current user: public

If you have questions about the server, please let us know.

Query: [S] COG3592 Uncharacterized conserved protein, from VFDB

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
# E-value Template Links and tools%idFirst MEEETLLEQGYRKYRGADVDIYFNTNICAHSGNCVKGNAELFNLDRKPWIMPDNVPKEEAKRVIHTCPSGALQYIEKLast
1 9.000e-24UniRef50_UPI0009EA8F6D hypothetical protein n=1 Tax=Exiguobacterium sp. BMC-KP TaxID=1684312 RepID=UPI0009EA8F6D  ali  35  45.KKLGRRDVVKKGYEGKEITVYFDSEVCIHSGHCVRSLPTVFDVKRRPWIEADGAPVEDVMRVVDGCPSGALSYERR 120
2 3.000e-23UniRef50_A0A2G5NNB9 Uncharacterized protein n=1 Tax=Macrococcus goetzii TaxID=1891097 RepID=A0A2G5NNB9_9STAP  ali  39  3...........KSYRNKDITVHFEASRCIHATECVRGLPQVFDVDKRPWINVDNASKEDITEVIMRCPSGALTFTRE 68
3 1.000e-22UniRef50_F0SYW7 Iron sulfur domain-containing, CDGSH-type n=1 Tax=Syntrophobotulus glycolicus (strain DSM 8271 / FlGlyR) TaxID=645991 RepID=F0SYW7_SY  ali  30  64.KKADRIPSKINTYLGENITVHFDLSICAHSAICLNTLPSVFDLSNQPWINPNGADPQKIIEAIKKCPSGALSYTLE 139
4 2.000e-22UniRef50_A0A031IL22 Uncharacterized protein n=18 Tax=Terrabacteria group TaxID=1783272 RepID=A0A031IL22_9BACL  ali  40  3...........KGYEGKEITVYFDSEVCIHSGHCVRSLPTVFDVKRRPWIEADGAPVEDVMRVVDGCPSGALSYERR 68
5 2.000e-22UniRef50_A0AEV1 Uncharacterized protein n=7 Tax=Bacillales TaxID=1385 RepID=A0AEV1_LISW6  ali  88  1MDEEKLLEQGYRKYRGTDVDVYFNTNVCVHSGNCVKGNAELFNLDRKPWIVPDNVTTEEAKRVIHTCPSGALQYIEK 77
6 3.000e-22UniRef50_A0A0Q0S1J7 DUF1271 domain containing protein n=11 Tax=Bacteroidetes TaxID=976 RepID=A0A0Q0S1J7_9FLAO  ali  35  3......PKDITKEYTNGEVTIVWQSAKCIHSGNCARNNPDVFQPREKPWIKPEASSSEKIIETVNKCPSGALTY... 70
7 3.000e-22UniRef50_E3ZLF0 Uncharacterized protein n=95 Tax=Bacteria TaxID=2 RepID=E3ZLF0_LISSE  ali  83  1MSEEKLLERGYRKYRGAEIDVYFNTNVCAHAGNCVRGNNELFDLDRKPWIMPDNVEKEEVKRVIHTCPSGALQYIEK 77
8 3.000e-22UniRef50_UPI000DC26195 (4Fe-4S)-binding protein n=1 Tax=Flavobacterium lacus TaxID=1353778 RepID=UPI000DC26195  ali  32  4.......TNIKKEYSNDEVTVVWEAGKCIHSGNCVQNNPDVFQPKEKPWIKIEASSTEKIIETVNKCPSGALTFYKK 73
9 4.000e-22UniRef50_D2QN03 Uncharacterized protein n=7 Tax=Bacteroidetes TaxID=976 RepID=D2QN03_SPILD  ali  25  1MADSTPSPDITKTYTNGEITVVWKPAVCIHSKLCWTQLSEVFNPRERPWVRMEGAGTERIIEQVDRCPSRALSYYR. 76
