINAAIKGIRANGKYDEIAKKYFDFNIYG. 259
154 2.000e-94UniRef50_A0A1I2YMK3 Amino acid ABC transporter substrate-binding protein, PAAT family (TC 3.A.1.3.-) n=10 Tax=Oceanospirillales TaxID=135619 RepID=A0  ali  38  20..............VFSGSVMARDDDPIRLAVDVPYEPFEYKTADGTLTGFEVDLGNAVCDYLEVECTWVEQPWDGMIPGLMARKYDAIMSSMAITEERAQQVLFSEPYYTTPSAWITAKDRDIIQDKESLKGLTVGVQRATIQDRYVTDLYGD-VLEIRRYGSADDVIADMQTGRLDLTFMDYPIAEASIDIDTEGSEFKRISDFIKEPKYFGQGVGVAFRKRDKALAEKFNEALAELKANGTYEEIMNKYFTYDV... 263
155 2.000e-94UniRef50_L9U9Y0 Extracellular solute-binding protein, family 3 n=11 Tax=Proteobacteria TaxID=1224 RepID=L9U9Y0_9GAMM  ali  36  1MFKTFTATAGLIGLSIFAAPVLADS--YKIGLSAEYPPFYAPDASGNWSGWEIDFIEELCDRLDAKCEIKPVAWEGIIPALKTGKIDMIIGSMSITPERAEQIAFSNKYYSSPTGILARKSTDIEPTPEGLEGAYLGIQSGTNQEQYARKHFADS-ATLNVYQTLNEELQDLVAGRIDAIVADTLAVQTFINSETGQSCCEYRGEVASDPELMSEGMGVGLRQSDTELRERVNSAIDAMRADSTYEEISAPYFDFDIYGS 258
156 2.000e-94UniRef50_A0A088UI41 Lysine-arginine-ornithine-binding periplasmic protein n=81 Tax=Betaproteobacteria TaxID=28216 RepID=A0A088UI41_BURCE  ali  36  1MKKLLQSLCVGAALLGSV---AHAEQVVRIGTLADYAPFEYKDASGKLQGMEIDVGKKMCDTMKVKCQWVTMDFDALIPALKAKQIDAVLAQMSKTPEREQSVDFSHIFTTAPVQLVAKQGSGITDNAATLRGKTIGVQTASTHESYLRRRLPKSGINVKVYQTLDEAWLDLEAGRVDAVFADNTVAYDWLTKAGRKEGFDFVGKPIADAEIFGDGTAIAVRKGDAPLKALFDKGIVQVQADGTFAAANKRYFPFSI... 256
157 2.000e-94UniRef50_A0A1V2SCV6 ABC transporter substrate-binding protein n=111 Tax=Firmicutes TaxID=1239 RepID=A0A1V2SCV6_9BACI  ali  25  1MKRSIFVIMMAILLVGLAACGTKESGEFVFASSGLYPPFNYT-ENNKLVGFDVEIGTAIAEEMGMNPKPVTNPWQTIIAALQTDKFDAIIGSMAITDERLKEVNFTDPYYESGAQIFVSKDNDSIKNADDLKGKTIGVVVSSTFEENAKEYTDD----VKTYDSDVTALQDLVKGRLDAVITDRLVGMYAVNQN--NLKIKQVGEPIYLD-----QMGIAIQKDDEELLKKVNEALKSIQENGTYGEISEKYFGEDIS.. 260
158 2.000e-94UniRef50_B8AFS1 Uncharacterized protein n=5 Tax=cellular organisms TaxID=131567 RepID=B8AFS1_ORYSI  ali  27  1MKSIFKVSLAALSLAFAVSSHAAD--KLVVATDTAFVPFEFKQGD-KYVGFDIDLWAAVAKELKLDYTLKPMDFGGIIPALQTKNVDLALAGITITDERKKAIDFSDGYYKSGLLVMVNADNNSVKGIDDLNGKVVAVKSGTGSVDYAKQHIKTK--DLRQFPNIDNAYMELGTKRADAVLHDTPNILYFIKTAGAGK------FKTVGDSLEAQQYGIAFPKGSDALREKVNGALKTLRENGTYNEIYKKWFGT..... 244
159 3.000e-94UniRef50_P0AEQ5 Glutamine-binding periplasmic protein n=1851 Tax=root TaxID=1 RepID=GLNH_ECO57  ali  26  1MKSVLKVSLAALTLAFAVSSHAAD-KKLVVATDTAFVPFEFKQGD-KYVGFDVDLWAAIAKELKLDYELKPMDFSGIIPALQTKNVDLALAGITITDERKKAIDFSDGYYKSGLLVMVKANNNDVKSVKDLDGKVVAVKSGTGSVDYAKANIKTK--DLRQFPNIDNAYMELGTNRADAVLHDTPNILYFIKTAGNGQ------FKAVGDSLEAQQYGIAFPKGSDELRDKVNGALKTLRENGTYNEIYKKWFGT..... 245
160 3.000e-94UniRef50_K9GYB2 Periplasmic cystine-binding protein FliY n=12 Tax=Proteobacteria TaxID=1224 RepID=K9GYB2_9PROT  ali  30  36....................QIKERGTIRIGVEGTYPPFNYTDEQGNLVGFEIDFAKAVAEEMGVEAEFVPTKWDGMLAGLDSERFDAIMNQVTITPERQEKYDFTQPYTVSGIQIITTEDKDELTTPEALEGQAVGVGLGSNYEDWLRENAP--GADVRTYDDNVASLQDLRVGRIDALLNDRLMAGYLLRRSDGA-------VVAAGEPFSKQRMGVAIRKDNPELLAALDQAIDDLRQSGELAEISKEWFGSDV... 264
161 3.000e-94UniRef50_A0A2X0V151 Glutamine-binding periplasmic protein n=4 Tax=Anaerobiospirillum thomasii TaxID=179995 RepID=A0A2X0V151_9GAMM  ali  27  6..KSSVLAMTLFAGSVFGASVATAADVLKVGTEGTYAPFEFVDNKGQLIGYDIDIMAAVAKDLGMELEVVNMPFDGLIPALMTQQIDAIAAAMSITEDRAKKVTFSDPYYKSGLSIIVRKDSDKYKTADDLKDQTLCAQIGTTGFMTANKISG----KVTAFNTQPEVFLELQSGGCEAVVNDRPVNLYYLVQNKDVAAVELK------DILSAEEYGIAVRKGNTELQEKINASLKKLKESGEFGKIHKKWFNV..... 251
162 4.000e-94UniRef50_A0A2V8N5I8 ABC transporter substrate-binding protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8N5I8_9BACT  ali  27  21..........VSTLAQSALQRVRQSGELRIGTDATYPPFESVEGN-EFSGFDIDLGNAIARELGVKARFINASFDGIFPALQNGTFDAVMSSVTITPERSASMLFSDPYYDSGQLICVRRESEGINAPDDLKGKTVGVQINTTAQYDLEKR---EGVTVAKYNTIDLALLDLQNNRIDAVVGDAPVLKYMIFKS-------FRELKTVGHRFTDEKFGIAFAQGSEDLVREVNTALKKIKETGEYDQIHEKWFG...... 253
163 4.000e-94UniRef50_A0A158K348 Histidine-binding periplasmic protein n=434 Tax=cellular organisms TaxID=131567 RepID=A0A158K348_9BURK  ali  53  26..................GAHAADMKEIRFGVEASYAPFESKSPAGELIGFDIDVGNAVCAKLSVKCVWVENSFDGLIPALQARKFDGINSDMTITDKRRVAIDFTDPIYTIPNQLVAKKGSHILPTAESLKSRHVGVLQGSIQETYAKAKWAPAGVDVQSYQAQDQIYADLASGRLDAAFQDAEAASKGFLKMPQGAGFAFAGPAVSDEKLLGAGVGFGVRKSDRALKDALNRALKELKDDGTIDKLAAKYFDVKV... 264
164 5.000e-94UniRef50_A4J4A4 Amino acid ABC transporter substrate-binding protein, PAAT family n=9 Tax=Desulfotomaculum TaxID=1562 RepID=A4J4A4_DESRM  ali  32  47....................QIKEKGVIVAGLDDTFAPMGYRDESNKLVGFDIDMGEEMAKRLGVKIQWQPTQWDGIIMALDSKRFDIILSGMTVTEERKKSINFSVPYVGDGQIMVVKKGTTGFNTAADLKGKVVGTQAGSSGEEAVKKVEGIK--EVKLYKTYPEAFTDLQIGRIPVVVCDRITASHYISKRAD--TYEIVGEKITDEPL-----AIGLRKSDPELKEAIDNVLNEMKKDGTLTKISMKWFNRDI... 274
165 6.000e-94UniRef50_A0A1X7EZH5 Amino acid ABC transporter substrate-binding protein, PAAT family n=1 Tax=Desulfovibrio sp. K3S TaxID=1519643 RepID=A0A1X7EZH5_9D  ali  27  1MKNLLSLCVAALLTVLMVGSAFAD--KLTVACDTSFPPFEFKDETGTHTGFDVQLWDAIAKKIGTEYTLQPMDFNGIIPGLQSNQVDVGIAGITIKPERSKVVDFSDPYYNAGILILVKAGNTSIKDIKDLKGKVVATKLGTTSADFVKTNCGAK--EVKLFPNSDAMFMELVAGGADAVMFDSPVIGDYVRKAPKGQ------VEVVGPLYQGQSYGIAFPKG-SALVAKVNAALKELRANGEYRTLYVKWFG...... 244
166 6.000e-94UniRef50_A0A1B1CKI8 Amino acid ABC transporter n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A1B1CKI8_RHILE  ali  37  1MKYTLKTIAVLAAITISSICGAAAEQV-RVGFAAEYPPFASPDASGNWEGWEVDFMKAMCSEAKLDCVISAIPYDGLIPALTASKIDIIIASVTITDKRKQTIDFSDYYYKTEAGLLTAKGSDLQVTPEGLAGKTIGVQSGSIHEAYATKHFVPAGAELKTYLTGDESFNDLASGRVDAVQADVIALDAYLKSDQGKDCCELRGKVQADASVLGNGIGVGLRKGDEDLKVKINAAIKAIRANGVYDKFSKKYFDFDVYGG 260
167 7.000e-94UniRef50_A0A1F9AYG0 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium RBG_13_49_15 TaxID=1797827 RepID=A0A1F9AYG0_9DELT  ali  37  26..........................KIRIATEGAYSPFNYVNPKGELEGFDVDIAKALCEAMKADCTMVSQDWDGIIPALQAKKYDVIVASMAVTEKRKEAIAFTKPYYYSVASYVVRKESKFPDKIESLTGKNIGVQRATIHEGTIKEMYKDK-VTIKTYDTNENCILDLKNKRIDAMIASRPLMAHYIKHHPES------GFAFLLGMYNPVDAAIGLRKEDKALLDKFNAALDTIIKNGTYEKISNKWFGESL... 249
168 7.000e-94UniRef50_X6FL25 Uncharacterized protein n=2 Tax=Mesorhizobium TaxID=68287 RepID=X6FL25_9RHIZ  ali  41  26...........................ITLATEAAYPPFNFRAADGSIAGFEVDLGQALCKKMNRTCIFVAQNWDGMIPGLLVKKFDGIFASMSITEERKKQIDFTDPYYQTAASFVAPDETKIDFSDKTLGGLKVGTVPG-VSECYLEKAYP--NASIQVYQNSEEMFLDVSSGRLDAVFSDKIQLDFGLLKTERGKGFSFQGDSISDPGCFGEGVGIGLRKEDTELREALNKAIKEVREDGTYKAINDKYFSYDIYG. 254
169 7.000e-94UniRef50_G4Q3D0 Periplasmic glutamine-binding protein n=28 Tax=Bacteria TaxID=2 RepID=G4Q3D0_ACIIR  ali  27  4MKKSLKMMCLLAALILGVAGCGGQKKELVVGTAPSFAPFEFSEEADKPTGFDMELIEAIGKKMGYKVTIKGMGFDALIPAMNAGNIDVIISGMSITDARKKQVLFTDPYYESGLMVIVKKDNNEIKSFDDLKGKRIGVQLGTTGAQEAEKI---EGAKVTNFDTSDLACIELKNGNVDAVISDLPVLQYFLKQKGSSYA------KAVGTPKKGDFYGIAAPKDKKDLVDGMNKALKELKDSGEYKKIYTKWFGE..... 263
170 8.000e-94UniRef50_A0A1N7SX48 Lysine/arginine/ornithine transporter subunit periplasmic-binding component of ABC superfamily n=1 Tax=Paraburkholderia piptadeni  ali  45  1MKKLHVLLAVVITFIVLPSSYSKDIATIRFGTSPDYPPFESKSPDGKLVGIDIDLGNAVCAQLHAKCEWVEGDFDGLIPSLKARKIDVILSGMMATEQRKKEIDFSDKLYSAHSRLLVSKASTLQPIAESLRGKSVGVLQGSVEETIAKAQWANSGVTVVPYANQDQALADLVNGRLDGVLVEQIQAGVGFLKTERGRGFKFAGGPIAVNGI-ADYTAMGLRKDDPSLRQSINDALQKIRSDGTYTTITHKYVDFDIS.. 258
171 8.000e-94UniRef50_A0A2T6C0I2 Glutamine transport system substrate-binding protein n=2 Tax=Bacillales TaxID=1385 RepID=A0A2T6C0I2_9BACL  ali  30  1MNKIIATLVLVLSLSAVACSSSQAKEKITVGTDSSFVPFEFLNETNEYDGFDIDLVKALSKEVGFEYELKTMDFNGLIPALQTNKLDMAIAGMTIKEERKKVVDFSQPYYDAGLLILVQKDEKEIKGLEDLKGKKIATKQGTTSYDFATNIDGVK--EVVPFPNIDQAYLELEKGAADAVIFDSPNVLYYSQNKGKGK------VKTVGKLLQGQQYGIAFPKG-SELRDKVDKAMTKLKEDGTYDKLYKKWFGE..... 255
172 9.000e-94UniRef50_D9Y3F7 Glutamine ABC transporter, periplasmic glutamine-binding protein GlnH n=5 Tax=Bacteria TaxID=2 RepID=D9Y3F7_9BURK  ali  30  3.KRSFLALVAVLSMSLLTACGAKAEKVLRVGTNPTFAPFEFQKGSNDLTGFDIDLAKALGKQMGYKVELVNLGFDGLIPALSTGNIDLAVSGMSITEERKNAVDFCDPYYTSGLIVLVRPDETNIKGINDLVGKRIGAQIGTTG---ATKASSVKGADVKQYNNANEPFIELDNKGVDAVINDQPVVAYYLVNGGKGK--------MVGDIMEAEYYGIAAKKGNKALVKQVNEALAALKKNGEYDKIYKKWFG...... 255
173 9.000e-94UniRef50_C1DA94 Glutamine transport system substrate-binding protein n=9 Tax=Betaproteobacteria TaxID=28216 RepID=C1DA94_LARHH  ali  26  8.....LVLSAILSAVVLAGCGKKXXKEYVVGTDAAYAPFEYENDKKEVEGFDIDVLSAAAEKGGFKVKFINTPWEGIFASLGNGDRDIVVSSVTITDERKQTMDFSEPYFEARQLIVVSKDAAGIKKFADLKGKKVAVQTGTTGDEVTQKLLGKSSPDIKRFESTPLALKELENGGVDAVVADNGVVVNYLSNNGDKGLVSVE----DTESFAPEYYGIAVKKGNQALQEQINKGLAAIKADGTYDQIYAKWFG...... 267
174 1.000e-93UniRef50_UPI00055EEE6C hypothetical protein n=1 Tax=Rhizobium sp. CF097 TaxID=1500301 RepID=UPI00055EEE6C  ali  35  2..RFFRTIALTSIVLLAYAAQAEELQTLKIGVDASYPPFSSMDATGEIVGFEIDYATALCAKMKVKCTFQNQDFDGIIPALLAKKFDVIVSSMSITEERAQRVLFSDMYYATAPAFMTSKDNSDDISPEALAGKTLGAQSSSVFANYLDKIY--SNSDIKLYPSQEEENLDLLNGRLDYVHGDQTLLQAFVEKHDN---CCRVITFKRDPVIFGPGVGAAFRPEDTELAAQFNKAIAEADADGTYDKIEKKYFNFSIRG. 254
175 1.000e-93UniRef50_A0A2H5ZVL2 Glutamine-binding periplasmic protein n=2 Tax=unclassified Bacteria (miscellaneous) TaxID=49928 RepID=A0A2H5ZVL2_9BACT  ali  27  49..........................TLRVATDATYPPFEMLDEQKNLIGYDIDLIREICRLANCRPEIRSVAWEGILPGVQQGDYDVAISGITITPEREQRVDFTEPYIEVGQVILVRADETRIQGAQDLADKTVAVQLGTTNDELATRMQRERQIEVRRYRTFDLAVAALLNRDVDAVIIDSVAGQGFIAQNPGR-------LKTVGERLTREQLGIVVREGNTELRDAFNAALRALKQDGTLDRLYRKWFEE..... 271
176 1.000e-93UniRef50_G7WE60 Periplasmic component of amino acid ABC-type transporter/signal transduction system n=15 Tax=Bacteria TaxID=2 RepID=G7WE60_DESOD  ali  32  41......................KAAGKITFAMSGQYPPFNYFNEENELTGFDVEIGQEIAKRINVNPEPIATEWDGIIAGLTTSKFDMILGSMAITDERLQKVNFSNPYYRSGAQIIVPSDST-ISGADDLKGKTVGVVLGTTFETKAREL----GANVNTYKGDPDAFHDMLNGRLDAVITDKIVGLNAIKNN--NYPFKLVGDLI-----YVEKMGIAIRKDSPELLDAVNKALTDMMDDGTYKAISEKYFNQDI... 263
177 1.000e-93UniRef50_C0GIL5 Extracellular solute-binding protein family 3 n=1 Tax=Dethiobacter alkaliphilus AHT 1 TaxID=555088 RepID=C0GIL5_9FIRM  ali  29  1MKKLALCFVLVLALGVLAGCGNEAAETLIMGTNAEFAPFEFINDDNEYDGFDVDMAKMIADELGMELEIDNMAFDGLISAVLSERVDMAVAAMTITEERQEEVNFSDPYINAGQVIVVLEDNDEIQSVEDLEDKSVAVQLGTTGDIEASRIVDDS--NIVRLQQINAAFMELETGRVDAVIVDNPVAQRYINTMGSLK--------MVGEPLTEEYYGIAVNKDNTELLEQINQALANIKEDGRFDELIVKWF....... 264
178 1.000e-93UniRef50_B2AFY1 High-affinity glutamine transport protein, ABC transporter, periplasmic binding component peri_bind n=62 Tax=Proteobacteria TaxID=122  ali  30  6.KCLIAALSAVAGLTFGASAHAQDSNVLRVATDATFPPMEFI-ENGKRTGFDVELVEAMAKTMGKQVEWTNIDFKGLIPGLVSRRFDMAVSGIYITPERRKVVDFTEPYYTGGLVALVKSGNTAINKPEDLNGKKVSVQVGTKSVSFLRDTYPQ--VTRVEVEKNQEMFNLVEIGRADAAVTGKPAAMQYVKTRG--------GLRVVEQQLTTEEYGMAVRKDTPELTRALNAALAKVKADGTYAKLTQKWFG...... 247
179 1.000e-93UniRef50_A0A1B8P690 Lysine-arginine-ornithine-binding periplasmic protein n=63 Tax=root TaxID=1 RepID=A0A1B8P690_HALEL  ali  34  1MKLNKLLSIGVLGAGMIAGVANAEVRDIRIGVDVPYEPMEYRTADGELTGFDIELGNAMCEEIGIECEWVVQGWDGIIPGLMARKYDAIMSSMTINDKRREQVLFSDPYFTPPSAWFAPADSEIETDAETLEDMSIGVQRGTLQDNYVTDMYGD-VADVNRYATADDMVLDMDSGRLDIVFLDFPVGKSTLLDSEAG-DYKTVGEQITEPKYFGDGFGIAFRKRDEELAAAFNEALATLKENGTYAEIESKYFSE..... 255
180 2.000e-93UniRef50_A4J2K6 Amino acid ABC transporter substrate-binding protein, PAAT family n=4 Tax=Clostridia TaxID=186801 RepID=A4J2K6_DESRM  ali  24  1MKRILTGLTILALALVAVGCTGKEKKKLVAAADATFAPFEFTDSSGKYVGFDLDLIAAIAEEMGYELEFQSIAFDGIIPALQSSQIDCAATAMTITPERSKAVNFSDPYYKAGQIVVVKTENNDIKGVNDLKGKTIAVQSGTTGAMEAEKATDKK--KVIYFTGADQALQELKNGAANAVIIDYPVAAYFIQQ--GNKDVKLVG-----DIMSAEEYGIAVPKDKEQILADVNAGLKKIKENGKYAEIYKKWFGE..... 260
181 2.000e-93UniRef50_A0A077DFW6 Glutamine ABC transporter substrate-bindnig protein n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A077DFW6_9BURK  ali  25  7.KKLCLIGGLMMSLLPFTHTAQAADKELIVATNLGFVPFEFT-EKGKYVGFDVDLIDAIAQKLGLKYKWRTMEFGGLVSALQTNNVDMVIAGMTITPERQAVVDFSDPYYQAGLAVLTRLKDEHIKTTADLAGKPVAVQTGTVAVEYMKKEVPT--AKLNYFPEVNNLYLDLLTGRSDAVVHDSPNVQYYAATAGKGK------TRVTGFIDTNESYGIAFPKGSP-LVAEVNKALKELKEDGTYDKIYSKWFGK..... 250
182 2.000e-93UniRef50_A0A2V4NFB2 Uncharacterized protein n=2 Tax=Pseudomonas TaxID=286 RepID=A0A2V4NFB2_9PSED  ali  33  1MPKRIKILAASYLLFATGFAQA-DSQPVRIATEGAYPPYNYVTPDGGLAGFDVDIANALCAEMNLQCTLVKQDWDGIIPGLLAKKYDAIVASMAITPERQRKVAFTAKYEGGYSMLFGRTE-LVDSSPRALHGKTIAVQKGSIQEKFAKAYYEKQGVRVQRYPDTQTALMDLTAQRVDAVVLEVATIHEALKDH-SLSGYHSFGEKYNDPAYFGNGSAIALRKEDQALLNRFNQALRAILANGTYKRINDKYFTYNQY.. 255
183 2.000e-93UniRef50_A0A1F4XN89 Uncharacterized protein n=3 Tax=candidate division Zixibacteria TaxID=1379697 RepID=A0A1F4XN89_9BACT  ali  29  10..RFITFLLIFTFLFPLNCSREKKEKKLLVGTDATYPPFESKDDSGKLVGYDIDLMDAICDKLGARCEYVVVPFDGIVSGLNSEKYDAIISSFTITPEREMVIDFSKPYYQASQSIAVRLDRQKINSLIDLKGKKIGVQLGTTGELLAKKV---EGAEVVSFDNIGAAFIDLENGKLDAIINDKPTSQRIIALRGNAK--------IVGTDLSSENYGIAVRKGEKRLLDAINNALTSLELSGKLEDLNKKWF....... 257
184 2.000e-93UniRef50_C0Z9S1 Glutamine ABC transporter substrate binding protein n=99 Tax=Terrabacteria group TaxID=1783272 RepID=C0Z9S1_BREBN  ali  25  1MKKLMFAVVSGLLALTVSACGTSGAKKYVFGTDATYPPFEF-EKDGKYVGIDIDLINAIAKEEGFEVEIKPMDFKGIIPAVQAKQLDGAIAGISINDKRKEILDFSEPYYQAGLSLVVREDNTTINGEADLAGKTIAIKKGTTGATFADELGQKYGATVKYFDDSPSMFQEVQNGNADVTIEDYPVISYKITVDPASK------LKIVGDRLNGDHYGIAVLKGNKELQDKLNSGLKKLKENGKYDEIINTYL....... 254
185 3.000e-93UniRef50_A0A256CHG5 Lysine-ar n=5 Tax=Ignatzschineria TaxID=112008 RepID=A0A256CHG5_9GAMM  ali  40  3.KKLIIGSSLLFATQVMA------QDVIKIGIEGSYPPFSYISENQTIEGFEPDLAKLFCEKMEQKCEIVQVDFDALIPSLNTKRIDAILASMSITDTRKKAINFSNKYYQTPARFVIPVGKNIDITDEGLKGKKIGVQSGTIHEIYMNDKYRRS-ADIRSYRSLDEAMMDLETGRIDLVFADVVPLDIGYLKEDYAGKIEFIGPAFFDEEWLGEGVGVGLRKSDTALLDRFNKAIQASREDGSYQEVEAKYFDYDVYG. 253
186 4.000e-93UniRef50_E8N0Q9 Amino acid ABC transporter substrate binding protein n=3 Tax=Chloroflexi TaxID=200795 RepID=E8N0Q9_ANATU  ali  25  1MKRLWAMLIMALVFSACTPAQPSEKTKVRVATDATFPPFEMVDENKQLTGFDVELMNAIAQKAGFEVEWINVGFDPMLAGIAECQYDMAIAAITITEERKASMDFSDPYINAGQIVTVRKETTDISGKNDLKGKKIGAQLGTTGAIEAEKI---EGAEVKTYDSYDQAFLDLANGQIDAVIADYPTTLAFLATNPDK-------LKTVGEVFTDENYGVAFCKKKADLIPQVNAAIKALKEDGTIKKLEEKWL....... 248
187 4.000e-93UniRef50_A0A2G6LIL3 ABC transporter substrate-binding protein n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2G6LIL3_9GAMM  ali  30  12.....TLLALSIGLSACGGNKPAEEEVVRFATEGAYPPMNFTDKDGNLVGFDVDVANALCEQMKANCEIVAQDWEGIIPGLQAEKYDAIIAGMSITDERKKVVDFSDPYFSSGLLLIAKKGEDV--SFESLAGKAVGAQGATIASQYLEEEHPD--IKVKMYDTQENVNLDLINGRLDAVLVDQVVGTDWL-NSEDASNFEQKGDVVSTGK---DDFGIATRKDD-ELVGKLNTALADIKSNGKYDEISSKYFNK..... 264