10 4.000e-22UniRef50_A0A2D8CIE3 Uncharacterized protein n=7 Tax=Bacteria TaxID=2 RepID=A0A2D8CIE3_9BACT  ali  35  1......MKERIFSYENEEVKVTWDQKRCIHAEECVHGLPNVFDPNEKPWIQPDNASADELTNVIKRCPTGALHYELK 71
11 5.000e-22UniRef50_A0A2V7SCZ4 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A2V7SCZ4_9BACT  ali  36  1......MPNRLQTYEADEIVVTFDPNVCIHSGVCVRGLPDVFDLTRKRWIRPELESADAVAAQVDRCPSGALQYVRK 71
12 6.000e-22UniRef50_A0A1J5AYT4 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium CG2_30_32_10 TaxID=1805032 RepID=A0A1J5AYT4_9BACT  ali  35  1......MEEKTKSYSNKDITVYWKPLLCIHSAICTKGLPSVFDANKRPWINIDGASKDEIIEVVNKCPSGALSFSLK 71
13 6.000e-22UniRef50_G7VTJ7 Uncharacterized protein n=36 Tax=cellular organisms TaxID=131567 RepID=G7VTJ7_PAETH  ali  45  2........TNHKVYYGKDIEVMFNSEVCIHSGICVKGLPGVFNLSKRPWVNPDADTMEAIARHIDTCPSGALTYRR. 69
14 9.000e-22UniRef50_A0A1X7JLU2 Uncharacterized Fe-S cluster protein YjdI n=7 Tax=Firmicutes TaxID=1239 RepID=A0A1X7JLU2_9BACL  ali  40  4...........KVYRGKEIEVYFDSEKCIHSGVCVKGMPQVFDLNKRPWVNTEGASANEIAAHIDSCPSGALSYKR. 68
15 1.000e-21UniRef50_A0A2T2URL2 Uncharacterized protein n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A2T2URL2_9BACT  ali  29  1......MDTNTYTYEGESITVTWDRERCIHAQACVEGLPDVFDPERRPWIEPDQADPDAVEAVVPQCPTGALHLARK 71
16 2.000e-21UniRef50_A0A2M8APX0 Uncharacterized protein n=22 Tax=Bacteria TaxID=2 RepID=A0A2M8APX0_9FLAO  ali  36  2........SNIKKYTNGEVTIVWDAEKCIHSAICVKGLPDVFKPKEKPWIKIDKASTEALIHQVKACPSGALSF... 67
17 2.000e-21UniRef50_G7WNW6 Uncharacterized protein n=1 Tax=Methanosaeta harundinacea (strain 6Ac) TaxID=1110509 RepID=G7WNW6_METH6  ali  27  1..........MKEYTNGEITVFWDPERCIHAAECLRGLPGVFNPQKSPWVDMEGATSDEIMAAIDRCPSGALSYRR. 66
18 2.000e-21UniRef50_A0A0E0USR6 YjdI-like protein n=176 Tax=Bacteria TaxID=2 RepID=A0A0E0USR6_LISMM  ali  93  1MDEETLLERGYRKYRGAEVDIYFNTNICEHSGNCVKGNAELFNLDRKPWIMPDNVSKEEAKRVIHTCPSGALQYIEK 77
19 2.000e-21UniRef50_A0A285L5L9 Uncharacterized Fe-S cluster protein YjdI n=10 Tax=Enterobacteriaceae TaxID=543 RepID=A0A285L5L9_9ENTR  ali  62  2..DKELLDAGYRLYSGEKIDVYFNTGLCQHSGNCVRGSSALFNLKRKPWIMPDNVDTETVQRVIDTCPSGALKYRLK 76