188 5.000e-93UniRef50_A3YDI4 Putative periplasmic binding abc transporter protein n=15 Tax=Proteobacteria TaxID=1224 RepID=A3YDI4_9GAMM  ali  33  1MKKASIAYISAFVIGFFSTTLAAQTIKVGIATEP-YPPFSVPDASGNYSGWEIDIAKAICAQAKLDCEIVATAWDGIIPALLSKKIDVVAASLSITADRKRVIDFSDKYYQSGASIIGSKNANFSSTPAELDNKIIGLQAASIHVKFAKKYYP--NATIKEYQSQDEANQDLYSGRIDATQADALTLESFLNSEQGKNCCDLKGMAVNDESLLGEGIGFGLRKGNPELKEQLNNAIDAIRENGTYEQISQAYFSFNIYG. 257
189 5.000e-93UniRef50_A0A2K9NBJ1 ABC transporter substrate-binding protein n=11 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2K9NBJ1_9PROT  ali  32  25MRLMSLTAGFAASLLLLTAPADAQNARMRVGVEGNYPPFSVIGPDGKLSGFDIDIANALCAEMKVDCTLVQQEWDGMIPALNTRKFDMIVASMTITADRAKIVDFSDVYYDVPSRWVAKQGAFTEPTPDALKGKTIIVLRNSPRAKHAKEKYPNS--RLLLVAKETDVYLELRAGRGDIALGSSVIAEGLFLKRPEGAGFATVGEPLRLK--GDSDVGIAVRKGDTPLRDRINAALKAIKADGRYQQIAQRYFTFDVSGG 280
190 6.000e-93UniRef50_I0HP95 Putative ABC transporter substrate binding protein n=19 Tax=cellular organisms TaxID=131567 RepID=I0HP95_RUBGI  ali  25  7.RRFLQTAAVLAAGIVLAACGKKEETVYAVGTDAAYAPFESQDEKGEIVGFDIDVLKAIAAKAGFEVKFINTPWEGIFNALGQGDRDIVVSAVTITDERKQTLDFSEPYFDAAQLIAVRDNSKVAK-FADLKKLKVGVQTGTTGDEATTKLLGKTNTNIKRFESTPLALKELESGGVDAVVADNGVVIHHVANNPGAKF-----KTISDKEFAPEHYGIAVKKGNTALLEKINQGLAAIKADGTYDQIYAKYFG...... 270
191 6.000e-93UniRef50_A0A1V5QEN8 Glutamine-binding periplasmic protein n=3 Tax=Chloroflexi TaxID=200795 RepID=A0A1V5QEN8_9CHLR  ali  25  1MKKIFLSLLITVIAGCSSSNQKASEKKYRVATDPVWPPFEMVDEKKEITGFDIDLMNAIAENQGFAVEYVNVNFDALIPGVGTCQYDAGASAITITDERKKQMLFSDPYVNIGQVMVVREDVNDLVNKEDFAGKVIGAQTGTTGAIMAEEWQTEGLVTFRGYDTIDLAYMDLKNGQIDGVLGDSTMAEAYVKSMG--------GLKIVGDQYSSEELAFAVCKDNKDLLDKINAGLKALKESGKFDEIYKKYFEQSV... 255
192 9.000e-93UniRef50_D2RIZ0 Extracellular solute-binding protein family 3 n=14 Tax=Negativicutes TaxID=909932 RepID=D2RIZ0_ACIFV  ali  29  1MKKMKMFAGILAGLMMCVAAAGAEKKELVVGTNPSFAPFEFTDKDGKVMGFDIDLINALARKAGYKVTIKSIAFDGLIPSLESGNIDVSITGMSITDARKQKVNFTDPYYESGLMAVVKKDNEAIKGLDDLKGKTIAVQLGTTGAKYAETI---EGAKVKTFDSSDLACLELKNGGADAVISDLPVLQYFLKQGGSQYA------KSVGTPKKGDFYGIATAKKNKNLCDKLNKALAEMKKDGEYQKIYDKWFKV..... 260
193 1.000e-92UniRef50_U7P8H2 ABC transporter substrate-binding protein n=25 Tax=Proteobacteria TaxID=1224 RepID=U7P8H2_9GAMM  ali  35  22.....................SADVRDIRIGVDVPYEPMEYRTPEGELTGFDIELGNALCAEIGIDCEWVVQGWDGIIPGLMARKYDAIMSSMTINDERREQVLFSDPYFTPPSAWFAPADAEVTPSEESLEGLTIGVQRGTLQDNYVTDMYGD-VADVNRYATADDMVLDMDSGRLDIVFLDYPVGKSTLLDSEAG-NYKVVGKMITEPKYFGDGFGIAFRQRDEALAETFNEALAELKANGTYDEIHAKYFGE..... 255
194 1.000e-92UniRef50_A0A2L2L1I5 Uncharacterized protein n=6 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2L2L1I5_9PSED  ali  36  1MHRIKKVLFGLIILGSCATAQA-EETLVRIATEGAFPPYSFVNPDGSLGGFDVDIANALCAEMKAKCELVKQDWDGMIPGLLAKKYDAIVSSMNITPERQQKVAFSDKYEGGYSMLFGGKHLTDGR-PTALQGKVIAVQKGTVQESFAKDYYEKAGISLRRYPDIATAKMDLTAGRVDAVLMDVGNIYEA-KKDEGLSDYYAFGEQIKDPAYFGTGAGIAVRKDDPILLGRINQALANILANGTYKEINDKYFQYNQY.. 255
195 1.000e-92UniRef50_UPI000897AD62 ABC transporter substrate-binding protein n=2 Tax=Burkholderiales TaxID=80840 RepID=UPI000897AD62  ali  37  40...........................LRIATEGTYPPWSFKDAQGRLQGWDVDIATALCERMKTRCEIVAQDWDGIIPGLLAHKYDAIVASMAMTEQRRQRVDFTRKYKNTVSRFVARKGVPPDVSPAALEGRTIGVQRGSIQARYLAAHYRA--ADIKLYDTPQAAELDLLAGRVDYIFGNMVTYHVGFLRQPEARGYGFAGPELQGG-LLGEGNAIAVRKNSPALLQRLNDALAAIVADGTYDRITARYFPF..... 264
196 1.000e-92UniRef50_A0A1Y1RYL5 Basic amino acid ABC transporter substrate-binding protein n=2 Tax=Marispirochaeta TaxID=1911565 RepID=A0A1Y1RYL5_9SPIO  ali  22  3.KRIALVFMISLIGFALFAGGQQDDNMYVFASDVAWAPMEFVDENGDMVGFDIDLMAAIAEEAGFEYEIRNTAWDGIFAGLANGAYDGVISSVTITDDRKKAMDFSEPYINAGQVLIVRKELNGVTSLADMKGMKVGVQNGTTGDFVVED---AEGVERRAYDEIGFAVEDLMNGNVEGVVCDSPVAADYVLQNKNYKG----ALKIVGEPFTEEYYGIAVQKGNTELLNKINAGLKKIIESGKRDELIDKWL....... 247
197 2.000e-92UniRef50_J1J1V8 Lysine-arginine-ornithine-binding periplasmic protein n=15 Tax=Bartonella TaxID=773 RepID=J1J1V8_9RHIZ  ali  34  1MK----LLALALIISATLFTQSAHTQMLKIASEGSYPPFSYIDSNNKLQGFDIDISYALCKKMNVECTITTQDFEGMIPGLLAKKYDAIIASIALTKERLQKIDFTDPYYNTELAVIVAKDSGIEISAIAFKGKNLGVQSNTTQAAYAEDHYASEEINIKLYPTTIEVNRDLLSRRLDVVIVDKLQALNWLK-NEGKDCCHFLGTL----EGTKFPIAIALRQNNNDLKNKFNEAIKEIHSDGTYNRIIKKYFAFDIY.. 250
198 2.000e-92UniRef50_A0A0A7TV79 ABC transporter substrate-binding protein n=9 Tax=Proteobacteria TaxID=1224 RepID=A0A0A7TV79_9GAMM  ali  44  1MYKRI---SLALLLSYCAIQSAAAQQTLRFGVDPTFPPFESKASDGSLQGFDIDLGNAICAQAKVSCKWVQIGFDGSIPALQAKKFDAILSAMSMTEKRREQVAFSDMLYVTPSALITPADSALTDDIATLRGKNIGVAQGTIQETYAQTYWAPKGVSVVSYPNQMEIYPDLVAGRLDGTLANAVSADQGFLNTAEGKEY-VNKVTLTDKAVLGNGVGIGLRKDDVANLKLINAALAELHRNGTYDRLAQKYFKYKVY.. 254
199 2.000e-92UniRef50_P0AEN0 L-cystine-binding protein FliY n=1856 Tax=root TaxID=1 RepID=FLIY_ECOL6  ali  28  11...LMGVMAVALVAGMSVKSFAKERGTLLVGLEGTYPPFSFQGDDGKLTGFEVEFAQQLAKHLGVEASLKPTKWDGMLASLDSKRIDVVINQVTISDERKKKYDFSTPYTISGIQALVKKGNGTIKTADDLKGKKVGVGLGTNYEEWLRQNV--QGVDVRTYDDDPTKYQDLRVGRIDAILVDRLAALDLVKKTNDT-------LAVTGEAFSRQESGVALRKGNEDLLKAVNDAIAEMQKDGTLQALSEKWFGADV... 264
200 2.000e-92UniRef50_A0A0A2V8L7 Cystine-binding periplasmic protein n=4 Tax=cellular organisms TaxID=131567 RepID=A0A0A2V8L7_BEABA  ali  28  816......ALMGVMAVALVAGASVKERGTLLVGLEGTYPPFSFQGDDGKLTGFEVEFAEQLAQHLGVKAALKPTKWDGMLASLDSKRIDVVINQVTISDERKKKYDFSTPYTISGIQALVKKGNGGIKTAADLKGKKVGVGLGTNYEQWLRENVP--GVDIRTYDDDPTKYQDLRVGRIDAILVDRLAALDLVKKTNNT-------LAVAGDAFSRQEAGVAVRKGNEDLLKAIDAAIAEMQKDGSLAKLSDKWFGADV... 1070
201 2.000e-92UniRef50_A0A1P8R662 Nickel transporter n=6 Tax=root TaxID=1 RepID=A0A1P8R662_9GAMM  ali  30  1MYRYLGITLLGAALVAGSAQARDSYDHVRFGVDVPYEPMEYRTPDGELTGFDIDLGNALCEQMGITCEWIEQQWDGIIPGLMARNYDAIMSSMTINEERREQVLFSDAYLTVPSAWFAPEESEIDTADEQLDGLTLGVQRGTLQDSYATDFYGD-VANVRRYATADDMLLDMESGRLDLVFVNYPVGKTTLLDSERG-DYRVVGEMIREPEYFGDGIAIAFRPRDEALAERFNTALAELQESGVYDEIHDRYFSE..... 255
202 2.000e-92UniRef50_A0A1I0W709 Amino acid ABC transporter substrate-binding protein, PAAT family n=2 Tax=Clostridium frigidicarnis TaxID=84698 RepID=A0A1I0W709_  ali  30  1MKKKVILALVGVMICGMAGCGSKESKVFKIGLSPDYPPFEYTNDKNEIVGFDIDLSNAIAEKLGAKTEIVTVPFDGIVQGLKSNKFDMVASGFTVTEKRQNEVLFTDNYLNSGQYIVLNTENNDIKTVEDLKGKTIGVGIGTTSADAAKKIEGVK--EVKEYNKTPEGLLDLKNKRIDAVVVDKPVCDYYLDKDKES-------YKKIDANIEEEPIALAFKKEDTQIQQEVNKILKELKEDGTLSKLSEKWFGFDAY.. 262
203 2.000e-92UniRef50_A0A175VDN4 Uncharacterized protein n=4 Tax=Aeromonas TaxID=642 RepID=A0A175VDN4_AEREN  ali  34  1MKR-----ALLLLTGLLFAQSVLAAPVLRIATDGTFPPYSTVNPDGTLAGFDVDIANALCAEMKVTCELRQYDFDGMIAGLKARKFDMIVASMAITEERLRQIAFSDKYQGGYSRFMGPRDTSLNGEPAAMAGKRIGVQLGSIQENYAKDVYGKAGAEVRTYGSAEQAWLDLMAGRLDAIVVEIGVGMEF-KKREGAAGFDFFGPRMNDPAYFGTGSGIAVRKQDARLLGEVNKALGTLLANGTYKQINDKYFDYDQY.. 252
204 2.000e-92UniRef50_E6YM54 Amino acid ABC transporter, periplasmic amino acid-binding protein n=55 Tax=Rhizobiales TaxID=356 RepID=E6YM54_9RHIZ  ali  35  1MK----LLAAAFIISATLFSQFVNAKTLTIATEGSYPPFNYIDSNNKLHGFDIDITHALCKKMKIECVITIQDFDGIILGLLAKKYDAIIASLSPTQERLKKIDFTDAYYSTELAAIVPKDSQIEISVEAFKGKNLGVQLNTTQAIYAENHYASKGVNIKLYPTTKEVIRDLLSNRLDVVILDKLQILDWFKHK--GKDCCHFLGSIEGTEL---PIAIAIRQNNDDLKNQFNKAIKEIRNDGTYDKITKKYFQIDTY.. 250
205 2.000e-92UniRef50_A0A1V4SQJ9 Cystine-binding periplasmic protein n=2 Tax=Ruminiclostridium TaxID=1508657 RepID=A0A1V4SQJ9_CLOHU  ali  32  4MKRILICLSALLIIAFAATACGDTQKVLKVGVDDTYPPMEFKDESNATVGFDIDVATELAKKMGMKAEFISNDWAGIFLALESGKFDVIVSSVSRNEERMEKYSMTTPYIANAQVIVVPAEDTSIKEPKDLAGKNVGVQIGTTADESCAEYLKTTKFTLKQYDQVIQPFSDMKAGRLDAIVVDEVVARYYVKKDPKS-------YKVSSARLTNEPIGVCFAKNSTELRDQAQKALDELFADGTMKKLSEKWFGEDLTG. 264
206 3.000e-92UniRef50_E2QNB6 Cysteine transport protein ABC superfamily n=79 Tax=root TaxID=1 RepID=E2QNB6_ECOLX  ali  28  11...LMGVMAVALVAGMSVKSFAKERGTLLVGLEGTYPPFSFQGDDGKLTGFEVEFAQQLAKHLGVEASLKPTKWDGMLASLDSKRIDVVINQVTISDERKKKYDFSTPYTISGIQALVKKGNGTIKTAADLKGKKVGVGLGTNYEEWLRQNV--QGVDVRTYDDDPTKYQDLRVGRIDAILVDRLAALDLVKKTNDT-------LAVTGEAFSRQESGVALRKGNEDLLKAVNDAIAEMQKDGTLQALSEKWFGADV... 264
207 4.000e-92UniRef50_A0A1X7LWT6 Amino acid ABC transporter substrate-binding protein, PAAT family n=3 Tax=Paraburkholderia TaxID=1822464 RepID=A0A1X7LWT6_9BURK :  ali  42  13MK--ISLMILCAALTFSGGAFAADATTLRLGIDPSYPPMDAKAPDGSFQGFDVDLGNEICRRIHAHCQWVELEFSGMIPALQARKIDAILSSMAITEKREQQILFSSKIFQFKSRLIARQGSPLAANASALAGKQIGVQSGTQFEGYALKNWAPLGANVVAYKSQDEVFADLRNGRLDGALLGSVEADIGFLRTPAGKGFTFVGEPL---SMGDRGVGIGLRKDETAVQASINAAIASMLKDGTYAQIAKKYFDFNPYG. 266
208 4.000e-92UniRef50_V8G928 ABC transporter substrate-binding protein n=1 Tax=Pelistega indica TaxID=1414851 RepID=V8G928_9BURK  ali  37  1MKLKTLFVATTVAMGALLSATAQAE-TLKIGVEAMYPPYEYKDASGKLMGFDVDLADAVCAKMNVTCEWVESSFDGLIPALNARKFDFINSTMNITEQRKKVINFTQPIYQSPSQLVVKSDVNVDLSADSLNNVTVSVLQGSAQETYAKKHWQSKGVKVISYGNQDQAFVDLLNGRVASTFLNTPVAKETFLNKPEAKNFKIVDEFAKDEAILGEGIAFGVRKDDDKLKKRLDEALQALKEEGVISNLTQKYFGGD.... 257
209 4.000e-92UniRef50_A2BKN0 Glutamine-binding periplasmic protein n=7 Tax=Archaea TaxID=2157 RepID=A2BKN0_HYPBU  ali  33  36........................KKILVVGTSPDFPPFEYIAKNGSVVGFDIELIRLVAKKAGYDIEIRTMDFDALIPALEQGQIDVIAAGMTITEERKQRVDFTIPYWQVDQAILVRADSEFPKSVEELSGKTVGVQTGTTAADYLNKIVEEKGINIKEYSSYVLAVNDLIAGRIDAVMVDTPVAKMFEKQYKDKLVISAVIE-------TGEKYGFAVRKGNTELLDKLNKALEDIMNSPTWDELVQKYFG...... 262
210 4.000e-92UniRef50_A0A0C2CG81 ABC-type transporter, periplasmic subunit family 3 n=1 Tax=Burkholderia sp. MR1 TaxID=870478 RepID=A0A0C2CG81_9BURK  ali  44  8.....LIACVLAGLLASTTVIAKEANALRLGIDPGYPPMDVKTPDGHVAGFDVDLGDEICRRIAMHCEWVELEFSGMIPALQARKIDGIMSSMAITDKRMKQIAFSTKLFQFRSRLIAKSGAPLTASADGLRGKRVGVQSGSQFETYALKNWQPGGVEVVAYQSQEGVFNDLIAGRIDAALLGSVEAEHGFLKTPRGAGFAFVGAPL---SMGDHGVGMGMRLDDTALKAKVDKAVADMRADGTYQKIARKYFDFDVYG. 258
211 4.000e-92UniRef50_B0TGZ1 Glutamine abc transporter, glutamine-binding protein n=3 Tax=Heliobacterium modesticaldum TaxID=35701 RepID=B0TGZ1_HELMI  ali  27  1MKKWLMGMLALGMLITAAGCGSSAKKTIKVATDAAYAPFEWKDEKGEIVGFDIDLIKAVGKELNADIELIDTPFDGIIAALTNKNVDMLISAMTITEKRKESIDFSKPYFVAVQAIAVKEGSP-VKKFDDIKGLKVGVQNSTTGQYVVEKLLGEKSDKIFRYDTTPMAMNMLSNGDVDVVVADKPVVQHFLKNNPNAKM-----TLIDDASFEKEEYGIAVRKGETELLKQVNDALDKLEKSGKIKEISEKYL....... 264
212 4.000e-92UniRef50_C7D6U2 Arginine-binding periplasmic protein 1 n=3 Tax=Rhodobacteraceae TaxID=31989 RepID=C7D6U2_9RHOB  ali  35  1MKKTLIGASLAVVAMTTT---AQAQDVLRIATEGAYPPFNNVTSDGELVGFDVDIAKALCVAMDRECEIVAQDWDGIIPGLVNNKYDAIIASMSITEERLEAINFTAPYYSNYLSVLGKEGSDL--TREGLGDVAIGAQRSTVGWQWTEDQFGSR-ADVRLYDTNPAAVSDLEAGRIEAIVMDFLPAAEVLNTTSGLGY-------IDEKIDINDQIGIGIRKGDDELTNAFNAALETIRADGTYEAISDAYFGTDIY.. 245
213 4.000e-92UniRef50_A0A135ZLS0 Arginine ABC transporter substrate-binding protein n=6 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A135ZLS0_9GAMM  ali  37  1MKKIVLA-SLIGLGLGLSSAQAAAQQEIKFVMEATYAPFEYVDANNEIQGFDVDLANALCKEIDVKCSFHNQPFDSLIPALKFRRYDAAISGIDITEQRQQQVSFTDAYYDNAAAFVALKG--KVADQAALEGKRIGVQNGSTHQSYL--IDKMSGVTAVPYASYQDAFIDMQNGRIDSIFGDTAVVAEWFEKND---KLAFVGQPVTNAKYFGNGFGIAINKDNQALVTQLNQALKTVKNNGQYQAIFDKYF....... 245
214 6.000e-92UniRef50_A0A0F3LWG1 ABC transporter substrate-binding protein n=13 Tax=Enterobacterales TaxID=91347 RepID=A0A0F3LWG1_9GAMM  ali  45  14...............GAFSTLSFAEQTLRFGVDPTFPPFESKASDGSLKGFDIDLGNAICAQAKVKCQWVQIGFDGSIPALQAKKFDAILSAMSMTEKRREQVDFSNMLYITPSALLTPKSSTLTEDISTLRGKNIGVAQGTIQETYAKAKWAAQGVNVVSYPNQMEIYPDLVAGRLDGTLANAVSADQGFLNTPEGKDYVIKA-TLVDKELLGNGVGIGLRKGDTVHLKLINDALAELHSNGTYDQLAKKYFKFKVY.. 255
215 7.000e-92UniRef50_A0A1B3NKH3 Bacterial extracellular solute-binding s, 3 family protein n=6 Tax=Rhizobiales TaxID=356 RepID=A0A1B3NKH3_9BRAD  ali  30  1MKRVIAAVLLTAVGASGALAQAKEWKEVRIGTEGAYPPFNNLNAKKELEGFEIDYGNLLCERMKVKCTWVVQDWDGIIPALLSNKYDIIIAGMNATDERKKRVDFTAVYTKTPIWIIGPKTTTSDFSPAALKGKAIGVQGSTIHTNYAEKYYKDS--TIRPYPTQEEANLDLINGRLDYVIADSLALEDFLAGKGKD-CCKKIGEITRDPTIHGPGVGGAVRKEDTALKALFDKAIAETIADGSHKKIADKYFKIPI... 258
216 7.000e-92UniRef50_A0A1X1MXE4 Nickel transporter n=1 Tax=Vibrio sp. qd031 TaxID=1603038 RepID=A0A1X1MXE4_9VIBR  ali  37  1MNKYLSVIFAAATLLSTSVIA----KEVRLASDFTYPPFNYKDSSGKPVGFDIEIADALCAEAQLECVWVSQGWDALIPSLLSRKSDVIMASMRITEDRKKKVLFTNKYYQTPARFVAANDVSDGISVDALKDKVIGVQGGTIHDRYVTDKFGD-VAKIKRYSGQDEVYIDMQNGRLDYTFGNADQLLLAFLEKDQGKGFEFKGEAVTDKEYIGEGTALALRQQDKQLAEKFNLAIQAIRNNGTYDKIASKYFTFDIYG. 254
217 8.000e-92UniRef50_G0VRF9 Putative arginine ABC transporter n=9 Tax=Megasphaera TaxID=906 RepID=G0VRF9_MEGEL  ali  33  31...................GASGEQKTLVVGTEPTFPPFEFT-ENDKYIGFDIDLANAIGEKMGSKVEVKSLGFDALIPALRSGQIDMIASGMDATPERQKQVSFTDPYFHDGYSVVVRKDNTTINGFDDLKGRTVGSQVGTKGVDLATE----AGATVKQYDANSQGWMELQSGTCDAVVINTSVALYYMKEGGD-KDLKIVG----DAKKADAGIAMAVSKDKPELLEKVNKALADLKADGTYAKLYKKWFGID.... 257
218 8.000e-92UniRef50_A0A239TQX5 ABC transporter arginine-binding protein 1 n=15 Tax=Selenomonadaceae TaxID=1843491 RepID=A0A239TQX5_9FIRM  ali  31  1MKKLLLCLAMVFGVMMIAGCGSQNEKPIVIGLDDSYPPMGFKDENNEIVGFDVDLAKEAAKRLNRSVEFKGIDWSSKEAELQSGRVDVLWNGLDITEERKQNMLFSDPYMKNRQV-VFVPVDVEVNSIEDLKGKVIGTQSGSTAETFLDNNYASQFAEVKKYGDYIDSFMDLENGRIDAVVTDELVGTYYMQKHPNA--FKETTIVVGEPT----DFGIAFAKDNTALRDEVQKVMNEMKADGTIAKISEKWFGKDI... 264
219 8.000e-92UniRef50_A0A0X8GRJ9 ABC transporter substrate-binding protein n=6 Tax=Betaproteobacteria TaxID=28216 RepID=A0A0X8GRJ9_9BURK  ali  29  1.......MILLLASASLFTTPVYAAKVYQVATDAAYAPFESVNEKKEIVGFDMDVIKAVALKAGMEVQLHNTPWEGIFATLSSGDRDLVASAVTITPERKLSMDFSDPYFEAKQLIAVAKKSN-ISNFTALKGKKVGVQTGTTGDEIVQKLLGKTSPNIKRFESTPLAIKELQNGGVDAVVADNGVVVNFISNNKASNL-----KTIDDATFAKEFYGFAVKKGNKELLEKLNKGIAAIKADGTYDKIHKKYFG...... 241
220 8.000e-92UniRef50_S0FQL6 Family 3 extracellular solute-binding protein n=2 Tax=Ruminiclostridium TaxID=1508657 RepID=S0FQL6_9FIRM  ali  30  11...LSALLIIALTVTACGSSASKNENVLKVGIDDTYPPMEYKDDSGANTGFDIEVAQALGEKLGMKVEFVPTAWTAIFSALEAEKYDVIISSLSITEERQKTLTYTRPYIANNQVIIVKKDLEGINSEKDLKDKIVCVQMGTTSDESCKEFNKVTPFEYKQYEKMTEALSELKIGRVDALVADLVVAKYFVAKDPDS-------YKIVNTTLPNEPIGAAVKKSNTALAEKLDKAMEEIMNDGTLKKISEKWFGED.... 257
221 9.000e-92UniRef50_V4RHY5 Amino acid ABC transporter, binding protein n=6 Tax=Proteobacteria TaxID=1224 RepID=V4RHY5_9RHIZ  ali  36  1MKKTILAAAAALSLAMAPGAFAQEPLKVGVAAEP-YPPFSSVDSAGNWSGFDIEIGQAICEEMGRECVTTPVAWDGIIPALTSGKIDMIVGSMSITEERQKVIDFSDRYYYTPAAFVAPAPVEVDTDSADLGGLVLGVQSGTTSAAYVRKAYPD--AEIKLYNTQDEVNADLAAGRIDVMLADQAAMVEYVK-TPEGSQFEVKAVAPEDEAF-GEGIGVGLRKEDDDLQADVNDAIAALLESGRYDEIAGQYFEFDIYGG 255