20 2.000e-21UniRef50_D5EA07 Uncharacterized protein n=13 Tax=Archaea TaxID=2157 RepID=D5EA07_METMS  ali  35  66.KKEDRVPDKMDTYKGKAITIHDNRGVCSHMGHCTDNLPSVFRMGIEPWIDPDGADPEEIARIIRMCPSGALSYT.. 139
21 3.000e-21UniRef50_A6TUK3 Uncharacterized protein n=1 Tax=Alkaliphilus metalliredigens (strain QYMF) TaxID=293826 RepID=A6TUK3_ALKMQ  ali  36  65.KSDERAPDKWKSYKGENITIHFNLGLCCHVASCIKGLPSVFNVDERPWINADGGTTEEIIQIISKCPSGALTYTK. 139
22 3.000e-21UniRef50_A0A2P8R410 (4Fe-4S)-binding protein n=2 Tax=Bacteria TaxID=2 RepID=A0A2P8R410_9PROT  ali  40  1......MEQIVKKYEKDGLTVYWKPNTCTHAGKCVKGSPKVFDVNRRPWVKLDEDSIEHIMEVIDRCPSGALSYEKK 71
23 3.000e-21UniRef50_A0A2A8CTA6 Uncharacterized protein n=1 Tax=Longibacter salinarum TaxID=1850348 RepID=A0A2A8CTA6_9BACT  ali  34  1......MERKTYTYQGEEVTVTWDQKRCIHAEECVKGLPEVFDPERRPWIDPDKADAASVADVVQRCPTGALHVT.. 69
24 4.000e-21UniRef50_A0A0K9YUG7 Uncharacterized protein n=5 Tax=Bacillales TaxID=1385 RepID=A0A0K9YUG7_9BACL  ali  36  1......MSDDSKRYVGKDIEVIFHPGRCVHSAKCVSGLPEVFNIKKKPWVHVDGETADKIASQINNCPSGALEYVWK 71
25 5.000e-21UniRef50_A0A2A4U4X0 Uncharacterized protein n=1 Tax=Elusimicrobia bacterium TaxID=2030800 RepID=A0A2A4U4X0_9BACT  ali  36  63.KQEGHPQNKRRDYTGKEVTVHYNLGICSHAAYCITGLPQVFDVEKKPWVQPDNASVEEVIDVVRRCPSGALSVT.. 136
26 5.000e-21UniRef50_A0A095SY16 Divergent 4Fe-4S mono-cluster n=11 Tax=Bacteroidetes TaxID=976 RepID=A0A095SY16_9FLAO  ali  36  5........DLTKEYSNGEVTIVWKNNLCIHAAQCVKNNPDVFKPKEKPWITPENSTTDKIIETVKKCPSGALTY... 70
27 6.000e-21UniRef50_F7PVH5 Glutamate synthase protein n=2 Tax=Bacteria TaxID=2 RepID=F7PVH5_9BACT  ali  34  65.KKEGRVQRKLETYKGETISIHDDRGICSHAGYCTEGLPDVFQMGEDPWIDPNGASKAEIIKTIEKCPSGALSY... 137
28 6.000e-21UniRef50_A0A023X2J6 Uncharacterized protein n=1 Tax=Rubrobacter radiotolerans TaxID=42256 RepID=A0A023X2J6_9ACTN  ali  32  1.....MSKNREKTYTSETTDVTFDPARCIHSENCVRTLPAVFDVGKRPWIQPDKASAEAVARAVTLCPTGALRYR.. 70
29 7.000e-21UniRef50_R6F1W4 Uncharacterized protein n=2 Tax=Firmicutes TaxID=1239 RepID=R6F1W4_9FIRM  ali  42  3...........KSYETENLKIFWKPDICQHAGKCVHGAPKVFEVGRKPWIIPENGREEDIIKVIDKCPSGALSYKLK 68
30 8.000e-21UniRef50_A0A1M5PEG4 Uncharacterized Fe-S cluster protein YjdI n=2 Tax=Firmicutes TaxID=1239 RepID=A0A1M5PEG4_9FIRM  ali  57  1MTEETLLAKNYKKYEGENIDIYFNLEVCEHSGKCVKGDNEVFDTERKPWIMPLASHTERIQEVIKTCPSGALKYKLK 77
31 9.000e-21UniRef50_H8XR66 Uncharacterized protein n=10 Tax=Bacteria TaxID=2 RepID=H8XR66_FLAIG  ali  36  3......PKNIKKEYTNGEVTIVWQSGKCIHSGNCVRNNPDVFKPKEQPWITPAHSTTEKIMETINKCPSGALTY... 70
32 9.000e-21UniRef50_A0A1G6E7X0 Uncharacterized Fe-S cluster protein YjdI n=1 Tax=Flavobacteriaceae bacterium MAR_2010_188 TaxID=1250295 RepID=A0A1G6E7X0_9FLAO :  ali  29  3.........KTHEYSNDDITVLWKPDLCIHSGICYRGLPEVFKPKERPWIKVEASTSERIASQVKKCPSGALSLKSE 70
33 1.000e-20UniRef50_A0A2P8H8F6 Putative GNAT family acetyltransferase n=2 Tax=Chitinophaga niastensis TaxID=536980 RepID=A0A2P8H8F6_9BACT  ali  33  1......MKDITKHYTNGEVTIVWKPNVCIHSERCFHGLPMVFNPNQKPWINAEGATTAQIIAQIKQCPSGALSY... 68
34 1.000e-20UniRef50_A0A1M3HDN3 (4Fe-4S)-binding protein n=1 Tax=Sphingobacteriales bacterium 50-39 TaxID=1895841 RepID=A0A1M3HDN3_9SPHI  ali  27  1......MEKDLK-YTNGEITVHWKPDFCKHSGRCVTQLPQVFDLKSHPWINMQGADTNTIIDQVNKCPTGALSYTR. 69
35 1.000e-20UniRef50_W9E0I4 Uncharacterized protein n=3 Tax=Methanolobus TaxID=2220 RepID=W9E0I4_METTI  ali  36  66.KEEDRVPDKVETYVGKNISIHRNRGVCCHVGYCVHNLPDVFERGRDPWAEPDAADQEEIAALIRSCPSGALSYT.. 139
36 1.000e-20UniRef50_A0A0R2VM42 Uncharacterized protein n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A0R2VM42_9SPHI  ali  34  3...........KHYTNGEVTIIWKPDLCIHSANCIRGLPDVFNNRARPWITPEGAETNAIIEQVKKCPSGALSYT.. 66
37 2.000e-20UniRef50_Q12TU4 Zinc finger domain-containing protein n=8 Tax=root TaxID=1 RepID=Q12TU4_METBU  ali  32  67...EGRQPDKVDTYVGKDITIHDNRGVCSHRGYCTNNLPTVFRMKEEPWVDPDGASVKDIIRVVEMCPSGALSYTK. 139
38 2.000e-20UniRef50_W4AZB5 Uncharacterized protein n=3 Tax=Paenibacillus TaxID=44249 RepID=W4AZB5_9BACL  ali  45  28.........KEKLYYGKDIEVMFNSDVCIHSGICVKGLPAVFDLSKRPWVDPDGDTSEAIARHIDTCPSGALTYK.. 93
39 2.000e-20UniRef50_A0A1I0S6D8 Uncharacterized Fe-S cluster protein YjdI n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A1I0S6D8_9BACT  ali  35  1......MKDITKHYSNGAVTIVWKPNVCIHSEMCFHGLPEVFNPNQKPWIHAEAATTEAIVSQVKQCPSGALTY... 68