222 1.000e-91UniRef50_A0A1G0HIX0 Uncharacterized protein n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1G0HIX0_9GAMM  ali  34  1MINFKKITVFFILLLQNPLLLAATPSIIRFATEATYPPFEYIDETGQIKGFDIDLAKALCAEMNAQCTFTNQAFNSLIPSLQLGKFDAVIAALGITSEREKQVAFTNAYYEPSASFVAPLDKNY--SISNLTGKTIGVQQGTTFEKYLVDRFQNKVV-MKSYASVQDAFLDLSSERIDLVLADTPIVQEWLKRDDNNKHYAVVEKPIVDRLYFGAGYGIAVRKNDTALQQSLNNALATIKKNGKYQKIMDTYF....... 250
223 1.000e-91UniRef50_A0A162V365 Lysine-ar n=7 Tax=Wohlfahrtiimonas TaxID=582472 RepID=A0A162V365_9GAMM  ali  42  3.KKLLLGLALTSSLAL-------ANEPIKIGIEGSYPPFSYMNPDRSLGGFEPDLANLFCEKAKLKCEIVQVEFDALIPSLNTKKIDAILASMSITDQRKQAINFTNKYYQTPAKFVAPIGEYKEITDDVLKGKSIGVQSGTIHETYANEKFA-KLADVRSYRNLDEAIFDLDSGRIDLVFADSVPLDDGYLRKGYDKSLEFVGPDYNDPEVFGDGIGIGLRKGDDALMEKFNEAILESRKDGSYQKVADQYFSIDVYGA 253
224 1.000e-91UniRef50_A0A1Q4UWE1 Nickel transporter n=27 Tax=Proteobacteria TaxID=1224 RepID=A0A1Q4UWE1_9PROT  ali  40  27.........................EKVVVATEGAYPPFNFIDKDGNLQGFDVDFTKELCKTAGVECEIVAQDWDGIIPGLLAKKYDAIIAQMSITEERKRSIDFTNYYCITPAVFVGKDGMKIEKVMEDLDGMVIGVQRSTTHANFLEDNFP--NAEIRMYDTQDNALLDLTAGRIDATLADSGVLVKWV-ESDAGKGYSFVSDTFAPSEWFGEGVGIGLRKEDQDLKEMFNKALAEMLGNGSYEKLNKKYFP...... 258
225 1.000e-91UniRef50_W8WYY9 Lysine-arginine-ornithine-binding periplasmic protein n=2 Tax=Castellaniella TaxID=359336 RepID=W8WYY9_CASDE  ali  44  25.......................DAKELKIATEAGYPPFEYRNPNGQLEGFDIDIGNELCKRLNRTCVWIDQSFDSLIPGLQARKFDLANSTMTATEARKKVIDFSTPMYIVPVKLMVKKGSGLQPTAESLKGKRVGVQQGTTMETYARKHWAPKGVEVVAYPSYTNAYVDVTAGRLDATFQEAQSAVEGFLNKPEGAGYELADMTL-DDPILNEPIAMGIRKGN-AIKADVDKTLKAMLADGTIQGYAKKYFAE..... 254
226 1.000e-91UniRef50_A0A1W9PHJ4 Basic amino acid ABC transporter substrate-binding protein n=1 Tax=Thermotoga sp. 4484_232 TaxID=1968524 RepID=A0A1W9PHJ4_9THEM :  ali  33  26......................KKRGYLIVGTEATFPPFEFVDEKKEIVGFDIDIAREIAKALGVKLKVEDIAFDGLIPSLLTKKIDLIAAAMTITPERAKVVSFSDPYFTAGQVIVVRKDSFMPKTFEELVGKKVAVQLGTTGDLEVSKV---EGIEVVRFTRYTEAFLELQNGRVDAVVLDFAPAQAYVKMNP--------GLVISSGILSQEEYGIAVRKEDKDLLEVVNTVLRNLKKSP-YDILVEKWF....... 245
227 1.000e-91UniRef50_UPI000B437818 amino acid ABC transporter substrate-binding protein n=1 Tax=Bacillus sp. EAC TaxID=1978338 RepID=UPI000B437818  ali  29  3.RKFMTALIMCMISILIVSGCGKEKNEVVIGLDDTFVPMGFKDDKGNFVGFDIDLAKEVFKREKIKVTFQPIDWSMKETELISGNIDAIWNGYSITKDRQKKVDFTNPYLKNRQVIITLANSK-IKSKNDLKGKNVGIQDGSSSLDAVNKEKSFNGKKPVLYENNNQALMDLESKRVDAVVADETLAKYYMNKRGQSK------YKISNDNFGEEEYGIGVRKDDNALQNKINKQIDSMKQDGTYDKIYQKWFGT..... 256
228 2.000e-91UniRef50_A0A2N3PVD3 Amino acid ABC transporter substrate-binding protein n=19 Tax=Proteobacteria TaxID=1224 RepID=A0A2N3PVD3_9PROT  ali  38  1MKKIGLFCALAML---GMATAAHAATKVRIATEADYAPFEYKDADGVLKGFEIELGTKMCAAAKLDCEWVNMDFDAEIAALNAGKVDAILSQMSVTDERKKSVDFGDLLTIAPVSLVAKKGAAIGADAASLKGKTVGVQSGTTHETFMKKRLPS--VAIKVYQSQEEAYLDLEAGRIDATLADKTIEWDWLQKTGKAEGFDYVGKDIDDVEIFGTGTAIAFRKGDAALRAKFNEALVQVLKDGTYKAINDKYFPFPING. 254
229 2.000e-91UniRef50_A0A1G9V2Q9 Polar amino acid transport system substrate-binding protein n=2 Tax=Megasphaera paucivorans TaxID=349095 RepID=A0A1G9V2Q9_9FIRM :  ali  28  6.KTALAGMIAVTAAILIAGCGSQSQKKIVIGLDDNFPPMGFRDESGKLIGFDIDLANEAAKRMGVKVEFKPIDWDSKEAALKSKKVDMLWNGLTITDSRKKQIAFSKPYMKNAQILIVRADS-SIQTKDDLKGKVIGTQEGSSSVDALDKDQGFKNSDVKLYGDFVAALMDLEVGRTDGVLVDSVVGRYYMTKKEGK-------FRVLAGSMGDEEFGVGMRQDDTVLVNKLNSVLKEMSADGTMKKLSEKWFKTDI... 263
230 2.000e-91UniRef50_K9QBB9 Polar amino acid ABC transporter, inner membrane subunit n=16 Tax=Cyanobacteria TaxID=1117 RepID=K9QBB9_9NOSO  ali  26  11..RWLLVVGLSCALLTGCSVNDSTSKTLRIATEPAFPPFEFQDAGGKLQGFSYDLMNAIAVAANFKVSFQSIPFDGIIPAVQAKTIDAAISSITITKERAQTVDFSRPYFKAGLAIAVRNNNQDITSLDSLKNKKLAVQIGTTGAEKAKSI---PGVQIRSFDSAPLALQELLNGNVDAVINDAPVTLYAINTGN------LQGIKIIQQLLTEEYYGIATAKNSPHLT-LINDGLDRVLKNGEYFQIYKKWFK...... 252
231 3.000e-91UniRef50_S5S381 Histidine ABC transporter substrate-binding protein HisJ n=309 Tax=Proteobacteria TaxID=1224 RepID=S5S381_RHIET  ali  38  1MKLLPTLFAGVAFALSAVAAQA----EVRFGMNESYPPFFAKNASGEWQGWEIDLMNAVCEEMKEKCSIVEISWDGLIPALQSKKFDVIWSSMSNTAERSKVIDFTDKYYNTPSTLIGPKDQKPGATAEDVKGKTIGIQVSTIQSEYYKKYFAEA-ADEKTYQTLDEAFQDLASGRIDYVFGDSLALDAFLKSDGGKDCCAKMGDVADDKEVLGAGVSGGLRKEDTELKAKLNAAIAAVRANGQYDAITKKYFDFDIYGA 256
232 3.000e-91UniRef50_E3HAX7 Amino acid ABC transporter substrate-binding protein, PAAT family n=2 Tax=Bacteria TaxID=2 RepID=E3HAX7_ILYPC  ali  30  1MKKFLNILLILVMLVSLAACGGKEKTVIHIGTNAEFPPFEYL-EDGKITGFDMDLIKEIAKESQLEIKIEDMSFDGLLPALQSKKVDVVIAGMTANEERKKAVNFTSPYYTASQVIVVKEGDSSINSFDDLKGKKVGVMLGFTGDLVVSEI---EGVNIERYNAAYAGIMSLQSGKVDAVVLDSEPAKNYVEKNE--------GLAIAKADAAEEEYAIAVRKEDKELLLKLENGLKTVKDNGTYEELLKKYF....... 244
233 4.000e-91UniRef50_UPI0008069F4D amino acid ABC transporter n=1 Tax=Epibacterium mobile TaxID=379347 RepID=UPI0008069F4D  ali  33  1MKKQSIIAAAMLL---STAQMALAEDKLRIATEGAYPPFNNVTADGGLVGFDVEIAQALCDKIKRDCEIVAQDWDGIIPGLVNNKYDAIVASMSITTERLQAIDFTDPYYKNYLSVVAKDGAEV--SMDNLGRQTIGAQRSTIGSQWAEDNYGRRG-DINLYDTIPAAFADLQAGRIDVVVTDFLPAADWI---EDNAGYGLAIEKID----IGDKIGIGLRKKEDSLKGKLNAALKEIRADGTYQKISEKFFGTDIY.. 245
234 4.000e-91UniRef50_A0A0T6YI64 Uncharacterized protein n=17 Tax=Rhizobiales TaxID=356 RepID=A0A0T6YI64_9RHIZ  ali  32  1MKKKFMTASVIAALFAAGTANA---ETLAIGTEGDYAPFNYVTAAGEIKGFDYDIGQAVCAEIKVDCVWSTNEWAGIIPALQAKKFDVMIASMAINPDRKTQVDFTTPYYFNAMRFVARKDLGLDISPEALKGKVIGTQSGSVAVEALQEFFPDS--EVKLYPTMSEVFLDMENGRLDLILEGQMAFTEWLAKEESG-CCAFVGESFVLD--TAEGNAMAVRKGDEALLSKLNAGLKTIMENGTYDKIRKQYFDFDI... 250
235 4.000e-91UniRef50_G9QH93 Uncharacterized protein n=27 Tax=Bacillaceae TaxID=186817 RepID=G9QH93_9BACI  ali  25  10...LFLAVCFVFLLAACGSNQGKSDKTLKVGTNAAFAPFEYM-EKGKVTGFDIDLIHAVAKEAGYQVDVQHEGWDSMLANLENKQSDLAISGITINDDRKKTYDFSRPYFEAANVIVVKKGSNVKNAL-DLKGKKVGVQNGTTGQDAAEKILGKNSQNVKKYEDVTVAFMALKNKEVDAVVIDNVVANEYVKNHPKENLKVITDRK----NFESEFYGIAFPKG-SELTPKFDQALDKVMENGTYEKLYKKWFGK..... 259
236 4.000e-91UniRef50_A0A011TF87 Amino acid ABC transporter n=12 Tax=Proteobacteria TaxID=1224 RepID=A0A011TF87_9RHIZ  ali  34  1MK---TALFAALSILLAGGAARADDPPLRMGVEGAYAPFNAVGSDGKVHGFDIDFGEELCKRLQRRCEWIVVQWDGLIPALQAGKFDVLMSSVTMTPERHQQVRFSKPYYFSYGLMVAQKGSGLQFTPGSLEGRAIGVQASTTHEHWLRERFG-TAISIHAYSSSDDMFLDFQNGRLDAVFAESVAMFPWMERNGGMDAYEQIGPNITDPALGTE-MGIAVAKGNDPLGEAIDRLIDEIVADGTFRKIERTYF....... 248
237 4.000e-91UniRef50_A0A292YMF5 Basic amino acid ABC transporter substrate-binding protein n=6 Tax=Bacteria TaxID=2 RepID=A0A292YMF5_9BACL  ali  28  38...............GGTSTPAPQVKEYIVGTDAAYAPFESENDKKEIVGFDIELLTAVAEKGGFKVKFVNTPWEGIFTSLKNGDRDILISAITITEERKKEMDFSEPYFEAKQLIAVPKDSKIAK-FEDLKGKKVGVQTGTTGDDVVSKLLGKDSKDIKRFESTPLALKEMVNGGVEAVVADNGVVINYVKNNSDKGF-----KTVEDASFEKEFYGIAVKKGNKEVLDKINAGLKKVKEDGTYQKIYDKYFGK..... 271
238 5.000e-91UniRef50_K9XCJ0 Polar amino acid ABC transporter, inner membrane subunit n=103 Tax=Cyanobacteria TaxID=1117 RepID=K9XCJ0_9CHRO  ali  22  11...RLSVVVGLCCLLLFAGCQNAAGRTLTVAVEGTYPPFEFQSPDGELQGFDVDLMNAIAQEEGFTIQYQNLPFAGMIPALQARTIDAAIAAMTITEERAKTVSFSRPYFKSGLAIATSANNQDITSFESLQNRRIAVQIGTTGALEAAKV---PGAQVRSFDDAPTTLRELLNGNVDAVLHDQPVILYAIQTGN------VQGVRVVGDLLTEEYFGIPTPKGSPNL-ALINQGLTTLLENGTYNQIYQKWFGV..... 257
239 5.000e-91UniRef50_E8UFJ0 Lysine-arginine-ornithine-binding periplasmic protein n=12 Tax=Alcaligenaceae TaxID=506 RepID=E8UFJ0_TAYEM  ali  42  1MRSLLLTAGLVLGLASVV--QAKDFTELRIGTETGYVPFEYKNEKGELIGFDIEVGNAICEKLKAKCTWVEQPFDALIPGLQARKFDIIHASITHNEAREKVIDFTDDVYAIPTQLIAKKGSG-IATEDDLKGKRLGALQGSAQEAYARRVISKKDVKVVSYKEQPQTFIDLKAGRIDAAIVEKPNANSAFIATPEGADYEFVGQPLEHE-LLNNRISIGIRKGDKDLKEALDKAISELRDEGKIAEIAKKYFKE..... 251
240 6.000e-91UniRef50_N2JEC2 Lysine-arginine-ornithine-binding periplasmic protein n=5 Tax=Pseudomonadaceae TaxID=135621 RepID=N2JEC2_9PSED  ali  32  1MKRLKRVISLMTGLSLCGTALAAD--VLKVGVQGSLPPFSSVSGNGKLTGFDVDIAQALCAELKVQCQFVITSWDRMLPSLNARKFDAIISSMSITPEREQLVSFTIPYYMNSIQFIAPRDKPFSTDPRGLKGKVIGAGRATLSADWLSNHLG-GQVNMRFYDSQEEANQALADGRVDAVLGDR-FAHYAWLQTPEGQRFELKGEPV----LQKDRIAIAVRKNDP-LKARLDEALKGILANGTYQQINARYFPFSLY.. 250
241 6.000e-91UniRef50_A0A1V5RYC4 Periplasmic dipeptide transport protein n=2 Tax=unclassified Chloroflexi (miscellaneous) TaxID=189774 RepID=A0A1V5RYC4_9CHLR  ali  27  58......................AAAKTFTVASDASFPPMEFVDENKMLTGFDIDLINAIAADQGFTVEIQNTAWDGIFAGLEAGQYEAIISSVTITEERQAAMDFSDPYFDANQAIIVLADDTAIAGEADLQGKTIGVQIETTGAIAVREL----GIDPKQYDSPDLALQDLVNGNIDAVVVDTPVAADYALQSPQFKGK----LKIVGELQTNEAYGLVVRKGDPDLLPLFNAGLAHIKASGKYDAIYEKWIG...... 282
242 7.000e-91UniRef50_D6GQB3 Amino acid ABC transporter, amino acid-binding protein n=1 Tax=Filifactor alocis (strain ATCC 35896 / D40 B5) TaxID=546269 RepID=D6GQ  ali  33  4.KNIVLFLVGILFLFSLCSCSNKQPSQYVIGLDDTFAPMGFRDSSGELVGFDIDLAKEIARRKNFTVTFQSIDWAMKENELNAKNIDMIWNGYSISEERKQKVAFSTPYVEDKQLVITMKDSP-ITTIEDLKGKVISLQAESTAIDAVNQNPSTSLAKIVEYPSNNEVFQDLQTGRCDAIVVDEILARYYMKQN------ASQEFRILEEALATEYMAVGIRKEDTELLQAINDGLEELKADGTYDDIRQRWF....... 258
243 8.000e-91UniRef50_Q3AES2 Glutamine ABC transporter, glutamine-binding protein n=10 Tax=Firmicutes TaxID=1239 RepID=Q3AES2_CARHZ  ali  25  46...........................IVVASDTSYAPFEFQDPSGKYVGFDMDLIQAIGEAVGFEVEIKSMNFDGVLTSVQSGTVDAAISAISITDKRKEVMNFSEPYYDSGLAIVVKGDNNTIKGIDDLKGKRVAVQIATTGADYANELKAKGIVEVKTFNTLPDALMELRNNGVDAVINDWPVNAYYIKQS-------FSDLKMVGDKLTGESYGIAVPKSKPEILAKINEGLKKVKESGKYAEIYEKWFGE..... 268
244 8.000e-91UniRef50_B5EGD9 Amino acid ABC transporter, periplasmic amino acid-binding protein n=13 Tax=Deltaproteobacteria TaxID=28221 RepID=B5EGD9_GEOBB  ali  29  31......................KKEGTLTIGLDDAFPPMGYRNDKGELVGFDIDAAEEVGKRLGIKIKWQPTAWDGVMHALNSKKFDCIWNGMTITDERKKEVAFTKPYKMDGQVAVVRFGEKKFKKLADLKGAKVGVQKGSSAVEAVKK-LPAAPAEVREYEDNPKALLDLESKRLDTVVIDDATGRDFIAKRPGK-------FQIIPGNITKEPFGVAFRKDDVELREAVQKTLDKMVKDGTMAKISKKWFGEDI... 257
245 8.000e-91UniRef50_G8NCC1 Amino acid ABC transporter, periplasmic amino acid-binding protein n=175 Tax=Bacteria TaxID=2 RepID=G8NCC1_9DEIN  ali  32  1MKKWLLFLSLLALPLGLAQVQVQRAGEIRIGTEGAFPPFNYFDAKNQLTGFEIDLGNALAKKLGLKATWITQAFDTLLIQLNQGRFDFVIASHGITEERAKAVDFTNPHYCTGGVIVAKKGGP--KTAKDLQGKVVGVQLGTTYMEAAQKIPGVKG--VRTYQKDPDALQDLLAGRLDAWITDRFVAKEAIKER------KLEGTLQLGELVFQEKVAMAVAKGNKSVLEALNRALADLMKDGTYAQVSKKWFGEDV... 251
246 9.000e-91UniRef50_C3MAM0 Putative extracellular solute-binding protein, family 3 n=139 Tax=Bacteria TaxID=2 RepID=C3MAM0_SINFN  ali  30  53MKLLPTLFAAALVQLAAFAPAEKSAGVLKIGTEGTYAPFTYHDANGALVGFDVEIGEAVAKRLGVKAEFLEGKWDGLIAGLDANRYDTVINQVGITEERKKKYDFSEPYIASKAVLIVKGDNEEIKDFADLKGKKSAQSLTSNFGKLAEA----SGAELVGTDGFDQSIQLVLTGRADATINDSLSFLDFKKQKPN------ANVRIAAEKPDADYSGIILRKDEPELLAAINKALAEIKADGTYEKISQKYFGADVS.. 308
247 9.000e-91UniRef50_A0A1S2CHI0 Nickel transporter n=5 Tax=root TaxID=1 RepID=A0A1S2CHI0_9ALTE  ali  35  1MKKLMIAASCALAFMAGSSIGSSDPRSLRIAFDVPYEPFEYKDENGELTGFEVELAEAMCDQMNATCKFVIQAWDGMIPGLLARKFDLIMSSMSITEERAKRVLFSEPYYITPGGWFGPEDNTDVTDMDAMNGKTVGVQRGTTMDTFVTEKMGN-VVSIKRYTTADDMVLDLEGQRLDVVFVDYPVGEQTVLSKDG---FKEVGESVK----LGEGVGVAMRKRDADIAREVNSALRTLKEDGTYDTIMQKYFAYDV... 256
248 9.000e-91UniRef50_A0A0K2SH63 Amino acid ABC transporter substrate-binding protein n=3 Tax=Bacteria TaxID=2 RepID=A0A0K2SH63_9FIRM  ali  27  27.........................EKVVVGTDTAFVPFEFF-QDGTYVGFDIDLIHAIAQEAGFEVQLMPMNFQGIIPGLQARSLDLAIAGITITEERAQVVDFSDPYYDAGQIIAVRAGDASIQGPEDLKGRRVAAKIGTTGARTAVELVGE--ANVKQFDNNADTYQELVNGGVDAVINDLPSTLYYIQTEGRGR------VKTVGDLLTGEQYGIAAPKGSP-LIPRINEALARLRENGTYDRLYQKWFGT..... 246
249 1.000e-90UniRef50_A0A1C6DUH0 Glutamine-binding periplasmic protein n=52 Tax=Firmicutes TaxID=1239 RepID=A0A1C6DUH0_9FIRM  ali  28  5.KKWITAALLVTTAAALTGCGSSEDKPLIVGTEPSFPPFEMT-ENDTYVGFDIDLANAIGEKLGRKVEIKTMGFDALIPALKSGQIDLIASAMSATEERKKQVDFTDPYYIGGSVIVVRKDNTDIRGWDDITGKTVAVQAGSKPADFAEK----QGALLKQFDANYQCLQELQVGASEAAALDKAVALYYISKGG------LSDLKVVGEPKKLAGSAMAINKGNEKELKEINAALQAMKKDGTYTKLYQKWFGV..... 253
250 2.000e-90UniRef50_A0A1I0W4Z6 Amino acid ABC transporter substrate-binding protein, PAAT family (TC 3.A.1.3.-) n=15 Tax=Bacteria TaxID=2 RepID=A0A1I0W4Z6_9BACI  ali  24  7.KFISVFLILFGLISLLAACGSGGNDTYTVATDSSFVPFEF-EEDGEYVGFDIDLINAIADEAGFDIELEVTNFDGIIPGLQTGSFDIAIAGISITEERAEKIDYSDPYYESGLAIGVPSDNNDIQDLEDLEGKTIATRLGSTSAAFIDEN--IENADPSQFEQLDQAYLAVENGSADAILYDAPNVNYYIQTTGD-------ELKVVGDLYQAEDYGIAISKGQEELVSAINDALAELKENGTYDEIYEEWFGE..... 261
251 2.000e-90UniRef50_UPI0009F215A7 basic amino acid ABC transporter substrate-binding protein n=2 Tax=Colibacter massiliensis TaxID=1852379 RepID=UPI0009F215A7 :  ali  30  2MKKILLATCAVTLSLLAAGCGADKQKTLIVGTEPTFPPFEFT-ENEKDVGFDIDLAQAICDKLGYKMEVKNLGFDALIPALQSGQIDLIAAGMDATPERAEQVNFTDVYFKGGYTVVVRKDNTDITGFDSLSGKTVGAQVGSKPVEVAQEH----GATVKQYDTNTQGWMELEAGTCDAVVIDKAVAMYYLEQGGKEK------LKLVGNSTDSRGTAMATSKDKGELTQAINKALSELKADGTYAKIYKKWFGT..... 259
252 2.000e-90UniRef50_A0A1Z5HV33 Uncharacterized protein n=5 Tax=Clostridia TaxID=186801 RepID=A0A1Z5HV33_9THEO  ali  24  48...................GGEKEVAILKVGTEAAYAPFEYVDEKGEITGFDAELIKAIAEAIGMEAELQHIDWDGLYPALNSGEVDVVISAMTITPEREEEVDFSEPYFEVVQAIAVKEGSE-IRSLADLVGKRVGVQANTTGHYAVEQIEGMKEDDISTYPTTPDALMALETGEVEAVVADDPVVANFIKHNPDAGIVM-----IEDPTVEPEFYGIALKEGNP-LREKINEGLKKVKESGKYDEIYAKYFGK..... 277
253 2.000e-90UniRef50_A0A1W2EKV5 Amino acid ABC transporter substrate-binding protein, PAAT family n=2 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1W2EKV5_9DELT  ali  28  1MKKITALLLSLMMMCCFAATGFA--KKITVATDTNFPPFEFKDPKGEHTGFDVELWDAIAKEVGIEYDLQPMDFNGIIPGLQSGQIDVGIAGMGIKPERAKVIDFSEPYYKAGLLLLVKSSTNDIAGIEDLEGKLVATKLGTTSESFLKENAKAK--EIKLYPNNDAMFMELMMGGVDAVMFDSPVIAHYMREVGKEK-VKVVGPLYGLDAATGSFYGIGFPKGSP-LVIKVNAALKSLKESGAYRDLYIKWFNT..... 250
254 2.000e-90UniRef50_A0A239YWT8 Glutamine-binding periplasmic protein n=40 Tax=root TaxID=1 RepID=A0A239YWT8_9FIRM  ali  29  7.KKLILMLIMAGAVVGGCGSTADTSNKLIVGTNATFVPFEFKDEKTQYTGFDIELIRAIGKRINKDVELKNVAFDALIPALNTHDIDVAASGMTITKARSEKVLFSSPYYENALA-VVFKDGQNINSLDDLKGKKIAAQLGTTGSDLAHKI---EGTTVKEFDHSNEALLELQNGGADATVIDLPVAQYYTTKHPDQQIKYMAYPN------TKEYLGIAINKDNKALQEQINKAIEEMKADGEFNALYKKWFNVD.... 255