40 2.000e-20UniRef50_A0A2D8FTJ0 Uncharacterized protein n=3 Tax=Bacteria TaxID=2 RepID=A0A2D8FTJ0_9FLAO  ali  35  2........DITKKYTHDQVTVIWKPGLCIHSGNCVSALPNVFKPKEKPWVQPEGSSSDELMSAIKKCPSGALTYE.. 68
41 2.000e-20UniRef50_H3NQI6 Uncharacterized protein n=5 Tax=Bacteria TaxID=2 RepID=H3NQI6_9FIRM  ali  43  1......MDDDVRVYETDELIVYWNAKICQHSGNCVKGAPEVFDVKKRPWINLNNASAEKIMAVIDTCPSGELSYKRK 71
42 3.000e-20UniRef50_A0A1H7WMU6 Uncharacterized Fe-S cluster protein YjdI n=1 Tax=Pseudosphingobacterium domesticum TaxID=407022 RepID=A0A1H7WMU6_9SPHI  ali  36  2........ETIKKYRKDNLKVIWDPKKCIHAGICVKTLPKVYDPKATPWITPENASVEDLKSQINACPSGALSYQE. 69
43 3.000e-20UniRef50_A0A2M8NE58 Uncharacterized protein n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2M8NE58_9CHLR  ali  36  1......MQTKPRTYTSETIDVIFDTKRCIHAQECVNGLPAVFDIDQRPWIQPQNGTPDEIAAVVRRCPSGALHVQRK 71
44 3.000e-20UniRef50_W2UPY4 Uncharacterized protein n=9 Tax=Bacteroidetes/Chlorobi group TaxID=68336 RepID=W2UPY4_9FLAO  ali  36  1......MGEIVKEYSNGELTIVWKPKKCIHSGICVKTLPMVYNPDKKPWIEIENATTEQLKDQVSKCPSGALSY... 68
45 3.000e-20UniRef50_UPI0009FBDC62 hypothetical protein n=1 Tax=Sporolactobacillus laevolacticus TaxID=33018 RepID=UPI0009FBDC62  ali  36  1......MSNKSKRYTGQTIDVIFHSERCVHAARCVKGLPEVFDVKKRPWVNADGEEADKIAKVIEQCPSGALEYIRK 71
46 3.000e-20UniRef50_D7AYR5 Uncharacterized protein n=5 Tax=Actinobacteria TaxID=201174 RepID=D7AYR5_NOCDD  ali  40  5........HGKKAYEGESITVTFEAERCQHAAVCVNGLPEVFDTRRRPWIQPDGAAADRLAEVIRRCPSGALQYR.. 71
47 3.000e-20UniRef50_A0A1E5TCC5 Uncharacterized protein n=13 Tax=Bacteria TaxID=2 RepID=A0A1E5TCC5_9FLAO  ali  31  2........SKIKEYSNNVVTVVWEPKKCIHSAICAKGLPEVFQPKDRPWIKIDAASTNNIIEQVKKCPSGALSY... 67
48 4.000e-20UniRef50_J7J0I3 Uncharacterized protein n=3 Tax=Firmicutes TaxID=1239 RepID=J7J0I3_DESMD  ali  37  1..........MKEYRNEHIIVHWYPELCAHPGTCLRLLPKVFNLEQRPWVNVDAAEPEEIIRAIDQCPSGALRY... 64
49 4.000e-20UniRef50_UPI000D7103BE hypothetical protein n=1 Tax=Prosthecochloris sp. V1 TaxID=2017681 RepID=UPI000D7103BE  ali  35  66.KQEGRPPRRSDSYKGKDIIIHDDRGICSHAGFCTDDLPEVFLKKDEPWIDPDGEGFEKIIETIEKCPSGALSY... 138
50 4.000e-20UniRef50_A0A1M3KWX6 Uncharacterized protein n=1 Tax=`Candidatus Kapabacteria` thiocyanatum TaxID=1895771 RepID=A0A1M3KWX6_9BACT  ali  36  1......MSEFVKHYSNGEVTIVWKPDLCIHSANCFRNLPEVFNPRVKPWIKPDAAPTERLIAVVSACPSGALSIEQE 71
51 4.000e-20UniRef50_A0A0F7CPE1 Uncharacterized protein n=7 Tax=Actinobacteria TaxID=201174 RepID=A0A0F7CPE1_9ACTN  ali  37  1MTEAVMSSSGKKTYEGRSITVTFEAARCRHAAECVRGLPEVFDTARRPWIRPDGAEAGRLAEVVRRCPSGALQY... 75
52 4.000e-20UniRef50_A0A2N2BVY3 Glutamate synthase n=2 Tax=Firmicutes TaxID=1239 RepID=A0A2N2BVY3_9FIRM  ali  34  65.KSPDRVPRQLDTYVGREITIHDDRGICSHAGFCTEGLPKVFRMTEEPWIDPDAEAKELIIETIKKCPSGALSY... 137
53 4.000e-20UniRef50_A0A2S1SGB8 (4Fe-4S)-binding protein n=3 Tax=Bacteria TaxID=2 RepID=A0A2S1SGB8_9FLAO  ali  34  2........ENTKEYSNGEVTIVWKPEICIHSGICARGLPSVFKPKEKPWINQHGAPTQDITDRIDKCPSKALSY... 67
54 4.000e-20UniRef50_A0A0Q3S149 Uncharacterized protein n=7 Tax=Bacillales TaxID=1385 RepID=A0A0Q3S149_9BACI  ali  54  2........KDYKIYTSQDIDVYFNLNKCTHAANCVKYLPSVFNVNRKPWIQPDAALIEDVKRVIATCPSGALLYKE. 69
55 5.000e-20UniRef50_A0A1M6GAW2 Zn-finger domain of CDGSH type-containing protein n=71 Tax=Bacteria TaxID=2 RepID=A0A1M6GAW2_9FLAO  ali  31  2........SKTREYTNGAVTVVWKPELCIHSGICAKGLPDVFRPRVRPWVRIEKGTTEDLINQVKRCPSGALSY... 67
56 5.000e-20UniRef50_UPI000B5108BC (4Fe-4S)-binding protein n=1 Tax=Methanobrevibacter sp. 87.7 TaxID=387957 RepID=UPI000B5108BC  ali  33  28.....LTKEKVKEYSYNNFTVVWNAKKCIHAGECWRNLPEVFKPAEKPWVKINIKSPDEIKEVIDKCPSGALSYKE. 98
57 5.000e-20UniRef50_X1R566 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1R566_9ZZZZ  ali  32  12.KEEGRVPDRLDTYEGEKISIHDNRGVCSHAGYCTDNSPKVFDMHQEPWVSPDDDNAEKTASTIRMCPSGALSYTK. 86
58 6.000e-20UniRef50_UPI000420702D hypothetical protein n=1 Tax=Desulforegula conservatrix TaxID=153026 RepID=UPI000420702D  ali  33  71.KADDRTPNKLKDYKGKDITIHDNRGVCSHDGSCIKLLPSVFRSKERPWINPDGAGVAEIISAIEKCPSGALSYT.. 144
59 6.000e-20UniRef50_A0A1Q7KC64 Uncharacterized protein n=10 Tax=unclassified Gemmatimonadetes TaxID=234665 RepID=A0A1Q7KC64_9BACT  ali  33  1......MPKKRQTYEADEIIVTFDPDVCIHSGVCVMGLPDVFDIKRKRWIRPELQPPDVVAAQVMRCPSGALQFVRK 71
60 6.000e-20UniRef50_X1G3T4 Uncharacterized protein (Fragment) n=2 Tax=marine sediment metagenome TaxID=412755 RepID=X1G3T4_9ZZZZ  ali  35  23.KQEDRQPGKIDSYKGKNITIHDNRGICAHVGYCTDGLPKVFQMGVEPWINPDAETMGKIIQTIKKCPSGALSY... 95