255 2.000e-90UniRef50_C7NA74 Extracellular solute-binding protein family 3 n=15 Tax=Leptotrichiaceae TaxID=1129771 RepID=C7NA74_LEPBD  ali  30  1MKKMLLLMILALSVFMCSVQKEEKPKKIVVGLDDSFVPMGFKNEKGEIVGFDIDLARAVAQKLGAEVEFKPINWDSKILDLNGGNIDLIWNGLTITEERKKETEMTKPYFTSHQLIVVKAGS-SINAKADLAGKNIGSQTESSGEEAVKKSGDDKKFEFKTYAQYDQAFMDLDAGRVDAIIADEVLAKYTKKTKETQAKKEL--YKILNDNYGEEEYGIAAKKGNIKLVEAINKAIEELKADGTYQKIYSKWFK...... 261
256 3.000e-90UniRef50_A0A1H1J2Y9 Amino acid ABC transporter substrate-binding protein, PAAT family n=2 Tax=Rhizobiales TaxID=356 RepID=A0A1H1J2Y9_9RHIZ  ali  35  1MISRRLALIRAFAVGATLTAQANARD-LRIATEGTYAPWSYVDSSGKLTGWDVDIANALCDVMKVKCEIIAQEWDGIIPGLNAKKYDLIVASMGVTEKRKQQVAFTKKYKETSSQFVAKKGTITATSPDALTGKRIGVQRGSIQDAFLTQLYTKS--DLVRYDKTTDAELDLLADRIDLLLANRVTSLLGFLTRPEAANYGLVGEEYKGGIL-GDGNAIALRKDDIELLAQVNAAIDTLIANGTYDKITAKYFKF..... 251
257 3.000e-90UniRef50_U7V903 ABC transporter, substrate-binding protein, family 3 n=6 Tax=Fusobacteriaceae TaxID=203492 RepID=U7V903_9FUSO  ali  31  1MKKIFKLLLLTFTIFSISFAKDQEKGEMVIGLDDTFAPMGFRDEKGNIIGFDIDLANEVASRMGVKAVFKPCEWDGIIFDLRSKKIDLIWNGLTITPQREQQIAFSTPYFDDDQIVIVR--NHNIKSFEDLKGKNIGVQLGSASYFAFENSLAKTTGKVNKYSTNVEALLDLEAGRTDAVVIDAVVGKYYVAKKD--------GFVVLNEILDKQQMGIGMRKQDLSLKNKIDETLANMKADGSFNKIYQKWFGNN.... 253
258 3.000e-90UniRef50_X5ZNY6 ABC transporter substrate-binding protein n=11 Tax=Phyllobacteriaceae TaxID=69277 RepID=X5ZNY6_9RHIZ  ali  36  1MKRLMTGAVFAAVCSVNSAYAQQA---LKIGTEGAFPPFNFVDANGEPQGFEVDLGHAICKAAKLTCTFTAIAFDGLIPALKAKKIDAIIASMNITDERKKVISFVGPYYVDPPRFVGKSGSPADVTPAGLKGRTIGVASGTISESYVRDVAGTT-AKITSYPSLDNALLDLSADRVELVLDNAIALSEGFLKKPEGKGFEFIGPALSDTKHFGIGPGIGIRQNDKATASALATGLKAVQDSGEFTTLSQKYFGMDIS.. 254
259 3.000e-90UniRef50_A0A0B7MEL7 Glutamine transporter subunit periplasmic binding component of ABC superfamily n=3 Tax=Clostridia TaxID=186801 RepID=A0A0B7MEL7_9  ali  23  1MRKLLIVMLIGLFGAFGVGCSSKEKPKYTVAFEATFAPLEFRDEKGEFTGFDIELIKAIGEVEGFDVELKDMGFDGIVSSVKTGNIDIGASGLTIDEDRLESVDFSTPYYKAGLSVVVRANEDKIKSVKDLKGKKIAVQIGTTGSKYAKTI---EGANVTDFDQVTDALMEVKNGGADALVNDNPVNQYYVSKSKKD-------YKIVGDILESEYYGIAVKKGNTKLLEKINNGLKKLKESGEYAKLYKKWFGE..... 264
260 3.000e-90UniRef50_A0A2T0LA66 Amino acid ABC transporter substrate-binding protein (PAAT family) n=1 Tax=Planifilum fimeticola TaxID=201975 RepID=A0A2T0LA66_9B  ali  30  78..KIFAIGLLFSALWALTACSDKERGEIRIGTEGTYKPFSFRDEKNELTGYDVDVAREVAKRLGVKASFVETPWDAMMTGLKTGRFDTVANQVGITEERKKTFDFSDPYTISYAQIVVHEDNDTIKGIEDLKGKRAGQTPTSNYGKMAKE----AGAEIVAYEDMMSSMRDLAAKRVDASINDRLAIAEMMKAVD-------LPLKTVGEPFEKSEMAFPVPKGNEDLVREINKALEAMRRDGTLSKISRKWFGEDVF.. 340
261 4.000e-90UniRef50_A4XR99 Amino acid ABC transporter substrate-binding protein, PAAT family n=23 Tax=Proteobacteria TaxID=1224 RepID=A4XR99_PSEMY  ali  35  1MLRMLLCLFAVLL------AQPGTAGPLRVAMEGQFPPFEELDAQGNLVGFNVDIANALCQRMQRECELQRFAWDDLIPALDAGRADLILASMSITAARAERVDFTARYAQTPAFFFARKGNQMLITPRRIAGKRVGVQQGTTYERFLEARFAEH-VQLLRYPSAAQAYRALAGGELDLVLDDAVSGYFGFLLTELGRDFEQVGGPVVAPQFFGQGQGIAVRKGDDELREQLDRALAAILADGTHKRIEKRYFKFSVY.. 254
262 4.000e-90UniRef50_A0A198X9B7 Amino acid ABC transporter, periplasmic amino acid-binding protein n=25 Tax=Moraxellaceae TaxID=468 RepID=A0A198X9B7_MORCA  ali  25  1MKKIFGLIAAIVGTFSLSACSGQNEDTLRIATEGTYAPFNYTNPDSSLGGFDVDIANALCNKMQTKCQIIAQDWDGIIPALKTGKFDAIVAAMSVTPERSEQVDFSEPYFVNSLVFLAKKGSNFDTSTDAINNAKIVAQRSTISSQWLTQTYPNSKPQL--YDTLDNAFIDLGNERADAMISDKLPALTWL-SSDLGQNFEIKG----GDIDINDKVSIAVNKGNTELLQKFNEALAAIKADGTYKQIVIKHFGE..... 257
263 4.000e-90UniRef50_A0A2A8ICJ5 Amino acid ABC transporter substrate-binding protein n=8 Tax=Bacilli TaxID=91061 RepID=A0A2A8ICJ5_9BACI  ali  30  1MKKVIQICIILAVALMATACGTKKQGVLKIAVDDTFPPMEYRNEQNKLVGFDIDLANVLSKELGVKVEFIPTAWDGILPGLDAKRYDMIMSSMNITDERKKKVDFVE-YMKLGQVVAVKTGNPKIQSKEDLSGKIVGVQLGSTSESAAKEIKGVK--ELKTYNGYTDVFNDLGLGRLQGVIVAEAVGRYYKTTKPDA-------FDVVGGTFQSLPVGIAVRKGDHELEAALQKAIVTVKDNGTYTEVSKKWFGTD.... 272
264 5.000e-90UniRef50_UPI00098FEB1B hypothetical protein n=1 Tax=Rappaport israeli TaxID=1839807 RepID=UPI00098FEB1B  ali  40  1.........MVLGFIGISSAWAEQGQTLRIGIEGEYPPFSAVNEQGELYGFDVEIAKALCVQMQKDCTLVQISWDAMIPSLKTNKIDAIVASMSATDERRQSVDFTDKYYSSYGKL-VLKDSNSDNWQEKLQSITLGVQRATIHDRFASEKLKNIVGEIRQYNTQDEVNLDLISGRIDATLADTIALITGFLETDMGKGYAFAEPVFDDPAYYGEGVSIVIRKNEEALKQAFNQAIQEIRANGVYQTINDKYFNVDIY.. 253
265 6.000e-90UniRef50_K1K0B9 Uncharacterized protein n=8 Tax=Bacteria TaxID=2 RepID=K1K0B9_9BURK  ali  29  2MFKKVFAAAASALAIAAFAGNAMARDTLRVGTEPTFAPFEFLDTKQEFSGFDIDLIKAVADKAGYDVKVMNMGFDALIPALSAGTIDVIASGISITEERQKKVDFTSPYYQSGLSYLVRKDAEKIKTFADLKGKTLAVQIGTTGAAYAKNV---EGARVSAFNTTSEAFMDLNVKNADAVVLDRPVLAYFLKTKPRVAKNLQLSTEIAD----AEHFGFAVKKGNAELLQKLNAALEELKKSGEFAKIEDKWF....... 249
266 6.000e-90UniRef50_G8AX92 Octopine ABC transporter, substrate-binding protein n=18 Tax=Rhodospirillaceae TaxID=41295 RepID=G8AX92_AZOBR  ali  35  1MKRLALGLAMGLCALAAATASRADGPPLRIATEGAYPPFNMTSPDGTLGGLEVELANALCERIKRRCTLVAQDWDGIIPGLLSRRYDAIMATMNITPERAKAIAFSAPYMVVPAYFVAATGGGIDGTEATLAGKSVGAQTSTTHYRYVEKHFGKT-VSLKNYDTASNLLADLKSGRIDAAITTGATASDWVKA-DASKSLQLVGKPLVDAEVFGPGVGVGLRKEDADLKAAFDAAIASVVQDGTLARIAAKYVDFTV... 257
267 6.000e-90UniRef50_A0A194AKG7 Amino acid ABC transporter substrate-binding protein n=16 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A194AKG7_9DELT  ali  26  1MKPLLKMLVPLFVLALVGTASAADDGELRIGLDDDFPPMAFRKADGKLYGFDIDFAEAVGKKLGLKITWVPTAWKGVIPSLYANKFDCIWNGMTITKEREEKVNFSKPYMMDGQVAAVVMSNTSIKTPADLGGKVVGIQQGSTAMKAIEALPNKPG-QLKQYETNPKAMLDMESGRLDCVVLDNLVARDIISKKPGV-------YKILPQFITKAPFGVAFRKADNSLRNKIQETIDELVASGEAAKISRKWFAEDL... 257
268 6.000e-90UniRef50_B6IV00 Histidine-binding periplasmic protein n=3 Tax=Rhodospirillaceae TaxID=41295 RepID=B6IV00_RHOCS  ali  38  34........................PDPLRIATEGAYPPYNMTDAAGNLTGFDVDVAREVCARIKVECRIVAQNWDGIIPGLQTGKYDAIAAGMSITEEREKVVAFTQGYATTPAYFVALNDSPLLTDLDELKGRTVGVQSATIHANFLDEYLADT-VSVRRYDTQENLALDLAAGRIDAGLAD-ASAWEAFLDSPEGRNASFFGPGF-DGGLFGRGMGIAIRQNEPALLDALNGALASMQQDGTLKRLSEQWFGFDAS.. 287
269 6.000e-90UniRef50_A9ILH3 Glutamine-binding periplasmic protein n=17 Tax=Bacteria TaxID=2 RepID=A9ILH3_BORPD  ali  27  3.KRRIAAALVGLSLIGAVSTAAAQDKELIVATDTAFVPFEFKQGS-TYTGFDIDLWAAIAKELNLKYKLQPMDFNGIIPGLQTKNIDVALAGITIRDDRKQVIDFSDPYYESGLAILVAANEDAIKSAKDLAGKSVAVKTGTATVDFMKKEVPE--AKLRLFPNIDNAYLELATGRVDAAVHDTPNVQYYANTAGKGR------VKVVGTVKSGDFYGIAFPKG-SDLVAKVNQALATLKSNGQYDAIYTKWFGK..... 246
270 6.000e-90UniRef50_A0A239DHV9 Amino acid ABC transporter substrate-binding protein, PAAT family n=2 Tax=Rhodospirillaceae TaxID=41295 RepID=A0A239DHV9_9PROT :_  ali  34  1MKSWIAALGLA-CVTLLGGCGKEEPNPLRVATEGAYPPYNMVDASGNLVGFEIDMMKDICRRMKVECQFVATAWDGMIPALQAGRFDVVVAGMSITEERLQAVDFSDGYTTTPAYLVSANSNPLQKSPESLKGKVMGVQTATIHANFAEKYLGD-VVDLRRYDTQEQLALDMQSGRIEVGLADAVTWNAFL-QRPEGKDYSFFGPGF-DGGLFGRGQGVALVKGRTALKTALNSAIKEMKADGTMKTMSVQWFGFDTS.. 290
271 7.000e-90UniRef50_G2IYJ9 Amino acid ABC transporter, periplasmic amino acid-binding protein n=9 Tax=Chromobacteriaceae TaxID=1499392 RepID=G2IYJ9_PSEUL  ali  35  4.KKVLTLTLLCALPWL------AQAQTVRIVTDASYPPFSKMNPDGSITGFDPDITRALCAEAKLECELKAMDFDGIIPALQAKKFDVAIASMSITPERAKVVDFSDMYFKIPGRLMAREGTQI--NDAWFKGKKIGVLRSSTQMQEANAKWAPKGSQIKVYSKITDAFLDLTGQRLDAVYLDATIGESDFLQKPMGKGFAFVGPVYNDPKYY-MGAAMAVGKGNKELRAKLNAALKQILGNGTYKQIQAKYFSYDIY.. 251
272 8.000e-90UniRef50_A0A1H0J8V7 Amino acid ABC transporter substrate-binding protein, PAAT family n=7 Tax=Proteobacteria TaxID=1224 RepID=A0A1H0J8V7_9GAMM  ali  28  1MKKHSVLASALALGTGLAGAALAQTPTVNVVTDPSFVPFEMMDETGEMVGFDMDIINELAERAGFEVNLTTMEFNGIIPAVQTGSQEIAIAGVTITEERAEIVDFSDPYYDSGLRIMVRADNDEVETLEDLEGLSVATKIGSTSYDFLQENLGE-NAEITPYPGTSDMYMALLGGNVDAAFYDAPNVGYFAQTRGEGR------TKVVGPLYEGQQYGIVFHQG-SEWVEPVNEALAAMKEDGTYDEIYTKWFGE..... 253
273 8.000e-90UniRef50_C0QEQ2 GlnH3 n=5 Tax=Bacteria TaxID=2 RepID=C0QEQ2_DESAH  ali  25  1MKKQTAFVLTLMMICCFAATGFAKN--ITVATDTNFPPFEFKDPKGHHTGFDVELWNAIAQDMGIEYDLQPMDFNGIIPGLQSGQLDAGIAGITIKPERAKVVDFSDPYYNAGLLLLVKADRTDITKVEDLEGKVVATKLGTTSDDFLKKNAKAK--EIKLYPNNDAMFMELMMGGADAVMFDSPVIANYVREVGKDR------VKVVGPLYMGQSYGIGFPKGSP-LVDKVNKSLKKLKDNGDYRTLYLKWFNT..... 245
274 9.000e-90UniRef50_A0A2G8RDP6 Uncharacterized protein n=1 Tax=Puniceibacterium antarcticum TaxID=1206336 RepID=A0A2G8RDP6_9RHOB  ali  34  1MLRKLSICLLATTSLAAPALA----DTYKVGISAEYPPFYTPDASGNWSGWEIDFMQAVCERIEAECIVTPLAWEGIIPALNTGKIDMIIGSMSITPARAEQIAFSDKYYDTPTGLLIAKGTDFDATPEGISGAIVGAQSGAVQQAYANKHYAATASDIRIYQTLDEELQDLAAGRLDAVVGDSLAMEPFINSDIGQACCDYKGAVPADPEVLGYGVGVGMRQDDTALLEKVNAAIAEIRADGTYAEISKDYFSFDVYG. 256
275 1.000e-89UniRef50_L7U5C1 His/Glu/Gln/Arg/opine amino acid ABC transporter permease/periplasmic amino acid-binding protein n=1 Tax=Myxococcus stipitatus (strai  ali  31  47..........................TLRIGTDGTYPPFESV-KDGELVGFDIELGRLIAEELGAKVEWTNTSFDGVFPALMAGKFDLVMSAVTITPERQQRLGFSSPYYTAGQLVVTREDDLSVTGIESLRGKVAGIQINTTAALVLQKF---PDVEVRQYPSIDLALQDLRNGNLAGVVGDGPTLRYFLTHG-------FKGLRPAGGLLTEEQYGIAMRPDDPELRDAVNAALQRLRDNGKFAALEERYFGES.... 265
276 1.000e-89UniRef50_A0A2J7U8L2 Amino acid ABC transporter substrate-binding protein n=97 Tax=Proteobacteria TaxID=1224 RepID=A0A2J7U8L2_9PSED  ali  36  1MKNLLKVL-ATGCLFSALASHAVAADKIVFGIALEYPPFSMKSGNGNWSGFEPELIQALCERMQAQCPLKEVAWDGLIPALQSSQIDAILNSLSITEEREKVIDFSAPYYQTPAMWVADQSLELATTPEGLKGKLIGVQGSTSNATFAKTYYGKT-STLRYYTTQDDMIADLQSGRIDVMLADALTIEP-ILKTAAGAGLADKGLAPKDP-LFGSGIGVGLRKGDSALQQRINTALASLKADGTYDKIRSRYFSVDIS.. 255
277 1.000e-89UniRef50_W0JEP2 Amino acid ABC transporter substrate-binding protein n=4 Tax=Desulfurella TaxID=33001 RepID=W0JEP2_DESAE  ali  27  4.KLFLFLVSFAFVFSFGLANLAQAEQVVKVGVDTTFPPFE-MEEHGKVVGFDVDLVNAIAKAEGFKVEWHTMDFQGLIPALQTGTIQMAVAGMTITPQRAQVVYFSKPYYHSGQSILVKKGSP-IKDLADLKGKTVATKLGTTADIMLSKM---KDIKVERFTNIDDAYNQLQNGGAQAVVFDNPVNINYAKTHKNVHT--------VGKLLTGEDYGIAVSKQDPKLLEKVNAGLEKIIKNGVYLKLYRKYFGDD.... 245
278 1.000e-89UniRef50_F0G2N6 Periplasmic solute-binding protein n=4 Tax=Burkholderia TaxID=32008 RepID=F0G2N6_9BURK  ali  38  1MNIKRLGMLLTLCALSTAASAQATSDIVRIGVDPNFPPFEFKSADGRLTGLDIDLGNAICQDIGVKCEWVEHDFDHIIPGLNAKKFDIILSAMIATEDRRKVMDFSDTLYHIPVAMIAATTSGLMPTGDSLRGKRLGVTKGTALEAYVKGKWGSK-AEVIAYPTDAQLYDALASGKIDAAIQDKAQAEYFFLTKPAGQNFAFTGPDFDDARLKNDDVAIGIRKDDAQLKDRINKAIADIRANGLYRTISRKYISFDVSG. 259
279 1.000e-89UniRef50_UPI000DCE69F6 basic amino acid ABC transporter substrate-binding protein n=1 Tax=Phytoactinopolyspora sp. YIM 96934 TaxID=1981511 RepID=UPI0  ali  31  164.......................EEGTLRVGSDIDFPPFEMV-EDDEIVGFDVDLMEEIADRLGVEVEWVDTPFDTIFTQLAAGDFDAIISGITITEDRQQTVDFSDPYFESIQSVVVRTDSD-ISGVADLADADVGVQAGTTGEAYAQENFTDS--TVRDFPTYPAAFTALETEGVDAVFADLPAAESQVEGSD--------VLEIAEEVDTGERYGIAVQPDDEAMRSAINEQLEAIIADGTYEEIYAEWFD...... 382
280 1.000e-89UniRef50_A8F5J2 Extracellular solute-binding protein family 3 n=28 Tax=Bacteria TaxID=2 RepID=A8F5J2_PSELT  ali  30  1MKFTRAMFLILILLSAMTFS-----RTITVGTSADFPPFEYI-ENGQFVGFDMDLMREIAKIAGFDLKFVDMSFDSLIPALRAGQVDVVAAAMTITDERKQVVDFSIPYWTADQSVIVKSESPLTITVLFSKGK-IGVQTGTTGDLWCTDNLVSTGKNLKRYDTFVLALSDLLNGNIDAIVLDSPVANRFAATKP---------VRVVGIITTGEQYGVAVRKGEKELLEKINNAIKVLNESGKMSELIDKYF....... 241
281 1.000e-89UniRef50_P49618 Arginine-binding periplasmic protein n=11 Tax=Mannheimia TaxID=75984 RepID=LAPT_MANHA  ali  33  1MKKTLLTLL----FGCVVTAQAQD----IIVMEPSYPPFEMTEEKGEIIGFDVDIANAICKEMNANCTFHSQPFDSLIQSLKQKQFDAAISGMGITEPRKKQVLFSEPYFPSSAAFIAKKDTDFAKV------KTIGVQNGTTYQHYLAK--EKKEYNVKSYASYQNAILDVQNGRIDAIFGDVPVLAEMARKHEG---LDFVGEKINNPNYFGDGLGIATHLKNQVLVDQFNAALKTIKENGEYQKIYDKWMG...... 235
282 1.000e-89UniRef50_A0A1I1XP40 Amino acid ABC transporter substrate-binding protein, PAAT family n=6 Tax=Bacteria TaxID=2 RepID=A0A1I1XP40_9FIRM  ali  32  1MKKICLVLFSVLMMLLVVGCGSSGPKKMVIGLDDNFAPMGFRNEKNEIVGFDIDLAREACKRAGMEVTFKPIDWSAKEAELNGKRIDAIWNCFTINPEREKVIQFSKPYINNCQVVAVPVASK-IETLADLKGKAVGVQDDSTGSYLLDGKYADGLKEYKKYPDFAAAFLDIDSGRLDALVVDEILVRYYMKKAPGK-------YKVLKEDLGKEVVGVGFRKDDKEFAARIDKILDEMKKDGTCKKISMQWFGTDI... 252
283 1.000e-89UniRef50_A0A095ZUW0 Uncharacterized protein n=5 Tax=Firmicutes TaxID=1239 RepID=A0A095ZUW0_9FIRM  ali  26  2...VLCIAVLAVAGCGGTKSDAPQSTTWKVGTNATFVPFEYTDESHQLNGFDIELFNAIAKKAGMKVEYKNVSFDGLIPALGTKQIDAAISGMTITKARAEKVDFSFPYYQSGLGVLT-KDGTAVEDLSELSGKKVAVQLGTTGAEKASEI---SNIELRTFDNNSEALLELTKGGVDAVIADLPVLQYYLTTKKDS-----VAKLSVIESKDPEYFGIAVKKGNKEVKDKINAALKELKKDGTLDALYQKYFNQD.... 245
284 1.000e-89UniRef50_A0A1M4N629 Sulfate starvation-induced protein 7 n=31 Tax=Bacteria TaxID=2 RepID=A0A1M4N629_9CLOT  ali  26  1MKKKIILLTAVLSLGILSGCGKKEKKEFVLGLDASFPPMGFTDDKGDIVGFDIDLAREACKRLGIELKVQPINWDAKEQELNTGNIDAIWNGFTINEDRKKQVLFSEPYMKNRQVIVVNSNSN-INDMGDLAGKTLALQSASSAADALDKYFKDSLKEVVEFKDNMTALMDLEKGGVDSVLMDEVVAKYYIEKKDKS-------YKIIDEGLGAEEYGIGFRKGDKALMEKFQEILKEMAKDGKIAEISKEWFGEDI... 265
285 2.000e-89UniRef50_A0A024QHK0 Glutamine-binding periplasmic protein n=51 Tax=Terrabacteria group TaxID=1783272 RepID=A0A024QHK0_9BACI  ali  24  32.................GNSEGELKDTYTVASDTSFVPFEFK-EDGEYVGFDIDLIHAIADEAGFEIELETTNFDGIIPGLQTGSFDIAIAGISITEERKQKIDYSEPYYESGLAIGVRSDNDSVKGIEDLEGKTIATRLGSTSASYIDEN--IENAEASQFEQLDQAYLAVENGSADAILYDAPNVNYYIQTNGDN-------LKVVGDLYQAEDYGIAISKGQEELVTAINDALATLKENGKYDEIYEKWFGK..... 259
286 2.000e-89UniRef50_E8LKJ0 ABC transporter, substrate-binding protein, family 3 n=7 Tax=Succinivibrionaceae TaxID=83763 RepID=E8LKJ0_SUCHY  ali  24  4.KFSTAVKTLCAAAAVTFCAVQAQAEVLRVGTEATYAPFEFMDDNVQPQGYDIDIINAVGKAMGYDVQVQNMAFDGLIPALMTSQIDVVIAAMTITEERAKRVDFTEPYYKSGLSILILEENDKFKTIDDLKNERLCAQIGTTGALKAQEISGNVGA----FNTEPEAFMELKAKGCAGVVNDRPVNLYFLTKSASKGVIEMS------ERITAEDYGIAVRKGNSELLKALNEGLKKIKESGEMAKIHQKWF....... 246
287 2.000e-89UniRef50_L0KX13 Periplasmic component of amino acid ABC-type transporter/signal transduction system n=3 Tax=Methanosarcinaceae TaxID=2206 RepID=L0KX1  ali  27  1MKKILNFLVLGLMIAVLVAGANSTQKTYVVGTEPYFPPFEYAEENNNIVGFDVDLINAIAADQGFKVQWKDLEFDALIPALQSGQIDMIASGMTITEERENAVDFTEPYINAGLALAVAVSNEEIKGVDDLKGKVAAVQQGSTGSHEAEKLKAEGKIDIIYLAHVNDIILNIQNERADFTINDLPVTQAFMSQNPGV-------IKIVDDELTSDSYGFAVKSGNTELLTMLNQGLENVKQDGTYDQIMTKYF....... 258
288 2.000e-89UniRef50_A0A1S6ZEI6 Amino acid ABC transporter substrate-binding protein n=38 Tax=Bacteria TaxID=2 RepID=A0A1S6ZEI6_9BACI  ali  27  1MKKSVAFLFFLLAFTVVLAACGKEDGVLTIGTEGTYPPFTFHDDANKLTGFDVEIAQEVAKRLGVKAEFKETQWDGMFAGLDAKRFDMIANQVGIRPDREEKYDFSDPYIESAAVLVVREDNNDVKSFEDMKGKKSAQSLTSNYADLAKKY----ETELVGVEGFTQSAELIVSKRVDGTINDKLSFLDYKKQRPN------APVKIVDEAEDASASGLMFRKDSGKLVEEVNKALADMQEDGTYAKISEKWFGEDVS.. 268
289 2.000e-89UniRef50_A0A073JYK8 ABC transporter substrate-binding protein n=429 Tax=Bacteria TaxID=2 RepID=A0A073JYK8_9BACI  ali  32  1MKRKVFAILTVLTLFSLLGACSKEKKEFRYAMSGLYKPFNYKD-NGKLVGFDVEIGEALAKKMGMKPVPVTNPWETLIQGLDAKKYDVILGSMAITEERLKAVNFTNPYYRSGAQIFVSENNDSISSAKDLKGKKVGVVKASTFKDLVAEHTD----QITEYDSDLTAIMDLEPGRVDAVVTDQMVGLRVMKEGKSN-------IKDAGKPLSLDEMAIAVRKEDKELLEKVNKALDEIIQDGTYEKISKKWFGRNILG. 257
290 2.000e-89UniRef50_R6Y5U9 ABC-type amino acid transport/signal transduction system periplasmic component n=12 Tax=Bacteria TaxID=2 RepID=R6Y5U9_9CLOT  ali  32  40.......................SKGTFILGLDDSFPPMGFRNENNEIVGFDIDVAKEVCKRLNVELVIQPISWNAKEQELNSGNVDCIWNGMSITEERKQAMLLSDSYMKNRMVFITKQDSNL-KTLEDLKNKKVGVQSGSSAEQILEESETYKTLNTVAYADNITAFMDLETNQIDAVFVDEVLANYYIATNNKNYNQ-------IEQALEEEQYAIGFRKQDNELCNRVNEILKEIKEDGTLEAISKKWFGKDV... 266
291 2.000e-89UniRef50_D3LU59 ABC transporter, substrate-binding protein, family 3 n=9 Tax=Veillonellaceae TaxID=31977 RepID=D3LU59_9FIRM  ali  31  1MKKIWMTLVIVMCVAVLAGCGHKPSETIIIGMDDNFPPMGFRDDQGQLVGFDIDVAKEASKRLGIPVEFQSIDWDSKEAALKSGQVDVLWNGLTITPERQKVIAFSKPYMKNDQLLVVRSDSP-IHDKQDFSGKCIGTQEGSSSIDALNKDFQRSLKDVKKYGDYVNAFMDLEVGRIDGVLVDSVVGRYYMEKKPGK-------FKVVDKSLGEETFGIGMRKEDKPLQDKMNKVMAELSRDGTLSALSKKWLGDDI... 261
292 2.000e-89UniRef50_D3FUN4 Glutamine ABC transporter substrate-binding protein n=7 Tax=Bacillaceae TaxID=186817 RepID=D3FUN4_BACPE  ali  27  1MKKVFGGLLLVATACGSAAAEDGERESYVVATDNAYVPFEFLDETGELVGFDIDLMTAIAEEAGFDIEFEAMEFDGIVAGIGSGRFDIGIAGMTITEERKENIDFSQPYYDAGLIVAVHADNDEINSVDDLDGKVVATRTGSTSETYIREN---TGGTPEAFPQITEAYQNVIQGRADAVIYDIPNVQYYASTEGGGQ------LKTVGEALTGEEYGIAFPKG-SELRDIADEALTTLKENGTYADLYEKWFGE..... 262
293 2.000e-89UniRef50_L2F7D0 Extracellular solute-binding protein n=3 Tax=Moraxella TaxID=475 RepID=L2F7D0_9GAMM  ali  29  1MKKFSFALTALATLIGLTACTQKDLPQIRIATESSFVPFSFKDADGKLIGFEIDLAEALCQEAKVKCEVISQDWDGLITGLQSQKYHAIMAGMSDSAERRKVVAFSDPYFINNLMIIGKKG--VDKGADDLAGKNVAVQRATVALEYLEKNFPK--ATAKSYDTQENAYLDLEAGRADLMISDSAPALSWLK-TPKGGNYEIKGEPIN----INDKIAIAFRQNDP-LIGQFNSALATLKANGTYDKIRQKYF....... 259
294 3.000e-89UniRef50_Q8RCC4 ABC-type amino acid transport system, periplasmic component n=23 Tax=Thermoanaerobacteraceae TaxID=186814 RepID=Q8RCC4_CALS4  ali  24  4.KSLFLAFAVVFALAFMLSGCGKQKGVIVMGTSADFPPFEFHGGKDEIVGFDIDIANAIAKKLGVKLEIKDMDFKGLIPALQAGRVDMVIAGMTPTAERKKSVDFSDLYYDSRQVVVVKNDSP-ISKFDDLKVKTIAVQIGTTSEEAAKKI---PNVKLKQLNRVSDEFMDLQNGRCDAIVVEDTVAKAYLKEYKDMKILYM-----DEINNVENGSAVAVAKGNKSLLDVVNEVIKELKQSGEYDKLVDKWFK...... 259
295 3.000e-89UniRef50_A0A1B2R5W5 Amino acid ABC transporter substrate-binding protein n=31 Tax=Bacteria TaxID=2 RepID=A0A1B2R5W5_9BORD  ali  29  1MKRIFSVLLAGLLSCAGMTARIKSAGEIKIGTEGTYAPFSFHDASG-LTGFDVEIGRAIAQRLGVKAEFVEGKWDGLIAGLDVKRYDAVINQVGITDARKAKYDFSNPYISSQAVLIVRDNNTAIKSFADLKGKRSANTLTSNFGKLAQKY----GAEVVPVQGFNESIDLLLSGRVDATINDNLSFLDFKKHKPDAKVKAVA----NDKSAEFSESGVLLRKGNPDLVAAINKALADIKADGTYKKISVKYFGTDLS.. 257
296 3.000e-89UniRef50_A0A1M5DUL0 Arginine/ornithine transport system substrate-binding protein n=5 Tax=Halomonadaceae TaxID=28256 RepID=A0A1M5DUL0_9GAMM  ali  32  1MNRTLISSVLATTLLIGTGAQAQQ-DPLRIGVDIPYEPYQYKLPDGTITGFEVELVEAACERMQRECQWVEQAWDGIIPGLQARKYDFIASSMNITEDRSRQVLFSEPYFQVPSVWVGQAEGDFAPEGGDLEGAAVGVQQGTIQDEYVTQFYPE--AEIRRYGDSGAVVNDMQAQRLDLVFTAFPLAQETLLGNE---RFTRVGELVTGPEIYGPGIGAAFRKRDKELVGAFNAAMKKVKEDGTYDELHEKYFGE..... 250
297 3.000e-89UniRef50_UPI0003F7896F basic amino acid ABC transporter substrate-binding protein n=1 Tax=Veillonella magna TaxID=464322 RepID=UPI0003F7896F  ali  31  4.KKGAALLLGAMLTVGLIAGCGNSKKVITFAAETTYPPFEYAEGD-KYKGFDVDLSNALAKEMGAEAKFVSMGFDALIPALQGKQIDAIASGLVITKEREEKIAFTDPYYEVSLMMVVRKDENNIKSEADIAGKTVAAQIGTTGAMLAKE---KPGTTVKEFDSIPNMLQDLQNGNVQIVMLDEPVARYYIQKMN------MDDLKVVDIGLQHHKVAIGLRKDDKQLLADMNKALAKLKENGEYDKLTKKWFGTS.... 257
298 3.000e-89UniRef50_A0A0X8GYZ9 Uncharacterized protein n=1 Tax=Erysipelothrix larvae TaxID=1514105 RepID=A0A0X8GYZ9_9FIRM  ali  28  1MKR---CFALILCILLLVGCGSSKNETFTVGF-TDYPPMGFKDENGEIVGFDVDLATEVFKRLNMDVSFQYINWDSKILELNSGGIDAIWNGFTITQERQKEVLFTNSYLKNSIVVIVRADNDSIQTLDDLTDKHIAVESESSGQRILVETLEDGSFTLNRFTTINEALLDLKAGNSDAVVADEIYARYLIGKSDEY-------IVVPNISLQSEEYAIGLRKDDTEMQVKINDTLDAIIADGTLSEISIKWFGEDL... 246
299 3.000e-89UniRef50_A0A1H0YPG2 Amino acid ABC transporter substrate-binding protein, PAAT family n=49 Tax=Halobacteria TaxID=183963 RepID=A0A1H0YPG2_9EURY  ali  31  62........................PETVVIGSDIPYRPFEYETTSGELTGFDVDIAKAIFEELGIGYEFKPTSFDSIIPSLNNNNFRIIMSAMTINEERAKKVDFSDPYFTAYQTVIVRKDSD-ITSKEDLKGKNVGVQKGTTGASAAEGLKEEFGGTLKKFDQIPGAFQALMNGQVDAVVNDNTVNAEFVNGKGEGKVRFLEGEGEAAEQLTVEEYGIAFRKDDDEFRKKVNEALAAIRESGKYDEIYSQYF....... 301
300 3.000e-89UniRef50_A4FZY8 Amino acid ABC transporter substrate-binding protein, PAAT family n=3 Tax=Methanococcus maripaludis TaxID=39152 RepID=A4FZY8_METM5 :_  ali  34  5.KKLILLGLVVSLVAFSGCTEDQAEGILVVGTDPTFPPFEEKNADGELVGFDIDLMNALGEKMGIEIQFVEQPFDGIIPALKAEKFDCIISAVTITDDRAKEVAFTNSYFDAAQVIAVLIDDDSVQSVDDLAGKVVAAQLGTTGEYEAQHYAEELGFEIKSYEVMADAFIDMENGRVNAVVTDDGVAQRFLDTKPGV-------YKVVGEPMTSESYGLAANLDNQELIDALNNALAEVKEDGTYDEIYAEWFD...... 259
301 3.000e-89UniRef50_A0A132EZK0 ABC transporter substrate-binding protein n=5 Tax=Burkholderia TaxID=32008 RepID=A0A132EZK0_9BURK  ali  52  25...........................LRFGVDPSYAPFESKAPSGQLVGFDIDVGNEICRRLNARCVWVETAFDGIIPALKGRKFDAILSALSVTPQRETQLAFSTSLFNTPSRLVGLRGRDIKPTVASLRGKRVGVAQGSTQETYARTYWAPAGIEVVSYANQELVNNDLRAGRLDVTLTDMVAASEGFLKTPQGAGYVFLGEPVVDEKTLGKGVAIGLRKDDGALRDRIDGAIAAMNQDGTLRRLERRYFD...... 251
302 4.000e-89UniRef50_Q39BT1 Amino acid ABC transporter substrate-binding protein, PAAT family n=452 Tax=Bacteria TaxID=2 RepID=Q39BT1_BURL3  ali  28  1MKFLRSILVVAMLQAVSVTSQIKSSGVFRVGTEGTYAPFTYHDETGKLTGFDVDIATAIAQRLGVKPQFVEGKWDGLIAGLDVNRYDAVVNEVSITDARKAKYDFSTPYITSRAVLIVRADNTTIRSFDDLKGKKSANTLTSNFGKLA----ASHGADVVPVQGFNEAIDLLSSGRVDATINDSLSYLDFRKHKPDAKLKVAA----TDTGGASDASGVLLRKGSPALVAAVDKALADIKADGTYAKISHKYFGRDVS.. 258
303 5.000e-89UniRef50_A0A2H5Y9Q5 Glutamine-binding periplasmic protein n=8 Tax=Bacteria TaxID=2 RepID=A0A2H5Y9Q5_9BACT  ali  26  1MRRLLWGILVLALLAVACQXXXXXXRELKIASDTTYPPFEFVDPKNEIVGFDVDLVNEICKLLNCKPVIVSTAWEGIFAGLEQKQFDLAASGITITEERKQKFDFSDSYLRYGQVVLVRADEERIKSKDDLKDKIVGVQIGTTNEETAKTLVADEAKQLKRYDTFDLAVRALLAKDVDAVVIDSPAADGFMAQNPGK-------LKIAGQPFTSEDLGLCFPKG-SDLVGPFNAALKVLKENGTLDRLYRKWF....... 260
304 5.000e-89UniRef50_A0A172YAI5 Uncharacterized protein n=6 Tax=Halomonadaceae TaxID=28256 RepID=A0A172YAI5_9GAMM  ali  30  1MLPSLRALLGASLFCVLSSAALAEEPPLRIASDVPFPPYEMLTADGEFTGFEVELVNAICERMQRRCEWQAQSFDGIIPGLLARKYDIIASSMLMTPARQQQVSFAKAYYFNPSVWVGPADRPLEVDEADLSGKRIGVQRASVQDDYVTATHPE--ADIRRYTTVDTVAVDMQAGRLDLIFANLPQAQALLL---DDAAYAIQGEPVRGPEIFGKGTSAAFRKRDTALVEAFNRGLDEVMANGTYDEIMQRYFDYDI... 254
305 5.000e-89UniRef50_A0A1X6ZVC8 Putative ABC transporter arginine-binding protein 2 n=1 Tax=Roseovarius albus TaxID=1247867 RepID=A0A1X6ZVC8_9RHOB  ali  33  1MK---ISILAVGLLAGGLASAASAQDVLRIATEGAYPPFNNVTADGELVGFDVEIAEALCASMERECEIVAQDWDGIIPGLVNDKYDAIIASMSITEERKQAIDFSAPYYSNYLSVVGADGTSA--TLEKLGDVSIGAQRSTTGSQWAEDTYGNR-ADIRLYDTNPAAFSDLSAGRVETVVADFLPAAEWVK---DNQDFGFVAEKID----IADQIGIGVRKGEDALREDLNTAIEAIRADGTYQTISVKYFGIDIF.. 245
306 5.000e-89UniRef50_A0A255XVX6 Uncharacterized protein n=1 Tax=Elstera cyanobacteriorum TaxID=2022747 RepID=A0A255XVX6_9PROT  ali  31  30...................GQAAAAPLLRFGTEGAYAPFNFIGADGKPQGFDVEIGEALCAALQRRCQWVVQDWDGLIPALNAKRFDAILASMAITEKRKAAVDFTDPYYASPGIVLARAGQGGPLTQAFLTGKTLGVQQETIYEAYLDAEMP-GWATVRRYRSQDEAAQDLLNGRLDMLMANSTQLDAWVKANGGYGAFARVGAPFRHPSF-GAGAGIAVRKGDAVLHADLNRALAQIVQDGRFAKITARYFDFDI... 265
307 5.000e-89UniRef50_F7NHD1 Amino acid ABC transporter periplasmic protein n=4 Tax=Firmicutes TaxID=1239 RepID=F7NHD1_9FIRM  ali  34  44......................QKRGTLKIGTEGTYPPFTFKNEKGELQGFDVEIIIEVAKRLGVKAEFVPTEWKAMFAGLDSERFDVIANQISINEKRLEKYDLSTPYTVSGAQVIVNKETTNISSVEDLKGRKVGVTQSSNWEEIAQK----AGANIRHYKGANEIFADLQAKRIEATVNDRLFIAEYFLKNSSHN------LAVAGQTFDEAKMGFAFRKGSPELIEAVNKAIREIQADGTYVKISHKWFGQDVS.. 269
308 5.000e-89UniRef50_D9TRR4 Extracellular solute-binding protein family 3 n=9 Tax=Thermoanaerobacterium TaxID=28895 RepID=D9TRR4_THETC  ali  25  1MKKVLIILSLIVMLSIILSGCSKKSGVIVMGTSADFPPFEFHNGKDTIMGFDVDLANAIAKKLGVKLEIKDMDFTGLIPALQSGQIDMAIAGMNATPDRKKNVDFSDEYYNSEQVLVV-KSSSSINNLKDLNGKTVAVQLGTTSDDAAKKI---KGINLNELNRLGDAFLSLENGRVDAILMESTIANAYLKEYKDMKMLH-----VKEINEAVPGYSVAVAKGNQDLVNQINSVIKELKDSGEYGKMLNKWMGK..... 258
309 6.000e-89UniRef50_A0A1B8P1R0 Lysine-arginine-ornithine-binding periplasmic protein n=51 Tax=Proteobacteria TaxID=1224 RepID=A0A1B8P1R0_HALEL  ali  32  1MQRALIPAIALSIATLGGAAQAAEP--LQIGISAEYPPFTYTSSEGEWTGFEVELGLAICEAMEAECEIQPTGWSGIIPSLKAGRIDMIMNSMSITEARQKVIDFSDPYYFTPGAYVA-ADDLELSLPEGLDGLVLGVQSATTNATYARRALRDTGVDIRLYDQAEQVNRDLLSGRLDVILADEIAMNELV-ERDEAEGFEIKGTAPHHEAY-GEGVGIGIRQGDSELKANLNAAIERVQQDGTCSSLSEEYFGTDICTG 256
310 6.000e-89UniRef50_UPI000DEB7CBF ABC transporter substrate-binding protein n=1 Tax=Pseudochrobactrum asaccharolyticum TaxID=354351 RepID=UPI000DEB7CBF  ali  32  6.KKLLFFALSASVLTACTSASAEDNAVLKIATEGAFKPWNFTEPSGKLAGFEIDLAEDLCKRMNRTCEIVAQDWDGIIPALNAGKYDVIMAAMSITDERKKVLDFSVPYVATYHATMLPEASDEKASAEELKNKTVGVQLASTNGAFLEAYL-KNDVTITYYKTVEQLNLDLQSGRIDATIAD-LTALEAELKKPGFSGYKIAGPVLMGGVF-GEGVGAAMRKGDDALKQLFDTAITAAIKDGTVKQLSEKWYGTDIS.. 281
311 7.000e-89UniRef50_H1PTA9 Uncharacterized protein n=7 Tax=Bacteria TaxID=2 RepID=H1PTA9_9FUSO  ali  29  1MKKLFMAVLVITILASVSLFAAKKDGYFTVGLDATFAPMGFRDENEEIVGFDIDLAKEVAKRMGVEVKFKPCEWDGIIFDLRSKNIDMVWNGMTITEQRSKQAAFTTPYLVDGQIIFSRKGNE-INKVSELEGKVVGVQLGSSGSQAVERNAAPKLKEIKKYATNVEALLDLEAGRTDAVVMDAISGKYYNAKKNTLS--------FSEESLSDEYFAVALRKDDKALLDEINRLLDEMKKDGTFDQISLKWLGT..... 254
312 8.000e-89UniRef50_A0A2N0Z5G6 Uncharacterized protein n=1 Tax=Bacillus nealsonii TaxID=115979 RepID=A0A2N0Z5G6_9BACI  ali  31  1MKKLVIIPFIFLLTLLLGACGSKDKGELVIATSGDYRPFTYLGDDNKLTGYDIEWAKAIAKQMGVKPVFETGDFSGLIPGLNQGRFDMVMSSIHVTEERKKSLDFSDPYALDGAVAVVRKDSLEIADPTEIKGLKVGVNAGSNWETIVRDIGGFK--ELKTYPGPTESIADLINERIDTVVLGQASAAAYIKNAPDGNQIEISGKPLDGGE--ESHIVIALRKGDAELQEAVNKAIAELKEDGTYDELAMKYFG...... 264
313 8.000e-89UniRef50_A0A1H8FWY4 Cystine transport system substrate-binding protein n=14 Tax=Thermoactinomycetaceae TaxID=186824 RepID=A0A1H8FWY4_9BACL  ali  29  8MISIALGLALFLFVSGCSVNQQKDRGTIRIGTEGTYKPFSFHDEKNELTGFDVEVAKEVAKRMGVKAEFVEIPWDGMLTSLQTKKIDMVANQVGIKPERKEKFDFSSPYTVSYAQIVVHKDNQEIKGIEQVKGKRAGQTPTSNYGKMAKD----AGATIVAYEDMMSAMKDVAAKRIDFSMNDRLAIAEMLKTTK-------LPLKTVGEPMEKSESAFPVPKGNPELVKEINKALESMKKDGTLAKISQKWFGQDVS.. 262
314 8.000e-89UniRef50_A0A2A3BDL0 Amino acid ABC transporter substrate-binding protein n=2 Tax=Mesorhizobium TaxID=68287 RepID=A0A2A3BDL0_9RHIZ  ali  38  1MKLLSILLTGTALALSIATASA----EVRFGMNEAYPPFFTKDPSGKWVGWEIELMDAVCAEMKETCSVVDMSWDGLIPGLQAKKFDVIWSSMSITDERKQTIDFTDKYYNTPSKLIGAKDGTTGASPDDVSGKTIGIQVSTIQSEYYKKYFADKASE-KTYTTLDEAFQDLAAGRIDYVFGDSIPLSELLKSDFGKECCKDMGNVKDDPAILGSGIGGGLRKGDQALREKLNAAITAVRANGKYAEISKKYFDFDPY.. 254
315 8.000e-89UniRef50_G0AED9 Extracellular solute-binding protein, family 3 n=5 Tax=Betaproteobacteria TaxID=28216 RepID=G0AED9_COLFT  ali  32  1MKKTASLMLAVLALSGLSACGKHEDKEYVVGTGATYAPFESENENKELVGFDIDVMKAIAAKEGMKVKFVNTPFDGIFSALANGDRDIIMSGLTITEKRKLTVDFSDPYFEAGQVIVVPLDSKIQKIP-DLKPLTVGVLQGSTGDEIMQKLAGDNNASIKRFESSPLALKELETGGVSAVIADKGAVVHYLANN-QGKGIRMV----TDDNFPKEFFGIAVKKGDAALLGKINQGLAAIKADGSYDKLHAQYFD...... 260
316 1.000e-88UniRef50_A0A0B5FIK2 Cystine ABC transporter substrate-binding protein n=22 Tax=Bacteria TaxID=2 RepID=A0A0B5FIK2_9BURK  ali  28  1MKAWLKTLLAAAALVGASPARAADAGVLKIGIEGTYPPFNYRGTDGQLDGFDVDVAKAVAERLGVKPMFVTTEWSGIIGGLVAGKFDVIVNQVAITDERKKSLDFSQPYTYSAAQLIQRKDDKRENSLEALKGHKLGVSLGSNYDKLAKAV---PGIDVRTYPGAPEYLRDLAAGRVDAALNDRLMLAYLIKTSNLPLRPGAVLQS------TNQSVGIPFRKGNPKFAKAIDDALASMKQDGSLTKLAEKWFGEDVS.. 261
317 1.000e-88UniRef50_A0A1E7RTZ8 Cystine-binding periplasmic protein n=8 Tax=Clostridiales TaxID=186802 RepID=A0A1E7RTZ8_BUTME  ali  24  3MKKKLVGVSVALMLVALAGCGGKADGVLKIGTNATYVPFEYRDENNEMVGFDIDMGNAIAEELGVKAEWVDTGFDGIFNGLTSNQYEMIIAGTSITEERQKTFNMSSPYTANGIVIVSRNDGTPAKTADDLKGKKVGVQIETTSDYAAEKMIENTDMNLSKFDAMLDAFTALEGKTIDYILTDKPVGQFYTSKKPDV-------YSITSETLSNEPIGITMRKNDTEFSQKIEETLQKLRDNGKLAELSQKWFGEDI... 262
318 1.000e-88UniRef50_A0A255Z684 Uncharacterized protein n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A255Z684_9PROT  ali  34  11MKKLMAALALASVMALSGCGKEEAKQPLRVATEGAYPPYNMVDASGNLIGFEIDMMKDVCKRMGTECQFIAQAWDGMIPALQAGRFDAIVAGMSITEERLAAVDFSKGYTTTPAYLVSTNANDKIKGL--LKGKVLGVQTSTIHANFADTYLAD-VVDIRRYETQENLALDLQTGRVEVGLADAITWNAFL-QRPEGKDFSYFGPGF-DGGLFGRGQGIAIAKGRPELLAALDKAIADMKADGTMKNLSVQWFGFD.... 296
319 1.000e-88UniRef50_I2B7Y9 Cysteine transport protein ABC superfamily n=418 Tax=Bacteria TaxID=2 RepID=I2B7Y9_SHIBC  ali  28  11...LMGALAVALIAGASVQAFAKERGTLLVGLEGTYPPFSFQGDDGKLTGFEVEFAQQLAQHLGVKAALKPTKWDGMLASLDSRRIDVVINQVTISDVRKKKYDFSTPYTVSGIQALVKKGNDTIKTAADLKGKKVGVGLGTNYEEWLRQNVP--GVDIRTYDDDPTKYQDLRVGRINAILVDRLAALDLVKKTNNT-------LAVAGEPFSRQESGVALRKGNEDLLKAVDDALETMKKDGSLEKLSQKWFGADV... 264
320 1.000e-88UniRef50_A0A1U6GJ90 Extracellular solute-binding protein n=61 Tax=root TaxID=1 RepID=A0A1U6GJ90_9GAMM  ali  31  69.....................STDDNVLRIGTEGAYAPFNYTNADGTLGGFDIEIANAICADMKMTCDIMAQDWDGIIPGLKAGKYDAIVAAMSVTPERAQQVAFTDPYFSNALVFLAKKDSAFDPTNSDIDSHSIAAQRSTISSQWLEKAYPK--ADMKLYDTLSNAFLDLGAGRVDAMISDKLPAIEWL-SSPSGSNYALKGEEID----INDNFAIAVRPGD-ELQAKINTSLANIKANGTYDKINQKYF....... 293
321 1.000e-88UniRef50_A0A2L0WN41 Histidine ABC transporter substrate-binding protein HisJ n=12 Tax=Bacteria TaxID=2 RepID=A0A2L0WN41_9RHIZ  ali  38  1MKLPLLLAGAMLAVSAFTAQAD-----VRFGMNESYPPFFAKDASGQWQGWEIDLMNAVCDQMKEKCSIVELSWDGLIPALQSKKFDVIWSSMSNTVERSKIIDFTDKYYNTPSTLIGPKDQKPGATADDVKGKTIGIQVSTIQSDYFNKYFA-KVADQKTYQTLDEAFQDLAAGRIDYVFGDSLALDAFLKSDAGKDCCAKMGDVADDKEILGAGVSGGLRKEDTELKTKLNAAIAAIRASGKYDEITKKYFDFDIYGA 255
322 1.000e-88UniRef50_A0A1V5SU26 Cystine-binding periplasmic protein n=1 Tax=Candidatus Atribacteria bacterium ADurb.Bin276 TaxID=1852833 RepID=A0A1V5SU26_9BACT :  ali  32  31......................KARGTIIIGTDATYPPMEYHDEAGNMIGFDIDLGNAIAELLGVKAEFIDTAWDGIFPALDSKKFDIIMSSTSITEERLKSKDMSDPYYQTSQAIAIRKDDDSIKGPEDLVGKVVAVQIGTTGDFAVSEIEGIK--EIKRFDTTDKAYMEVMNKRADAVVNDYSEVSFRMTLLPDMKVAATF-------KEGEDIYGITMRKGETELLAAINEAIAKLKESGKYQEIHDKWF....... 252
323 1.000e-88UniRef50_R5BM63 Putative glutamine ABC transporter periplasmic glutamine-binding protein GlnH n=3 Tax=Veillonella TaxID=29465 RepID=R5BM63_9FIRM  ali  30  10...FMAVGLAAGVLAGCGSDTASDKKVITFGAETTYPPFEF-AEDNTYKGFDVDLSNALAKEMGYESKFVSLPFDGLIPALQSKQIDAIASGLVVTKEREAKVNFTAPYYHVKLVMVVRQDTNNVNGEADIAGKTVGAQIGTTGAMLAQE---KPGTTVKEFDAITTMLQDLEAGNIQIAMLDEPVAKYYIQK------LNMKDLKIVPVGLQDHTVAIAVRKDDKELLDKMNAAFEKLKANGEYDKLQQKWFG-DI... 252
324 1.000e-88UniRef50_A0A1U9JWM2 Bacterial extracellular solute-binding protein,family 3 n=1 Tax=Candidatus Tokpelaia hoelldoblerii TaxID=1902579 RepID=A0A1U9JWM2  ali  27  10...WKAVMAGIVAAVTVFGVRPALAEEFRFATEGAYPPFNYVDSNRQPQGFDVDIARALCQKMQVKCVIAVQDWDGLIPGLIAAKYDAVIASMQSTPDRAKSVDFTSRYYSSELALAVKKSSTLDIAPETLKGLRIGAQSGTAMAAYAEDHYMPAGVNIWFYPTAEEANMDMLIGRLDGMVQEKFPLLDWL-QKDGRDCCRLLGYA----QGTREPISIAIRKNSAALKARLDQAIEDIRADGTYQKISAQYFGADIY.. 260
325 1.000e-88UniRef50_A0A1Y5DTZ7 Amino acid ABC transporter n=1 Tax=Marinomonas sp. 42_23_T18 TaxID=1856283 RepID=A0A1Y5DTZ7_9GAMM  ali  32  1MKKTSAIIISASVIGLLSTSIAAQTIKVGIATEP-YPPFSVPDASGNYTGWEIDIAKAICVQAKLDCEIVATAWDGIIPALLSKKIDVVAASLSITADRKRVIDFSDKYYQSGASIIGSKKASFGSTPTELDNKVIGLQAASIHVKFAKKYYP--NATIKEYQSQDEANQDLYSGRIDATQADALTLESFLNSEQGKNCCDLKGMAVNDEALLGEGIGFGLRKGNAELKNQLNDAIQAIRQNGVYEQVSQSYFSFNIYG. 257
326 2.000e-88UniRef50_A0A1W9TMN1 Basic amino acid ABC transporter substrate-binding protein n=4 Tax=Bacteria TaxID=2 RepID=A0A1W9TMN1_9BACT  ali  28  1MKKILSLLVIGVLLLVMGCNGSEKSTKIVLGTNAEFPPFEFR-EKGEITGFDMELATAISKKIGRELEIKDMAFDGLIPALQSNKIDFIAAGMTATDERRKNVNFTKSYYQSSQVIIVNDDNTEIKGVENLEGKKVGVQLGTTGDTEAQKI---KDVKLKKYNAAFAGVMELKNKKIDAIILDSEPAANFVRENK--------GLKILSENLTKEEYAMAVSKKNEKLLKEIDGALKELRENGEYDRLFKKYF....... 243
327 2.000e-88UniRef50_A0A2T1HVU8 Amino acid ABC transporter n=1 Tax=Alsobacter sp. SH9 TaxID=2109933 RepID=A0A2T1HVU8_9RHIZ  ali  38  24.....................AGDWSSIRIATEGGYPPFNFV-ENNQLQGFEIELAKAMCEHMKATCTFVTDDWDDLIPDLKKGQFDAIVASLEITEERRQKIALTKRYYRTPAVFMVRKDTDLTATPEAMKGRKLGAMTGTVYATYLEDLYGP-GSEVSLYANQDEASLDLALGRIDAVLGDKIALTEWLKRGRESTCCKFLADAPNDVTYFGEGYGIGLRKKDEDLKRQFDAAIDAIQADGTYDRIRARYFPFDV... 258
328 2.000e-88UniRef50_A0A1I1AGV4 Polar amino acid transport system substrate-binding protein n=2 Tax=Collimonas TaxID=202907 RepID=A0A1I1AGV4_9BURK  ali  31  1MKRTAILILTVLALSGISACSGAEIKEYVVGTGATYAPFEYENEHKELVGFDIDVMKAIAQKEGMQVKFINTPFDGIFTALAQGDRDIIMSGLTITEKRKLTVDFSDPYFEAGQVIVVPLDSK-IQKIDDLKPLKVGVLQGSTGDDMLQKLLGDSNANIKRFESSALAMKELEAGGVSAVVADKGAVVHYLSNN-QVKGIRIV----TDDNFPKEFFGIAVKKGDAALLGKINQGLAAIKADGTYDKLHAQYFDT..... 261
329 2.000e-88UniRef50_E1RAX8 Extracellular solute-binding protein family 3 n=57 Tax=Bacteria TaxID=2 RepID=E1RAX8_SEDSS  ali  24  1MKRIATLLTAIALVALLSVSGCQEKNELVMGTNAAFPPFEYIGADGNVVGFDVEIAKAIAEKAGKTLRIEDMEFDSLLTALNADKIDFAIAGMTITDEREKSVDFSDPYYEATQAVIVRKADNPISTKDDLNGKKISVQLGTTGNEIAKEFTDDS--NIVAFNTGFEAIMELKNGKVDAMIIDEQPAQNFIRQNSD--------LEIVSLDFDPEYYGIAVKKSSEELLPIINETLKELKANGTYDKLLSEYMK...... 249
330 2.000e-88UniRef50_A0A1M6HKP0 Amino acid ABC transporter substrate-binding protein, PAAT family n=1 Tax=Clostridium amylolyticum TaxID=1121298 RepID=A0A1M6HKP0  ali  32  1MKKKIAITLLVTSSLGLAACGTSNKDKILVGLDDSFPPMGFRSNSNELQGFDIDMAKEIEKKINKKFDFMPYNWDGIIPGLQSKKFDVVISAMSVTEERQKQINFTVPYIMEKQVIVIKGDSK-INSPEDLKGKVVGVQLGSTSEHAMEPI-KNTFKEVKEYKNNMDAINDLGIGRIDAVVIDELVARYYLKEQGSK-------FKVAEKELSKEPVAIGIRKDDSAMKEQLDKAIQELKQDGTLAKISEKWFGEDI... 258
331 2.000e-88UniRef50_I4NAF1 Cystine transporter subunit n=11 Tax=Bacteria TaxID=2 RepID=I4NAF1_9PSED  ali  29  11...LIASMGLVMGSALIGQAVAKKNGEIRVGLEGTYPPFSFVDDSGKLSGFEVEFAQALAKELGVKAKLEPTKWDGILAAVDSKRLDVAINQVTISDERKKKYDFSEPYTVSGIQALTKKDAGKIASANDLTGKKVGVGLGTNYEQWLKDNVP--GAIVKTYDDDPTKYQDLRVGRIDAILVDRLAAFELISKTNDT-------LAVSGPAFSKQEAGVTLRKGEPELLDAINKAIDKLRADGTLAKLSQKYFGADV... 263
332 2.000e-88UniRef50_A0A2W4K9C5 Basic amino acid ABC transporter substrate-binding protein n=1 Tax=Firmicutes bacterium TaxID=1879010 RepID=A0A2W4K9C5_9FIRM  ali  28  80...................AEIKERGYMTFANDAAYPPMEFADPTNQVIGFDIDLGKAIAEKLGVEHRVVVVDWDGLLAGLQARQFDAVMSAMNITEDRKAGADF-VPYVEMGQLIVVKKGNPKIRGLEDLKGKKIAVLLESTNEKLARTI---EGAEVVTFPSFPDALQEVANGRADATILDEPVAYYYVKTQPDQ-------YEIVGDVLQPMPVGIALPKGETELVQAVQQALDELKADGTYDQIYEKWFGK..... 307
333 2.000e-88UniRef50_P54535 Arginine-binding extracellular protein ArtP n=137 Tax=Terrabacteria group TaxID=1783272 RepID=ARTP_BACSU  ali  31  1MKKWLLLLVAACITFALTACGSSNKKKLIMGTSADYKPFEYKEGDN-IVGFDVELAKALAKKAGYEIEVQDMDFNSLITALKSKQVDLVLSGMTPTPERKKQVDFSDVYYTANHMIVSKKDSG-IQSLKDLKGKTVGVQLGSIQEEKGKELSPEYGFKTEDRNRISDLVQEIKSDRFDAAIIEDIVAEGYFKSNDDLQ-----GFVIPDAKAEEAGSAIAFRK-DSELTDKFNKALKEMEDNGELEKLKKKWF....... 251
334 2.000e-88UniRef50_A0A1Y4HWZ4 ABC transporter substrate-binding protein n=3 Tax=Clostridiales TaxID=186802 RepID=A0A1Y4HWZ4_9FIRM  ali  26  1MKKLAKIAAFLLAAVMTVSAAGQKSGKLMMSTNAEFEPFEYKDG-GEVVGIDIEISQKIAEALGVELEVTDIAFDSLIPALQSGKADLVAAGMTADEERRKSVDFSDPYFNASQAIIVTSDSE-IAGPEDLADKTVGVQLGTTGDQYCTNEKGETVAEVRRYNKGMEAVSDLMAGRIDAVVIDNFPAQKFVENNPDA-------IKVLDTALTEEEYAIAVPKGNTELLDKVNEVLASLEESGELDEIVGKY........ 256
335 3.000e-88UniRef50_B0SZW2 Extracellular solute-binding protein family 3 n=11 Tax=Proteobacteria TaxID=1224 RepID=B0SZW2_CAUSK  ali  28  40......................ESSKTLRIGLEGTYPPFNFQDKDGQLAGFEVDFAKALAAQMKVKPEFSPSPFAGLLGALEAKRIDVVINQITITPERAAKYDFSRPYTISGIQIIVRAGQTGISTPADLAGKKVGVGLGTNYESWLRKTVPT--AIVRTYDDDPTKYQDLKAGRIDAVLNDRLVAADFVKTSPD--------FVASGPAFASQGMGVAM-LRDPALKVAIDQAIDALRANGQLTAISMKWFGADV... 263
336 3.000e-88UniRef50_A0A1B2EC34 Uncharacterized protein n=12 Tax=Microvirga TaxID=186650 RepID=A0A1B2EC34_9RHIZ  ali  34  10.RKLAILAAAMLGLSAFAAQASRPKSVVRIAVEGAYPPFNFIDANNELQGFEVELLKSLCEAMDTECELVQHEWDGIIRALVNREYDAVMSSLEITERRQKRIAFSDPYYRIPAVFIGSKETPGAVTPAAMAGKKIGTIERTDHEAYLKTFY--KNSEIVLYAKAEEANLDLLVGRIDAVFADELLLSKFLGTR-EGACCHIVGDAPAEPAYKRESYGIGLRKEDEELRERFNRAIAQVKADGTYDRIRAKYFPFDI... 267
337 3.000e-88UniRef50_A0A084GJ26 Amino acid ABC transporter substrate-binding protein n=8 Tax=Bacillaceae TaxID=186817 RepID=A0A084GJ26_BACID  ali  29  44......................KEEGVLVIGTEGTYPPFTFHDDSNKLTGFDVEIAQEVAKRLGVKAEFKETQWDAMFAGLDAKRFDMIANQVGIKPEREEKYAFSDPYISSAAVLVTHKDNKDIKSFKDLEGKKAAQSLTSNYGEIAKEN----GAELVGVEGFTQAIDLINSKRVDATINDKLSVLDFQNQRKN------APIQIVDESKDAAQSGLMFRKDSGKLVEEVNKALAEMKEDGTYKKISEKWFGEDVS.. 269
338 3.000e-88UniRef50_A0A2G2DPG4 Nickel transporter n=1 Tax=Desulfotalea sp. TaxID=2030813 RepID=A0A2G2DPG4_9DELT  ali  30  1MRKIICILIVVGLGAIFSSASAQN--VVRIANETATPPFNFVDGDGNIKGFDVDIAAALCAELGVKKVDIIQDWDGMIPGLIAKKFDAIISDMSITDKRLKVVNFSQSYYDEQGLFLTLKGKTIDFSVEGMKGKKIAVQRATTFANYIKGIYGSS-VDIKYYETPASQILDLFSGRVDLILASDVFVHKTI-ESEDGAKLEIVGSPVIDSKYIGDGVGIAVRKQDTELLKSFNKALDTIKSNGTYDKIYDKWF....... 249
339 3.000e-88UniRef50_R7BWK5 Uncharacterized protein n=1 Tax=Sutterella sp. CAG:397 TaxID=1262976 RepID=R7BWK5_9BURK  ali  29  1MRKTTLCAVLFAAAFGVHCAQAAQ--TLRVATESTFPPFEYVNTKGDIEGFDMDLIRLLAKKAGYNIEIANMGFDAIVPGILTNTVDIGAAGISITPQRAKRVLFTDPYYTSGLSFVIREDKTKLKSIKDLDNQPICVQIGTSGAMRAAKI---PGATVRTYNGLNEAYTELLNGGCRAVLNDKPVNGYFMAKSNKSKRYHHV----TDESLKAEEFGFAVSKERPELLEKLNKALREARKNGEYQALYTKYFGE..... 248
340 3.000e-88UniRef50_A0A1H3W453 Cystine transport system substrate-binding protein n=68 Tax=Bacteria TaxID=2 RepID=A0A1H3W453_9BACI  ali  27  45....................QIQEKGVLTVGTEGTYPPFTFHNDQDELTGYDVEVAREIGKRLDLEVKFNETKWDAMFAGLNAKRFDMIANQVGIRPDRQEKYDFSEPYTVSTAVLVAKKGNEDIKTFEDIEGKPVAQSLTSNYADIAKEY----GGEIQSVEGFNEAMQLTASGRVEATINERLSVLDYINQKGDQAPVEIV-----DRQEDAAESAMMFRKGNQDLVEAVNGALKEMKEDGTLAEISNKWFGEDVS.. 273
341 4.000e-88UniRef50_A0A1G7VGG5 Polar amino acid transport system substrate-binding protein n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A1G7VGG5_9BRAD  ali  36  1MLKPILVAAGLLSALTTGAAARD----IKVGSECTYPPFNYRDAKGELQGFDIDVAREIGKRLNANLVFVCQQWDGMIPALLAGKFDLIVASMSITDERKKSIDFSVPYRSSTARFVGAKSADGKPDPKALAGKTVGLQRSSTYEQFMTKEFP--GVKLAQYDTVDNLLLDLQSGRIDLAFAGPIKLDGDFLQKPRGEKFHFVGPEINNIALFGPGVGVALRKEDSALRDQIDAALNASFKDGSFKAINDRYWSFSV... 258
342 5.000e-88UniRef50_A0A0G3Y423 Glutamine-binding periplasmic protein n=15 Tax=Bacillaceae TaxID=186817 RepID=A0A0G3Y423_9BACI  ali  27  4MKKGLIVAVVAALFMALAACGKSTKQKITVGTDAAFAPFEYM-QKGKIVGFDADLLDAVMKEAGLDYELKNIGWDPLFASLQSKEIDMGISGITITDKRKQSYDFSAPYFEATQVILVKQGSPVKNAL-DLKGKTIGVQNATTGQEAAEKLFG-KGDHIKKFETSVVAIMELLNGGVDAVITDNAVANEYVKNNPNKKLQVIEDPK----NFASEYYGMIFPK-NSELKAKVDEALKNVINSGKYTEIYKKWFGK..... 262
343 5.000e-88UniRef50_A0A1V6EAF0 Cystine-binding periplasmic protein n=1 Tax=Spirochaetes bacterium ADurb.Bin110 TaxID=1852908 RepID=A0A1V6EAF0_9SPIR  ali  25  78.........IILLIPLSIEQAKQKNSKIIIATDATWPPMEYVDENKNIVGFDIDLVNEIAKAAGFEVEIKNTAWDGIFAGLAAGNYQAIASSVTITDERKKTMDFSEPYVNAGQVLVVRKGTTGVTTLADMVGKKVGAQIGTTGAI---EVGKVQGVQLKTYDEVGLAFEDLANGNIDGVVA--PIAANFALQNASYKDKLM----IVGKPFTDEWLAFAFKKGDTKTQKLFNDGLAKVKSSGKLDEIIKKWFKY..... 314
344 6.000e-88UniRef50_A0A256CGR0 Arginine ABC transporter substrate-binding protein n=4 Tax=Ignatzschineria TaxID=112008 RepID=A0A256CGR0_9GAMM  ali  33  1MKKRLGLLLVAAGLLSSTTLYAQD--KLVVGTNPAYPPFEYKGENNELLGFDIDLMNEVCNVLEKECVYSEQEFDALIPNLRLRRYDAVISGMDITEERAKQLAFSDPYYQNYSIYITKEKADQIKDVAD---AKIGVLSGSTHQQYIRDTY--KGANVSVYPQYPAAMSDLAIGRVDVVFGDGEVVNDYMKENDN---FVVVGEKVTDPKYFGQGLGIGVGKRNTELVDQINAALKEVKESGKYDEIYSKWF....... 244
345 7.000e-88UniRef50_A0A1C3WRG4 Octopine/nopaline transport system substrate-binding protein n=66 Tax=cellular organisms TaxID=131567 RepID=A0A1C3WRG4_9RHIZ  ali  36  1MNFKVLSLIALLAGFAGSACAA--EGELSIGTEGAYPPWSMADAAGNVTGFDADVGNLLCTKLQMKCHFVVQAFDGLIPALKAKRFDVIISGMSITADRKKEINFSVGYADLANMFVVPKTSDLIKDVDSLDGKTVGVQTGTTHAHFIEKRVPK--ANLKTYDTLDNLQIDLASGRVDAAFADASALQDFLAK-PDGKDFQFVDVKIPGDPSLGEGLGVGIAKENTDLKAKIDKALCALVADGSIGKASKKWFKSDIS.. 261
346 7.000e-88UniRef50_A0A2P8KHG0 Uncharacterized protein n=1 Tax=Variovorax sp. WS11 TaxID=1105204 RepID=A0A2P8KHG0_9BURK  ali  37  22......................KEWKEVTIAMDATYPPFESVGPDGKLVGFEVDLSNALCEELKLKCKLVNVAFDALIPGLVTKKSDALITSLNINEDRKRVIDFSEPYYRMENRFVAKKGANIPISREGLKGKKIAVQAGTAQASYVRKFYGD-IADVKYYQGASEPYLELLSGRADLHFGFVVQINDSFLSK-DGKGYEFVGPSVSDDKTLGEGVAVAVRKDDKELKALFNQGLQSLRKNGTLKKINDKYFPF..... 254
347 8.000e-88UniRef50_Q9RWV1 Amino acid ABC transporter, periplasmic amino acid-binding protein n=22 Tax=Deinococcus TaxID=1298 RepID=Q9RWV1_DEIRA  ali  36  34.......................NQGTLKIAMEGTYPPFTSKNEQGELVGFDVDIAKAVAQKLNLKPEFVLTEWSGILAGLQANKYDVIVNQVGITPERQNSIGFSQPYAYSRPEIIVAKNNTFNQSLADLKGKRVGSTLGSNYE---KQLIDTGDIKIVTYPGAPEILADLVAGRIDAAYNDRLVVNYII--NDQKLPVRGAGQIGDAAP-----VGIALKKGNSALKDQIDKALTEMRSDGTFEKISQKWFGQDV... 258
348 8.000e-88UniRef50_A0A2M8PDJ5 Uncharacterized protein (Fragment) n=2 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2M8PDJ5_9CHLR  ali  32  68.........................GELIVGTDAAYPPFENVNETGEIEGFDIELLNAIAAKAGFTPVYQNVPFDTIFTNLAAGQYDIVISATTITEERQQTVLFSNPYFAAAQVLTVRADAETLKSVEALAGKKVGVQKGTTGADYAKSL---GGFDVVEYETTPEAMRALANGDVDAVIADDAPSKTILLNNPELN------LAITVEALTVEYYGISVRRECTELIEAINAGLAEVIKEGTYAEIYRKYFGVD.... 291
349 9.000e-88UniRef50_A0A2S7MZL1 Amino acid ABC transporter substrate-binding protein n=5 Tax=Bacillaceae TaxID=186817 RepID=A0A2S7MZL1_9BACI  ali  29  3MKKGFLYLVMLTVIVVTAACGIKEQGVINVGIEGAYPPFNFYNSSNELEGFDVDITNEIAKRMDVKVNFVATPWDSIIGGLLSNKYEIIISSMAITEERKEKVDFTEPYYRTGAQLFAPADTGMKDAKTDLKGKKIGVVTGTTFTQEVEKL----GGEPVLYKSDLLSFQDMANGRIDGAITDKAVGGNIIVENDYDA-------VAVGDILYDEVAGITVNKDEKELVKEIDRHIKEMVKDGTYADISKKWFGTSIY.. 263
350 1.000e-87UniRef50_E8LHB7 ABC transporter, substrate-binding protein, family 3 n=3 Tax=Succinivibrionaceae TaxID=83763 RepID=E8LHB7_SUCHY  ali  25  19MQRLLRFFAMGLCAAVISTSSAAEGGTWRVGCDAAFAPFTFTDSKGELIGFDVDLIRAMGKSRGVEVSIKSYPFDSIIPTLITDNIDLIISGFTITPERAERVDFSDPYYRCGLTFLTLENADKYKTLEDLKDAEICVQLGTSGAVFLEKAMP--NAKIKRFNSPPETYLELIGKGCAAVLNDRPVNDYFMVTSGRK---DIVSRNITTDD--SEYYGIAMRKGDKQMVDLVNKALKDVQENGEFERISKKWFGYDVS.. 276
351 1.000e-87UniRef50_D8IUR2 ABC-type amino acid transport/signal transduction systems, periplasmic component/domain protein n=171 Tax=Bacteria TaxID=2 RepID=D8IU  ali  25  10..RALALTAGFVGMLGLAACGKQEDKVYVVGVESAYAPFSSENEQKDVVGFDIDIMKALAKKIGIEVKFVPTPFEGFFNFLAQGDRDLLISAITITDERKKSVAFSEPYFVATQTIALPAADTKVSKMEDLKPLTVGTQSATSGDELVQQVLGKNSAKIKRFDSTPLALKELESGGVDAVVADEPVVKNYIANNPNSKL-----RTVTDPSFPKEDYGIAVRKDDPELLAKINKGLAEMKADGSFAAISAQYFGK..... 271
352 1.000e-87UniRef50_A0A1G7RWE7 Amino acid ABC transporter substrate-binding protein, PAAT family n=5 Tax=Bacteria TaxID=2 RepID=A0A1G7RWE7_9GAMM  ali  30  6.KKASLLSALALGLGMSTLASAADQPTLDVVTDPSFVPFEMMDTDGQMVGFDIDIINEVADRAGFDINLNTMDFNGIIPAIQTGNVDIAIAGITITNERSEIVDFSDPYYDSGLRIMVAANDDSISNIDDLAGKTIGTKIGSTSYDFLTENLGDE-ATITPYPGSSDMYMALLGGSVDAVFYDAPNVGYFSKTRGEGRA------KVVGPLYEGQQYGIALVKG-SEWVEPVNEALAAMREDGTYDDIHEKWFG...... 251
353 1.000e-87UniRef50_A0A080UQR2 Arginine-binding extracellular protein ArtP n=86 Tax=Terrabacteria group TaxID=1783272 RepID=A0A080UQR2_BACIU  ali  31  1MKKWLLLLVAACITFALSACGSSSKKKIIMGTSADYKPFEYKDGDN-IVGFDVDLAKALAKKAGYEIEVQDMDFNSLITALKSKQIDMVLSGMTPTPERKKQVDFSDIYYTAHHMIVSKKDSG-IDSLSDLKGKTVGVQLGSIQEEKGKELSPDYDFKTEDRNRISDLVQEIKSGRFDAAIIEDMVAEGYFNSNEDLQ-----GFTIPDAKAEEAGSAIAFRK-DSDLTDKFNKALKEMKDNGELDKLKKKWF....... 251
354 1.000e-87UniRef50_A0A1G3WGP9 Uncharacterized protein n=5 Tax=unclassified Tenericutes TaxID=713063 RepID=A0A1G3WGP9_9BACT  ali  29  1MKKLALFVLTLVLVAALAACQEEERGYFIVGLDDTFAPMGFRDTEGNLVGFDVDLAKEVSTRLGIELRFQPIDWDAKVLELNAGTIDMIWNGLTITESRLEEMAFSNPYIKNTQMIMVKNGS-SIETIDDLAGKKVGVQLSSASQEAVEGNTILTQGELVKYDTFNLALLELENGTIDAVAIDEIMGRYIISQNEGVYD-------VATENFGEEEYGIGFRLESTDIRDEINQILIEMIEDGTAAEISIKWFDEDIF.. 260
355 1.000e-87UniRef50_UPI000411386F basic amino acid ABC transporter substrate-binding protein n=1 Tax=Aneurinibacillus terranovensis TaxID=278991 RepID=UPI000411  ali  27  45.............AAQGNGSGAGAKKTIHVGTDAAYPPFEKQGPDGVPVGFDMDIIKAVAKVNNWDVDLKHTGWDPLFEAIKTGTRDVGISAITIKPDRQKLYDFSEPYFDAYQLIMVPEDSKVTK-AEDLKGLRVGVQNGTTGADLAEKILGKGSPNLKGYDDTPSAVEDLYAKRVDAVVADNGVLNDYLRTS-GKKGFKVV----KDPKVQPEQYGIMVKKGNKELLDAINNGLKTIKQNGTYDQIYKQYFGE..... 280
356 1.000e-87UniRef50_A0A166TP42 Cystine-binding periplasmic protein n=31 Tax=Clostridia TaxID=186801 RepID=A0A166TP42_9CLOT  ali  27  1MKKIGMIMLSAIMVFTLFTGCGKDAGKLTIGLDDSYPPMEFRDNKNKLSGFDIDLGNALAQKLGVKLNIVVTDFNGIVLALQSGKFDVILASMSITDERKKKIDFVGPYIDGGQIIITKAGNSSIKTKNDLKGKIVGVQLGATGEQAAAKVSGIK--EIKKYDKITEAFHEVNIGRIDAVVCDAQVGQYYISKDKSN-------YVILKDRLTKEPIGIGIKKKDKKLEEALNKALDDLKKDGTMSKLSTKWFGYDIY.. 262
357 1.000e-87UniRef50_C7NC24 Extracellular solute-binding protein family 3 n=3 Tax=Leptotrichia TaxID=32067 RepID=C7NC24_LEPBD  ali  26  5MLKMIMLVTVFMLTMACGSKSADGKKKYTIGIDTSFPPFEYK-KDSKYTGIDIELLQAIGKLEGFEVEFKPMDFGGLIPALQSGQLDGVIAGASITEERKKSVDFSDPYYESGLVALVNKGNSTIKTVKDLEGKRLVVKNGTAGAKFAEDNLKGK-ATIRVFEDSASTLKAVENNQADAAFEDYPVIAYTIKVNPNLN------VKIGTEKLTNNEYGFMVKKGNKELLEKFNKGLKTLKENGEYQKIVDKY........ 249
358 1.000e-87UniRef50_K6PRH7 Amino acid ABC transporter substrate-binding protein, PAAT family n=5 Tax=Firmicutes TaxID=1239 RepID=K6PRH7_9FIRM  ali  29  68......................KERGYMTFATDGAYPPMEFPDPENELIGFDIDLGKAIAEKLGVEHRAVVVDWDGILAGLESGRYDVVMSSMNITEERQKSADFVQ-YFEMGQMIVVAKGNPKIHSLDDLKGKVIAVQIGTTNEEIAR---GIEGATVKTFQTFPDALKEVHVGRADATILDEPVARYYA--NIEGDKYEFVG-----EPFERAPVGIAVAKGNEDLVQAIQKALDELKQDGTYDQIYAKWFG...... 291
359 1.000e-87UniRef50_A0A261FK73 Amino acid ABC transporter substrate-binding protein n=5 Tax=Bacteria TaxID=2 RepID=A0A261FK73_9BIFI  ali  26  6.KKMLAGASAAALVVPLLAGCGSSSTDLIVATDTSFVPFEFKEGD-SYTGFDIDLWDAIADDLGIEYELQPMDFNGILPALQTGQVDAALAGITITDERKQAIDFSDGYYDSGFSVMVAADSD-ITGFDDLAGKTVAMKTGTSAAQWAEENLTDT--TIKLFPNIDNAYLELQAGGVDAAIHDTPNVMYYITQNGDGKVKKV------GDQVEAQQYGIAFPKGSS-LTAEVNQALDDLKNDGTYNTLYKKWFGE..... 255
360 1.000e-87UniRef50_A0A1S1V5V9 Cystine-binding periplasmic protein n=18 Tax=Bacteria TaxID=2 RepID=A0A1S1V5V9_9FIRM  ali  28  1MKKRLLLLMISATMLIAGCSGSEDKGKFVVGLDDSFPPMGFRDESGEIVGFDIDLAKAAAEEMGMEVEFKSVDWDGVLLSLKKGDIDVIWNGLTVTEERKAEINFTEPYLANRQIIVVKSDSD-VKSKEDLSGKVLGLQLGSSSEKALDSEFSDSLSEVTKYANNTEALMDLSAGRVDAVLVDEIVGRYYMSKKEG-------EFKVLSGDLGEEDYAVGVRKEDGEFLKKLNEALKKVKSSEKGSAISDEWFGEDI... 265
361 1.000e-87UniRef50_A0A2W5KLH3 Amino acid ABC transporter n=1 Tax=Starkeya novella TaxID=921 RepID=A0A2W5KLH3_STANO  ali  34  24....................SAKDWTRIRVASEGAHPPFNSLDAMNQLQGFEIDLAREVCRRLRATCEFMTQDFAGIIPALIAGRYDIAFASLTITPPREANVAFSKKYYDARAMFVDNKAKPVASTPKAMKGLKVGAKIASTSARYLQDHYVPQGAVLKLYHTIDEARLDLAEGRIDALLGDKTAMVYWLANSPLARCCEVTGDDLTDPAYFGRGVGAAMRKDDVELKELVDAALTAIRADGTYSALRKKYFSFDPY.. 262
362 1.000e-87UniRef50_A0A0U5B2G7 ABC transporter arginine-binding protein 1 n=6 Tax=Aneurinibacillus TaxID=55079 RepID=A0A0U5B2G7_9BACL  ali  26  1MKKKLLIAMLALTVFAVGCGSGQAANKIIVGTDASFPPFESLAPDGKPEGFDIDLINAIAKSQNMNIEAKHVGWDPMMAGLENGSVQVGIAGITMNDDRKKQFDFTDPYFTAKQAILLKNSAPDVKTIADLKGKKIGVQSGTTGQAVVEKNFGKGYTGLKGFDDIASAIDDMKNGRIDAVVADNAVIKKF-KEQLQLNDVKIV----EDKTINQEQYGIAVKKGNKELLNTLNKGLKAVKADGTYDKIYAKYFNK..... 256
363 2.000e-87UniRef50_UPI000A0446FA nickel transporter n=2 Tax=Halomonadaceae TaxID=28256 RepID=UPI000A0446FA  ali  30  6.KAVAAISVTAACLGALPGHAIAANERVRLILNIPYEPFEFRNKDGELAGFDIDLGNAMCAQAKLSCSWSEQGWESLLPSLMTRKADAIMSGMTISDDRREQVLFSDPYLIQPSGWFAPVDSPLSNTTDTLRHQRIGVQRGSSQDRYATDLYGQHN-DIRRYASADDAVNDLMASRLDITLFDYPTGQSALLEASPGR-FRLVGAKIQDERYFNDGFGIAFRKRDQALAERFNRALAELKENGTYQKLVDKYFPE..... 258
364 2.000e-87UniRef50_A0A193G9A6 Glutamine ABC transporter substrate-binding protein n=7 Tax=Burkholderiales TaxID=80840 RepID=A0A193G9A6_9BORD  ali  32  1MKRRVLQAALALCPVLWAAAAHAQQDVLRVVTDATFPPMEYV-ENGKLTGFDIELVEALAKAMGKKVEWTQIDFKGLIPGLVARRYDMAVSAIYITDERRKVVDFGDSYYAGGLVAMVKADNTAIKTPKDLNGKQVTVQVGTKSVSFLKEHFPD--VKLVEVEKNDQMFNLVAIGRADAAVTGLPAAYQYVRTRG--------GLRVLPEQLTTEAYGMAVRKDLPEVTASLNKALAQLKADGTYDAIVKKWF....... 248
365 2.000e-87UniRef50_A0A1A5X6Z9 Uncharacterized protein n=2 Tax=Paraburkholderia tropica TaxID=92647 RepID=A0A1A5X6Z9_9BURK  ali  33  1MKRYARLLLITAACATLGAAHAKEWTQVNVATDATFPPFESVAPDGSLTGYDIDLIHALCDRMQVKCNVINAAWSGMFPGLLGKKYDALISSLNITEERKRVMAFTDVYEFPVYRFVGPKSEHLAITPEGLKGKTIAVQTGTPMDNFITQRFGN-VATIKRYESGSEPYLDLASGRADLHFSYQAQIDSSFLSKPENAQFGLIGPAYTDSQALGEGVAIAVRKQDDDLRLKFNTALAQLRKDGELKKINDKWFG...... 258
366 2.000e-87UniRef50_A0A0J8D9Y6 Cystine-binding periplasmic protein FliY n=3 Tax=Firmicutes TaxID=1239 RepID=A0A0J8D9Y6_CLOCY  ali  28  1MKKIFLVVIAILSLSMLLTGCGKDKGKLVIGLDDGFPPMGFRGENGQIVGFDIDLAKEVGKKLGVEVEFKPIDWNAKEMELKTKKIDAIWNGMSVTPEREKNMALSKPYLNNTQAFVVKKDST-IKSIADMKGKKIGFQKSSSQEAFADKNLSSSVASNQVYPKNKDVLVDLKVGRIDVALMDKVVSKYYLAKEKDQYVF-------LNENLGEEAYAVGFRKGDVKLRDEVNKILDELKKNGTTSNISKTWFGEDI... 267
367 2.000e-87UniRef50_A0A1J4YSF5 Uncharacterized protein n=3 Tax=unclassified Elusimicrobia TaxID=1797919 RepID=A0A1J4YSF5_9BACT  ali  34  22.................ACSRTNDTNILKIGTDATYPPFEIIDTTGELVGFDIDLMKEICKEISKKPEFIIVPFDGIIAGLKQKKYDAIISAMTITDERSKEVGFSKPYFLAGQSIVVREDNNSIKSLNDLINKKIGVQLGTTGEIEAKKIL---NVVVVSYDNISAAFIDLKNGRIDAIINDIPTNRLIVNQKGKMK--------IVGEPLTKECYGIAVRQEDKKLLELINCTLDKIQKNGIQRKLYRKW........ 246
368 2.000e-87UniRef50_W0P8B1 Histidine-binding periplasmic protein n=5 Tax=Alcaligenaceae TaxID=506 RepID=W0P8B1_9BURK  ali  50  24..........................KLRLGIDPTFAPFESVNPQGELVGIDVDMGKSICKRIEADCEWIRMNFDGVIPALKAKKIDGILSGMTITKEREKQVLFSDVMYASSTRLMVPSGSGLDTTAESLKGKTVGVVQGTTQAAYADKHWKGKGIDLVSYQNDDLAKQDLALGRVDATLQDAAAATIFF-DSPDGKNFKLVGTPVSDADVFGNGNGIGLRKEDTELKGKIDKALADMKADGEYAKIYKKY........ 252
369 2.000e-87UniRef50_A0A1G6ID68 Amino acid ABC transporter substrate-binding protein, PAAT family n=1 Tax=Succiniclasticum ruminis TaxID=40841 RepID=A0A1G6ID68_9  ali  26  1MKKLLAVLVFLVLLVTVGCGGGKNEKELVVGTEAAFAPFEFTDEKGKLTGFDVELIQAVAQEIGFKCTVVNMDFDALIPAVNSGKADVAISAVTINDTRKRVVLFTQPYYKSGLAFIVRKDVKDVKTFEDLKGKTIAVQKETTGEVYARQ-LEEKGAVIKAFASNEQAFTELKNGKADAVVCDLPVLQYFLKNGGSAFA------SLAGNPLTVEEYGILMGKKKPDMQKAMDKALDNLKRNGTYDKLYEKWFGK..... 259
370 2.000e-87UniRef50_B9ML21 Extracellular solute-binding protein family 3 n=13 Tax=Caldicellulosiruptor TaxID=44000 RepID=B9ML21_CALBD  ali  27  36......................KKTKEFVVGMDNTFPPMEFTDDNNNTVGFDVDLANEIAKKLGAKLKIVAVDWSGIQSALKSKKFDAIISCFSITDERKKAFNLAGPYLYIRQVIAVKKGDSSIKSFEDLKGIKIGVQANTTGDNAVQKMFINYEKDVTRYERITDAFNDLDIGRIKAVVIDSVVAYYYKKQNPEK-------FDIAPAQLEREPVGIALRKEDKDLYNEIQKILDQLKKDGTIAKISEKWFGEDI... 264
371 2.000e-87UniRef50_A0A1I5VT34 Amino acid ABC transporter substrate-binding protein, PAAT family n=16 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1I5VT34_9LA  ali  29  37.......................EEGKFVVGLDDTFAPMGFRDSEGEIVGFDIDLANEVGEKMGVDVEFQSIDWALKETELKSGNIDAIWNGYTITDERKEQVDFSTPYLENSQIIIVLEDSE-IQTKEDLKGKAVAAQQSSSAVDAINADPSNANGEVVLYPSNNDVFNDLASGRSEAIVVDETLGRYYMKQNAD------VEYRVLEDNFGEEEYAVGTRKEDDKLTEAINSALEEMKSDGTFDEIYAKWFAE..... 266
372 2.000e-87UniRef50_A0A2W4NIZ5 Amino acid ABC transporter substrate-binding protein n=1 Tax=Proteobacteria bacterium TaxID=1977087 RepID=A0A2W4NIZ5_9PROT  ali  27  43.......................ATGVMRVGLEGTYPPFNFVDENNQMAGFDVDISNEIARRLGVRAEFVGTLWSSLIAGLQTDKFDVIIAQMTITEERKQSVDFTNPYVITGAVLVSRANDNRFSKLSDIAGHRVGVGIGTTFEEVARSV---PGADVRTYDSFQEYAQELLTGRLDVIINDQLSVAYAIKQHG-------LPLKITSDIVNEDVIGIAVKKGNEDFVEMLNHILADMVADGTYQQIFQKWFD...... 263
373 3.000e-87UniRef50_A0A0A3I2Q9 Amino acid ABC transporter substrate-binding protein n=202 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0A3I2Q9_9BACI  ali  24  1MKRFSLVFILALILTIVAACGADEKETVIIGIDDTFAPMGFRDDNNEIVGFDIDLATAAAEHMGVNVEFQPIDWSTKESELSSGRIDLIWNGYTVTEERKEKVLFTKPYLENAQVVMTLADSE-IAALNDLSDKEVGIQALSSALDALNANPISEKIALNEYKDNVLALTDLQAKRVEAVVIDKVVGEYFMTQQADT-------FKILDETLAPEQYAVGVKKGNEELLKKIQAALDEMNEDGTSAEISTKWFGEDI... 258
374 3.000e-87UniRef50_A0A1M7YCI5 Polar amino acid transport system substrate-binding protein n=3 Tax=Desulfobacterales TaxID=213118 RepID=A0A1M7YCI5_9DELT  ali  32  30......................KNKGEITMAMSGQYPPFNFVDDKNELTGFDVEIGKEVAKRISVTGVPMSTAWDGIIAGLLANKYELICGSMAITEDRLKSIDFSDPYYRSGAQLFVKKDSPL-KTVADLKGKKVGVTLGTTYEKWVRENIAD--ADIRTYKGVPDMILEVSNGRIDGFITDKIVGALAIKDKG-------APIALAGDLLYEERMGIAMRKGNTELKTAIDTALAAMKEDGSYHDISMKWLGIDV... 254
375 3.000e-87UniRef50_A0A1G9KM12 Amino acid ABC transporter substrate-binding protein, PAAT family (TC 3.A.1.3.-) n=5 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A  ali  35  1MKSSLITAAGIAALISSTLSVAAQP--LKIGISAEYPPFTYKSSNGDWTGFEVELGLAICAEMQTECRITPTGWSGIFPALNAGKIDMIMNSLSITVARDKVIDFTVPYYFTPGAYVTAKGNDL-QIPEELDGKILGVQGSTTHASFARKALRDSGVEINVYNKQEQANRDLLAGRVDVILADKVAMTEFV-ERDAAQGYEIRATAPRHEAY-GEGVGIGLREDDDALEEKLNTAIATVLENGTCTQLSKQYFGTDICGS 256
376 3.000e-87UniRef50_A0A0M7HE32 Glutamine-binding periplasmic protein n=63 Tax=cellular organisms TaxID=131567 RepID=A0A0M7HE32_ALCXX  ali  26  3.KRKVAAALVGLSVAMFGAASGAQGKELVVATDTAFVPFEFKQGN-TYTGFDVDLWAAIAKELNVKYKLQPMDFNGIIPGLQTKNIDVALAGITIRDDRKKVIDFSDPYYESGLAILVGEKNTDIKDAKSLAGKTVAVKTGTATVDFLKAQVPD--AKLKLFPNIDNAYLELATGRVDAAVHDTPNVQYYANTAGKGR------VKVVGSVKSGDFYGIAFPKG-SELVPQVNKALATLKSNGQYDAIYEKWFGK..... 248
377 3.000e-87UniRef50_A0A0H4L897 Lysine-arginine-ornithine-binding protein periplasmic protein n=93 Tax=Proteobacteria TaxID=1224 RepID=A0A0H4L897_9RHOB  ali  43  26.........................DTLRIGVEGAYPPFSSKESDGTLVGFDXXXXXXXXXXXXXXXXXXXXXWDGMIPALKARKFDAIVASMSITEERKRQIDFSEKYYQTPARLVAPKDAGFEGTPEGLAGKRIGVQRGATHQCYAEKMFPE--AEIVLYGSQDEVFRDLALGRVDAQLSDSLIAQESFLSSDEGADFAFLGGDHTDVDCYGEGVGIAVRKGEEKLREDFSEAITALRENGTYAEINDKYFPFDIYGG 258
378 4.000e-87UniRef50_A0A2G5QPC2 Cystine ABC transporter substrate-binding protein n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A2G5QPC2_9CAUL  ali  25  27.............VGASAWDRIKASGTLRIGLEGTYPPFNFQDKNGQLAGFEVDFAKALAAQLGLKPDFRPAPFAGLLGALESGRVDVVINQITITPDRQAKYDFSEPYTVSGIQIIKLRDKPGLEKPKDLSGKKVGVGLGTNYEQWARANVPK--ADIRTYDDDPTKYQDLKAGRTDAVLNDRLVAADFVKTSPE--------FVASGPPFAAQGAGVAMKK-DPALKVIIDQAIEALRANGKLTAISQQWFGMDV... 259
379 4.000e-87UniRef50_A0A2I0N1W2 Uncharacterized protein n=1 Tax=Clostridiaceae bacterium JG1575 TaxID=1658742 RepID=A0A2I0N1W2_9CLOT  ali  26  5MKKIPALLMALTLVVSAAAAQVQETKKLKVGMETTYPPMEFTDEKGSTIGFDVDLMAAIAQKLGVQMDVVPTDFAGITEGLAANRFDVIASGMNITEKRKESVLFSDPYIDAGLSLILRPEEKDVKKFSDLAGKKIGLQQGSTADEWARS--QSNLGEVKEYLSISEALLDLSAGRIQAVVTDNVVGAYYIKKDPKN-------YQMPKELLEAGPLGIAIPKDAPELKAQIDAALKTLKAEGTLANLSEKWFGTNIY.. 266
380 4.000e-87UniRef50_A0A2A9LA88 Lysine/arginine/ornithine transport system substrate-binding protein n=2 Tax=Burkholderia TaxID=32008 RepID=A0A2A9LA88_9BURK  ali  44  1MKRVVHAVAVACAVFG-GPVHAEAGHVVRFGTEPNYYPFEYKTPDGKLAGFDYDIGSALCAAAGVQCTWVESTFDGLIPGIKARKFDIINSDFSATEARARVIDFSDMLYDVTRRLVAKKGANLQPTVASLAGKTVGVVQGTIEEIYVRQNWGAHGVNVATYQTADQAYADLANGRIDATFQNVQAAKKGFLSKPQGAGFDYSGAPIIDERTLGVGVALGFRKEDAALRERFNLALAKIKADGTLQQLVEKYFP...... 253
381 4.000e-87UniRef50_A0A1P8R825 Amino acid ABC transporter substrate-binding protein n=34 Tax=Proteobacteria TaxID=1224 RepID=A0A1P8R825_9GAMM  ali  26  18.....ALSTAVALGLGLSTAAVADLPSVDVVTDPSFVPFEMMDPDGEMVGFDMDIINEVAERAGFEVNLTTMEFAGIIPAVQTGNQEIAIAGVTITEERAEIVDFSDPYYDSGLQIIVRADNDDVETIEDLAGKSIATRIGSTSYDYLQETLGD-DADITPYPGNSDMYMALLGGNVDAAFYDAPNVAYFSQTRGEGR------TKVVGPLYEGQQYGIVFHQG-SEWVEPTNQALAEMREDGTYDAIYEEWFGES.... 261
382 4.000e-87UniRef50_A0A1B2F318 Putative ABC transporter arginine-binding protein 2 n=27 Tax=Pseudomonadales TaxID=72274 RepID=A0A1B2F318_PSEPU  ali  34  1MKKTLVAFVQTFILAGAINVAHADDKVVAIAQEP-YPPFSYKDSSGVWSGFEPELITEVCKRMQADCTLKELAWDGLIPALRSKQVDVIMNSLSITPEREQVVDFTEPYIETPALWVGDAALALTPTPEGLEGKTIGVQGSTSHSAYVKQYFGKT-STIRYYNDQDDLLADLRSGRIDIMLADKISVEPMLA-LPDNAMLESKGVAPADP-LFGKGIGAAVRKGDDALREKLNKALKSVREDGTYDAIGARYFK...... 251
383 5.000e-87UniRef50_A0A1G8RX94 Amino acid ABC transporter substrate-binding protein, PAAT family n=2 Tax=Ferrimonas TaxID=44011 RepID=A0A1G8RX94_9GAMM  ali  27  1MKKTLAALSLTLIAL---TGCNKKEDVLVVGTNAAFPPFEYIGGADEIKGFDIDIVKQIAEDSGKTLKVENMKFDSLIVALNSGKIDMIAAGMTITPERQASVAFSDPYYEATQVVITQKQDDQIHSVDDLKGKHFAVQLGSTGDIMAKTFTE----QVTAFNTGFEAMMELKNGKVDLVLFDSEPAANHLQKNPNLKLQKL--------NFDPEYYGLAVSKDNPELLKQVNASLDAMKSNGSYDALITKYMK...... 241
384 5.000e-87UniRef50_A0A072BSD6 Lysine-arginine-ornithine-binding periplasmic protein n=83 Tax=Rhizobiales TaxID=356 RepID=A0A072BSD6_RHILP  ali  32  34......................QERMPMRVAVEGAFPPFNYLDANNKLQGFDIDIANALCETGKFECQFIIEKWDDMIPDLVAGKYDAIISSMSMSLERRQKVAFTEKYYNSPSVFIARKDSPIDVSPPALNGKKLGVTSSTAQESYANHFYPDMKKTV--FRSSPELYKGLSDGRVDIILEDKLAIYDWIANTKAGTCCAFKGPDLVDVTYFGEGAGIAVRLDDKERLARLNEALKTIKEDGTYDMINAKYFPFSI... 267
385 5.000e-87UniRef50_UPI000DA1C9CC amino acid ABC transporter n=1 Tax=Salinicola sp. CPA62 TaxID=1949082 RepID=UPI000DA1C9CC  ali  38  18..RLALTLVSLSTLCALPAAAAD----YNIGISSEYPPYYSPDASGEWSGWEIDFADELCRRLGSECETVPLAWEGIIPALKTGKIDMIIGSMAITPQRQEQIAFSDKYKHSPTGLLALKQSEVEPSADSLEGAYLGVQSGSIQENYARAYYAES-ANLQVYQTLDEELQDLDAGRLDAVLGDIVAMQAFMTSERGQACCEFRGTVAPDQSILGYGVGVGMRKSDQDLKEAVNVAIADIRADGTFERLSAPYFDFDIYG. 270
386 5.000e-87UniRef50_R4K1A4 Periplasmic component of amino acid ABC-type transporter/signal transduction system n=892 Tax=cellular organisms TaxID=131567 RepID=R  ali  28  1MKKLLAIIIGIFLVTLGASGCSKNAGVISIGTEGTYAPFTFHDSNGTLTGFDVDIATEVAKRIGVKPKFVETKWDGMIAGLDSNRFDIVANEVAITPERQQKYDFSSSYITSKAVLIVNKDNNSIKSFSDLKDKKAAETLTSNLAKIATAN----GADLVQVDGFNQAIDLLNSKRVDATINDSLSFYDLIKQKPDTQ------LKIADTDKNADKNAIILKKNKKELLDAINKALADMKSDGTYLKISQKWFGTDVS.. 262
387 5.000e-87UniRef50_A0A265Q5D3 Amino acid ABC transporter substrate-binding protein n=5 Tax=Firmicutes TaxID=1239 RepID=A0A265Q5D3_9FIRM  ali  27  1MKKLKFLVVSVLILGLIFSGCIEERESIIVGLDDTFVPMGFRDKDGGLTGFDVELAREAALRMGLKVEFQPIDWNLKEQELDSGNIDLIWNGYSISEDRLKKVNFTKPYLDNRQVIVTL-NSSDINTKEDLKNRIVATQNSSSSLEALEKIKDFKNAEAILFDTYNEAFMDLEAGRVEAVVADQVLARYYIAERGEEK------YKVLNDDFGDEEYGVGLRLGDKVLLERLNKALDEMKKDGTAKAISEKWFGENI... 265
388 6.000e-87UniRef50_A0A1S9EP91 ABC transporter substrate-binding protein n=97 Tax=Rhizobiales TaxID=356 RepID=A0A1S9EP91_9RHIZ  ali  35  1MKVSQLLCLLPIVIALVGHANAQESKTITIATEGAFPPWNSVNSSGEVEGFDVDVGKALCERAKISCRFVAQAWDGIIPGLTVGKYDAVMAGMSITEKRKKVIAFSEPYALTSNYFVV-ANSTGLHAMDNLKGRILGVQGATNAEAFVREVLGE-DVEIRTYDKQDNLNLDLLAGRIDGGLADYSVWKAFL-DADGGKVASLYGPRISGGVF-GPGVGIGLRKNNSNLIRLFNRGIQAMKQDGTLKSFSMKWFGID.... 275
389 7.000e-87UniRef50_A1WJ74 Extracellular solute-binding protein, family 3 n=2 Tax=Verminephrobacter TaxID=364316 RepID=A1WJ74_VEREI  ali  31  22...................SASHAQQSIRIGVEGEYAPFNEVDKDGKVKGFDVDIANALCDEMRVKCSFVIQTWDGIIPALISSKYDMIVSSVLITEKRKKAVAFSKPYYTDQAVIVGPKGKAMTIRSDGFEGKTIGVQTASVYEKILKEKFPT--ATAKSYAAVPDHNLDLGNGRLDAVLAAQLPMLEWLKTN-EGKNFEVKGQPFMDAKFMGAGAGVALRKGDTGLLNKVNAALDTIFKNGKYDAINKKYFPISI... 256
390 7.000e-87UniRef50_A0A077J898 Glutamine ABC transporter substrate-binding protein n=25 Tax=Bacillaceae TaxID=186817 RepID=A0A077J898_9BACI  ali  25  1MKKWMATLIVSAFLLVLSACGASEKKTLRVVTDAAYAPFEYQD-KGEVVGFDVDFIKAVAKQAGYEVKVEHVGWDPLFVEINGKTADLAVSAITINDDRKQTYDFSVPYFLSTNKILIPKDSD-IKSAADLKDKVVAVQNGTTGQEAVETLLGKENKNVKKFKDNNLAIMELKNGGADAVVADNTVIEEYVKNNPNENFIVIE----DEGAFDKEFYGVLFPKESK-LKAEFDKAIKEMMENGEYAKIYKKWFKVD.... 258
391 7.000e-87UniRef50_A0A1F8N4X6 Uncharacterized protein n=1 Tax=Chloroflexi bacterium RBG_13_56_8 TaxID=1797632 RepID=A0A1F8N4X6_9CHLR  ali  27  1MKVRKWIVVLVVLGLVLTACRATPNGTVKIGINAEYPPFEYVNEQGEIVGFDPDLLAVIAEEGGFDYELVNTRWDGIFVALASGEFDAVMSAATILPDRAEIVDFSAPYFDAGQMIAVRADTADIKNADDLAGKKVSVQLGTTGDIWLTD---ETEAEVVRYDENTLAFQALANGDVDAAVADGPTAFDVVEANPEMN------LKVLPGVYTDEQYGIAVNKGSLDLLEAVNKGLAAAKSSGKYDEIYEKYFGE..... 247
392 7.000e-87UniRef50_F2BY25 Amino acid ABC superfamily ATP binding cassette transporter, binding protein n=16 Tax=Bacteria TaxID=2 RepID=F2BY25_9FIRM  ali  28  20............LVAGCGSDSAKKPKKIIAGLDDTFAPMGFRDENGNIVGFDVDIAKAVSKEIGVEIEFKPIDWASKESELNSGRIDCIWNGLSITPEREEKMDFTNPYMNNDQIYVVM-DNSDIKSASDLKGKRICFQEGSTVDLALNKNMDHSFGEIKTYPDFTSCFLDLDANRADAVLVDGILADYYMTKSPGK-------YRRLPEKLSTEPFAIGVKKGNEEIVKMLNEGIEKVKASGEAAKISQKWFQRDVIG. 265
393 7.000e-87UniRef50_A0A157SLS2 Amino-acid ABC transporter substrate-binding protein n=3 Tax=Bordetella TaxID=517 RepID=A0A157SLS2_9BORD  ali  30  1MKFSFRTLLVAGVMQLAALGAAKKAGAIKIGTEGTYAPFTFHDASG-LTGFDVEIGRAIAKQLGVKAEFVEGKWDGLIAGLDARRYDVVINQVGITEARQAKYDFSDPYISSPAALVVRNDNKDIKTFADLKGKRSANTLTSNFGKLAQSY----GAEIVPVQGFNESVDLLLSRRVDATVNDKLSFLDFKKQKPNAPLVAVAFADGRDLN----SSGVLLRKNNPELRDAINKALSAIKADGTYKKISEKYFGADLSAA 260
394 7.000e-87UniRef50_A5X2G2 GlnA n=1 Tax=Halobacillus dabanensis TaxID=240302 RepID=A5X2G2_HALDA  ali  29  32...................SSYALDETYREASDTAFV--EFMNETGEMEGFDIDLIKAIADEAGFNIEIESMKFDGVVAGMQSGRYDIGIAGMTITEERKETIDFSDPYYDAGLMLAVSADNDEIQSEDDLAGKKVGTRSGTTSETYITENHPD--AELVTFPGIVEAYMDLESGRLDAVMYDVPNVQYYVANDAE-------GLKTAGDILQGEQYGIAFPK-DSELVEDVNEALQTLIDNGTYDDIYEEWFGERKYG. 260
395 8.000e-87UniRef50_UPI000471DCD9 nickel transporter n=1 Tax=Carnimonas nigrificans TaxID=64323 RepID=UPI000471DCD9  ali  37  3.KPVALSAIGLLAACAITACSHGDDNQVRFVLNTPYAPFEFTDSNGELKGFDVDLGKALCKQADLQCSWKTQAWDSLIPSLLSRKADAIMSTMTISDERRQQVLFSDPYLVLPSGWFVPQASTIDISSDGLKGKRIAVQRGTLQDSYVTDNYAADN-TIVRYASLDDITIDLQAGRADISFVDVATGQETFIKGNQDKFKRVGDLISEPKKYFGDGIGIAFRPRDQELADKFNKALAELKSNGEYDQLVQHYFPE..... 258
396 9.000e-87UniRef50_E8T7K7 Extracellular solute-binding protein family 3 n=15 Tax=Proteobacteria TaxID=1224 RepID=E8T7K7_MESCW  ali  34  1MK--LKVLTLLACLAGSMGSALAAEGELSIGTEGAYPPWSMSDASGNVTGFDADVGALLCTKLAVTCHFVVQAFDGLIPALKAKRFDVIISGMSITADRKKEINFSVGYAELANMFVAAKGSDLITDVDSLDGKKVGVQAGTTHAHFLEKRAP--NADLKTYDTLDQMQIDLASGRIDTAFADQSALQDFLDK-PDGKNFQLVGVEITYDPTLGEGIGVGIAQDNTELKAKIDKALCELIADGSVGKASEKWFKTDIS.. 261
397 9.000e-87UniRef50_S6I2S0 Uncharacterized protein n=4 Tax=Bacteria TaxID=2 RepID=S6I2S0_9GAMM  ali  36  1MKKLLATAALTAVTLMSGAAQAGD--VVRIATEGAYPPWNALNSDGHLEGFEIDLYQVLCARANLECSMEQTAWDGIIPSLQQGKFDVIMAGMSITDKRKKKITFSRSYASSPAVFVVGKDSSMVDSLADLNGKTIGVQKGTIHLNFLKEYM-KGNATIRTYETQEQLDLDLQSGRVDVAFAAESYWHPLF-QKPEGADFRAIGPGFSEGPF-GEGVGLGLRKENQELADKFSVAINAAIADGTVSKLAVKWFGFDAS.. 276
398 9.000e-87UniRef50_R7INN6 Glutamine ABC transporter periplasmic glutamine-binding protein GlnH n=4 Tax=Sutterellaceae TaxID=995019 RepID=R7INN6_9BURK  ali  25  1MFKNLVMLVMAAAVTMACAGSALAAPVLTVGTEPTFQPFEFVDATKDFVGYDMDMIRAAAKHMGYQVKFVNMGFDGLIPALMTNNIDAAAAGMTITAERKKKVDFTRPVYQSTQVILVNKDAGSVKSEKDLKGKNICAQIGTVGAEFGRKI---PGAKVKAFNTLPDTILELNNRGCTAVIADKPVVEYFLKQRGGRNMVEVQ------TGYPKEEMAFAVRKGNKKLLDAFNKALAAMDKSGETAKIHQKWF....... 251
399 1.000e-86UniRef50_A0A1H4C371 Amino acid ABC transporter substrate-binding protein, PAAT family n=2 Tax=Eubacterium TaxID=1730 RepID=A0A1H4C371_9FIRM  ali  28  33...................GATNDDKTFVIGLDDSFPPMGFRDKDNNIVGFDIDLATEVAKRMGMEIKLQVVNWDTKEMELENDKVDALWNGLTITDERKAAMDFTNPYLENDQVVVVQKGSD-IANIAALEGKKVGVQKGSSAYDALMDNPKIDGGKPVEFDENVSALQDLASGRIQAVVVDSVVARYYISS-------ENADFTILSDTLSPELYGVAVKKGNTELRDKIQKAMDEMNADGSAAKISEKWFGENI... 265
400 1.000e-86UniRef50_A0A0K9GPW3 Uncharacterized protein n=5 Tax=Bacillales TaxID=1385 RepID=A0A0K9GPW3_9BACI  ali  33  1MKKVILSLFMVAIALVVTACGTKEKGEITIGLDDTLPPMEYRNDKNELVGFDIEFAEALAKELGVKVKFVPSAWDGIIPGLDAKRFDIILSSMNATDERKKKVDFVE-YFGVGQILAVKTGNPLIKSVDDLKGKIVGVQLGSTGETAANSINGIK--EIKKYDLTTDVFNDMGLGRVEAAVVGEMIGRYYMTTKPG-------EFEIVGEAFQVQPMGIAVRKNDNQLRDALEKAVRTVEGNGTLSKISEKWFEKDI... 273
401 1.000e-86UniRef50_A0A0A1MDH4 Glutamine-binding periplasmic protein n=40 Tax=Bacillales TaxID=1385 RepID=A0A0A1MDH4_9BACI  ali  25  46........................NDSYTVVSDNSFVPFEFM-EDGELVGFDIELITAVAEEAGFEIEIQTTNFDGIIPGLQTGQFEIAVAGISITEERKGTVDFSDPYYESGITIAVPEDNKDINSLEDLEGKTIATRLGSTSSQFLEENLEDK--TIDTYEQLDQVYMSVENGSADAAVYDLPNVEYYIATTGD-------GLKAVGDTYQAEDYGIAISKGNEELVAAINDALATLHENGTYDEIYDKWFGAS.... 269
402 1.000e-86UniRef50_A0A081NXQ1 ABC transporter substrate-binding protein n=69 Tax=Terrabacteria group TaxID=1783272 RepID=A0A081NXQ1_9BACL  ali  31  1MKKLLSMLVGAMLLAGCASSAASADGKFHFAMSGLYKPFNYK-ENGNLVGFDVEFGSELAKKMGVKAEPVTNPWETIIPGLLSKKYDAILGSMAITPERQKTVSFTTPYYRSGAQIFVAKTNETIKSANDLKGKKIGVLKASLFKSLAAERTDAG--NITEYDSDLTALLDLPTGRVDAVITDDLVGFRMIKES-------ATAIKAVGEPLTMQEMGIAVRKEDQALLDQLNKAIDEMVKDGTYDKLSEKWFGKNI... 264
403 1.000e-86UniRef50_A0A1C6AN53 Arginine-binding extracellular protein ArtP n=51 Tax=root TaxID=1 RepID=A0A1C6AN53_9FIRM  ali  22  1MKKVIALLTVAVLALSLAACGSKGKETLTMATNATFPPYEYYDDDNNIAGIDVEIANAIAEKLGMKLEIQDIDFDSIVTSVQSGKADIGLAGMTVDPDRAKNVNFTDSYATGVQVIIVKNDSD-ITGPDSLEGKKIGVQQGTTGDIYCSDDYGDE--NVVKYTSGPNAVEALKTGKVDCVVIDNEPAKEYVKANE--------GLKILDTEYVQEEYAAIVAKDNDELFEKVNTAIKELKEDGTIQKILDKYIK...... 255
404 1.000e-86UniRef50_Q746W2 Polar amino acid/opine ABC transporter, periplasmic amino acid-binding protein n=53 Tax=root TaxID=1 RepID=Q746W2_GEOSL  ali  28  9...MVLTLAAVCLTAAVPRQAEAAGRTVTVATDATWPPMEMVDANKKIVGFDIDFMNAIAKEAGFAVQFKNTAWDGIFAGLGAGRYDAIISSVTITEERKKQYDFSDPYINIGQILVVPK-TEKATNLSGLKGKKVGAQIGTTGAFEIKKV---QGVELKNYDEIGLAFEDMAAGRIVGVVCDEPTAAHYALQKAEYKNK----FKIVGKSFTAESYGIVVKKGDKELLALINKGIKAVKAKKVDEQLRKKWL....... 250
405 1.000e-86UniRef50_B6IV01 Arginine-binding periplasmic protein 1 n=2 Tax=Rhodospirillum centenum TaxID=34018 RepID=B6IV01_RHOCS  ali  33  4..RRTLGVMAVLLLAACGDGGQDGAQPIRVATESAYPPFVSVDPAGTLVGFDMDVVREICQRLDRRCDIIPQSWDGIIPGLLANRYDAITGGMTVTGERRRVVAFTRPYVSTPLRFFAPEGGPALITLDALAGRSVGVQSGTTAAEFADARLAP-GATVRRYDTHENLVLDLATGRLDVGLADSVVVEPYLA-SEEGKDTVIAGPAIEGGPV-GEGIGIAVRQGDVELRQQLDGALAAMQADGTLRALAVKWFGADVS.. 291
406 2.000e-86UniRef50_A0A0J1FVP6 Putative ABC transporter arginine-binding protein 2 n=28 Tax=Clostridiales TaxID=186802 RepID=A0A0J1FVP6_9FIRM  ali  29  42........................EKVLKVGSDITYAPFEFMDDKQQPTGFDMELIQAIGKDIGYKVSIETCSFDGLITALQAGKYNAVISAMTITPAREKSVTFSDKYFKSMQYIAMKKGSNF-KTLEDLKGKRVGVQLNTTGQFDCEA----KGITPKKYDTTPDALNDLLNGGVDAVVADSPVVLWFQAQNPTAQ------IESVPANVDPEYYGIAMKQGDKELASKVNASLKKLIDNGTYGEIYKKWFKKD.... 262
407 2.000e-86UniRef50_E8LLB7 ABC transporter, substrate-binding protein, family 3 n=3 Tax=Succinivibrionaceae TaxID=83763 RepID=E8LLB7_SUCHY  ali  27  8MKKVFAACALALSAF----CVSAQADTLKVGSHPTFAPFEFVDSEGKAIGFDIDLINAIAKANGDTVEIVSMPFDGLIPALVTNQIDAIISGMTITDARKERVEFTDGYYKSIQSVLIRKDAEKFKKVEDLKGQKICTQIGTTGDKFARTLSED----VIAMNNEPDALMELRNGGCAALINDRPTNLYYLLQSKATEIGELKDDSLY---LNPEFYGIAVNKNNKALVKRLNAGLEKIAASGELKSIHEKWFGV..... 252
408 2.000e-86UniRef50_A0A0B5WP04 L-cystine-binding protein tcyA n=17 Tax=root TaxID=1 RepID=A0A0B5WP04_BACCO  ali  26  1MRKYIKWLAVFSLLFALTACGKKSKGVLLIGTEGTYPPFSFH-KNGKLTGYDIDVAKEVAKRLGLKAEFKETQWDAMFAGLNSKRFDMIANQVGIRADRQKKYDLSTPYTISKAVVLVRKDNTNIKSFADLKGKKSAQSLTSNYADIAKKN----GANIVSVEGFNQAVQLLTSNRVDATVNDSLTYLDYKKQKPNAA------IKVAATANEASKSAFLFRKHSGKLTDKVNDALKDMKKDGTLTKISKKWFGEDVS.. 264
409 2.000e-86UniRef50_A0A021WWF6 Cystine-binding periplasmic protein FliY n=175 Tax=Proteobacteria TaxID=1224 RepID=A0A021WWF6_9RHIZ  ali  28  1MLKSILSYAVAAGLAFSVLGAIKAAGEFKFANSGAYPPFSFVDDSNQTVGFDVDIGNEIAKRLGVKGAGVSTAWDGIIAGLLAGKYDTIIGSMTITPEREKAVDFVGPYYKSGRGVFVSDGSE-IKSIDDLKDKTIGVTLGETHEKWARER---GGWEIRTYKGLPELFLELKAGRIQAMIVDAVPVSIAVKQTGD----KVVKLDVPEFAGTEDKIGIAIRKGNPELKAAMQKALDDMMADGTYEAIAMKWIGSDI... 260
410 2.000e-86UniRef50_A0A2W4NEC9 Basic amino acid ABC transporter substrate-binding protein n=1 Tax=Firmicutes bacterium TaxID=1879010 RepID=A0A2W4NEC9_9FIRM  ali  29  95......................KREGVLKIGTSPDYPPFEFLDENNQVVGFDIDIMQEVARELGVQLEIVQMGFDGLIPALQAGKFDIMAAGVTVTEERKQVVDFTDPYLVGTDAIVVHKDQKPIKGLEDLKGHTIAVQIGTIQADAAHEV---EGLTVKEYNLFTEAATAVASKQADAMYLHKVVAEAFIKANPNLKIAA---------ETPAKDTAFALRKDTPDLTQFVNQVLAKMQEDGRFDQLVQKWF....... 314
411 2.000e-86UniRef50_A0A0N8GN51 Uncharacterized protein n=10 Tax=Chloroflexi TaxID=200795 RepID=A0A0N8GN51_9CHLR  ali  26  60..........................TIRVATDATFPPFEIVDETKELTGFDVELMKAIAEKAGFQLEWSNLPFDSVLAGLAQCQFDLAIAAITITDDRKQQMLFSDPYINAGQIVVIRKGDETIKSKDDLAGKTVAAQLGTTGEIEARKIA---NVNYKPYDTYDLAFLDLANGQVDAVIADYPTALGFIGQNPEK-------LTTVGEVFTDESYGIAICKNREDLIAPINAALAQLKNEGVISELEMKWL....... 277
412 2.000e-86UniRef50_A0A1I4ZZV8 Amino acid ABC transporter substrate-binding protein, PAAT family n=6 Tax=Firmicutes TaxID=1239 RepID=A0A1I4ZZV8_9CLOT  ali  29  1MKKSLLLVTGVLAGCGDKSTGEGEQTVLKIGTDPTYPPFEFTNDKNELIGFDIDLANALGEKLGMEVEFVPTAFDGIFTGMNSGAYDVIMAAVSMTPKRLETMLFSKPYLANGQVILNRKEDAVLSSLEELKDLNVGVQLGTTADTATAKYAEEVGFEVTKYDEIIQTFSAMKAGHVDAIAVDYAVAIEYVANEPES-------YQISPVMLTNEPIAVAIKKDNTELQEKINAALLELKEEGKLKELSEKWMGGD.... 257
413 2.000e-86UniRef50_A0A0L0M557 Transcriptional regulator, IclR family n=1 Tax=Candidatus Paraburkholderia schumannianae TaxID=1069530 RepID=A0A0L0M557_9BURK  ali  29  180MKKNLLSAAAMMVAALPGTARAQDSNVLNVATDATFPPMEFVD-KGERTGFDIDIMNALATVMGKKIQWTDIDFKGLIPGLVAHRFDAAISGIYITPERVQVVDFTQSYFAGGLSALVKADSP-IKTLADLNAKKVTVQVGTKSVNFLRDNYPQ--VQRVEVEKNQEMFDLVGIGRADAAVTGKPAAYQSVRTRP--------GFRVLDKELTTEAYGIAMRKDEPQLRDQMNAALAKIKADGTYDAIVKKWFGASAS.. 430
414 2.000e-86UniRef50_A0A150IN21 Glutamine ABC transporter periplasmic protein n=7 Tax=Euryarchaeota TaxID=28890 RepID=A0A150IN21_9EURY  ali  30  33.......................EEGYLTIGTEAQFPPFEIRKADDSFYGFDIALGEALAKELGLKPKFVDTDFASIIASLNSGKFDIAMSAMTITEDRKKTINFSDPYFDAGLSMAVPANSP-IQTINDLNGKIVGVQLGTTGDLYASELKNIK--EIKRYAHAPDAFLDMKNGKVDAVINDDVVSKPIVASDP-------TSFKIVGGLLTVEQYGIAIPKDNEVLLQKVNAALKKLKQDGTYDQIYNQY........ 251
415 2.000e-86UniRef50_W9AJY2 Sulfate starvation-induced protein 7 n=103 Tax=Firmicutes TaxID=1239 RepID=W9AJY2_9BACI  ali  30  1MKKFLLGILLAVFAIMLTACGSKEEGQLKVGLMGTYKPYNFINEDQEMDGFDADIAKEVANRLGVDVEFVAQEFSGMIAGLQSEKFDVVISQMTITDERKEQMDFSDPYITNQVKVIVKEDNDSITSVEDFKGKNIGVGLGTNDETYLRTELMPEDFTIMTYDDVVTTLKDLDTGRIDATINNIYAITPVVEQN--GFKIKAVGEPIK-----SDQAGIATRKGNEELIAELNRILAEMKEDGTYNEIFVKWFGE..... 276
416 2.000e-86UniRef50_A0A1W9VA08 Amino acid ABC transporter substrate-binding protein n=4 Tax=Bacteria TaxID=2 RepID=A0A1W9VA08_9SPIO  ali  28  1MKKSLIVFLVLAVCSASVFAGGKEKGVFVLGLDDSFPPMGFRDENGEITGFDIDLAKEVCKRMGVELKLQPIDWDAKILDLNSKDIDVIWNGLSINPERKEKIEFSKAYIANRQIIIVQAGS-AIDSKADLAAKTVGVQLGSTADDAVNNDADTMASELVKFQDNVQALMDLEVGRIDAVVVDEILGRYYISKKEGVFG-------VASESFTEEEYGIGFRKGELAFVAEVDRIIDEMVKDGAAAAISNKWFAEDI... 265
417 2.000e-86UniRef50_M8DF38 L-cystine ABC transporter substrate-binding protein n=10 Tax=Bacillales TaxID=1385 RepID=M8DF38_9BACL  ali  27  1MKKLVFTALISTLLLGIAGCGNKAEGKLVIGTEGTYAPFTFHDQSGKLTGYDIDVATEVAKRLGVEPVFQETQWDAMFAGLDSKRFDLIANEVGIRPDRQEKYDFSSPYSVSRAVLVAHKDNETVKDFPDIKGLKAGQSMTSNYADMAREL----GAEIVAVDNFNNAIELIASRRVDVVLNDNLSVLDFLKQKPD------TPIKIVKVKEEGLNCGFMFRKGSNELIEEINKALDAMHKDGTLKQISEKWFGEDIS.. 276
418 2.000e-86UniRef50_A0A0A0DAP9 Uncharacterized protein n=3 Tax=Inquilinus limosus TaxID=171674 RepID=A0A0A0DAP9_9PROT  ali  35  24.........................DTVRICMEGAYPPFNNTDSTGKIVGFEVDVANALCKQAGLTCEVAQQDWDGFIPALLNKRCGALMDGMSITEERLKQIAFSVPYTDTPAWFVGAKDGKDAKTLADLKGKTIGVQRSTTHQNFLEAEFKD--ANIKLYDTVDELNFDLVNGRIDAGLGDSTSWDSFLK-SDNGKNFVHYGPTLTDNPLFGQGIGIGLRQEDKELKAKFDKAIDSMKADGSLSKLALQWFGYD.... 259
419 2.000e-86UniRef50_M1ZM50 Glutamine transporter subunit periplasmic binding component of ABC superfamily n=2 Tax=Firmicutes TaxID=1239 RepID=M1ZM50_9FIRM  ali  23  25............ATTGDANSSDGTAETMVVGTDTSFPPFEYVDPDNQYTGFDIELIYAIADAAGLKVDLKPMEFKAIVPGLQTGTLDVGIAGMTITEERKKAVLFSEPYFQAGLVIAVRPQENKIHNKDDLKGKTIAVKLGTTSEKMAREI---EGATVKTFDNGNDVYLEVIHGGADALIEDLPVIKHFIVKNPDK-------LIVVSEPMTGDNYGIAVTKSKTQLLEKINEGLKKVKESGKYDELYKKYFGE..... 258
420 2.000e-86UniRef50_A0A2D6CY82 Basic amino acid ABC transporter substrate-binding protein n=1 Tax=Candidatus Poribacteria bacterium TaxID=2026781 RepID=A0A2D6CY  ali  28  46MRPLRVTCSVLLCLVACGTPEASSDRVVVVATDATYQPFEYLGDGRVIVGYDIDLFRAIGERAGFAVEFVNQPFVGALAGLETGAYQAMISAMTITEERAETFLFSDPYYDAGQVVAIRDETDDIASFADLPGRKIGVQRGTTGSMKAKE---APGAELTEYDTIDLAFMALGNGTVDAVINDEPTSRSIAAARG--------GFRLVGETLTEEQYGIAMRRDAHELAAKINAALAELRADGTLDRLRARWID...... 289
421 3.000e-86UniRef50_A1WER8 Extracellular solute-binding protein, family 3 n=2 Tax=Verminephrobacter eiseniae TaxID=364317 RepID=A1WER8_VEREI  ali  37  1...............MALSVDAKSYKEITIATDATYPPFESVAADGQLVGFEIDLSHALCEELKLKCRLINASFDTLIPGLVTRKSDALITSMNINDERKRVIDFTDPYYRMESRFVARKGAGIVISAAGLTGKTIAVQAGTLQASYVRKVYGD-VARIKYYQGGSEPFLELLSGRADLHFGFIVQVNDSFLSK-DGKDFEFIGPTLSDDKTLGEGVAIAIRKEDKELKALLNQGLQTLRKNGTMKKINDKYFPF..... 240
422 3.000e-86UniRef50_A0A068DFY0 Bacterial extracellular solute-binding s, 3 family protein n=3 Tax=Rhizobiales TaxID=356 RepID=A0A068DFY0_9RHIZ  ali  38  1MKHLGKVLALAAVILTTNAHA-----EIRFGVNEAYPPYTTKDASGKAIGWEIDLMDAVCAELKEKCTIVDVAWDGLIPALESKKIDVIWSSMSITDERKKRIDFTDKYYSALAGMIGTKDGTMGVTAEQLKGKTIGIAVSTTQSAYFKKHFAQVATE-KSYATVDESFQDLASGRIDYVFADTAPLKEFLKTDLGQGCCEFKGNVEPDNAILGAGVGGGIRKGDDALREKLNAAVQAVRANGKYAEFSKKYFDYDPY.. 253
423 3.000e-86UniRef50_A0A081BUL6 Extracellular solute-binding protein family 3 n=1 Tax=Candidatus Vecturithrix granuli TaxID=1499967 RepID=A0A081BUL6_9BACT  ali  28  30......................KNTGKLKVALNATFPPFEFFDNDKKYMGFDIDVAKAIAEAMGVEAEIINTAWDGIIPGLLSKQYDIIISAMTITEERAKKVKFSDPYYYAGQIIVV