61 6.000e-20UniRef50_UPI0005ED5E34 GNAT family N-acetyltransferase n=1 Tax=Bacillus niacini TaxID=86668 RepID=UPI0005ED5E34  ali  49  3VTEKELLESGYRKYPGETIDVFYDIKKCVHAGECVRGNGDVFKVKRKPWIIADNASAEEVALVVDSCPSGALKYIRK 79
62 7.000e-20UniRef50_A0A1V5B5D1 Iron-binding zinc finger CDGSH type n=3 Tax=Methanothrix TaxID=2222 RepID=A0A1V5B5D1_9EURY  ali  36  1..........MKEYSNKDIKVIWNPEKCMHAGECVKGLPQVFRRGETPWIDMQAAGSEEIISVVDRCPSGALTYKK. 66
63 8.000e-20UniRef50_S2XBA3 Uncharacterized protein n=16 Tax=Staphylococcus TaxID=1279 RepID=S2XBA3_9STAP  ali  42  3...........KKYTGSDINVYFEPKRCVHATECVRGLSHVFDVNQRPWINPDNDTAEHIAEVVERCPSGALTYE.. 66
64 8.000e-20UniRef50_J1AEB3 Uncharacterized protein n=23 Tax=Bacteroidetes TaxID=976 RepID=J1AEB3_9FLAO  ali  37  7..........TKEYTNGEVTIVWQSGKCIHSANCVKNNPDVFRPKEKPWITPEKSTTEKIITTVNKCPSGALTF... 70
65 8.000e-20UniRef50_A3HTD1 Zinc finger CDGSH type superfamily n=19 Tax=Bacteria TaxID=2 RepID=A3HTD1_9BACT  ali  33  1.....MADPIKKEYSNGDITVTWEPHKCIHSKKCVSGLPEVFDFNRRPWIKAEGTSSENIATQIDKCPSGALGY... 69
66 9.000e-20UniRef50_H1Y3P1 Uncharacterized protein n=2 Tax=Mucilaginibacter TaxID=423349 RepID=H1Y3P1_9SPHI  ali  34  1......MTDFHKTYQNKDITVFWQPEKCLHSANCVRGLRAVFDPGRKPWIELSEGETEDIVRTINNCPSGALSFE.. 69
67 9.000e-20UniRef50_A0A1N7F7Z7 Uncharacterized Fe-S cluster protein YjdI n=3 Tax=Halobacteria TaxID=183963 RepID=A0A1N7F7Z7_9EURY  ali  37  1......MEEDLHEYHGKDIEVTYDHNRCIHVRECVEGLPGVFDPNQRPWIDADNADADEVARVIERCPTGALHYER. 70
68 9.000e-20UniRef50_A0A1H6VIB6 Uncharacterized Fe-S cluster protein YjdI n=1 Tax=Deinococcus reticulitermitis TaxID=856736 RepID=A0A1H6VIB6_9DEIO  ali  34  25...........RAYTAPEITVYYDRGRCIHYAACVRGLPEVFDTAKKPWIQPAQAQADAVAEVVRRCPTGALHYV.. 88
69 1.000e-19UniRef50_A0A1T4TRQ4 Uncharacterized Fe-S cluster protein YjdI n=1 Tax=Chitinophaga eiseniae TaxID=634771 RepID=A0A1T4TRQ4_9BACT  ali  32  1......MKDITKKYSNGEVTIVWKPEVCKHSEICFHGLPEVFDPKAKPWINADGSTTDRIMQQVKKCPSGALTF... 68
70 1.000e-19UniRef50_S3V3Z4 Divergent 4Fe-4S mono-cluster n=3 Tax=Bacteria TaxID=2 RepID=S3V3Z4_9LEPT  ali  30  1......MSEVVKKYTNGEITVIWKPDVCIHSAICFRGLPAVFHPKKIPWVRLGETPSERIMDQIDRCPSGALSYIK. 70
71 1.000e-19UniRef50_A0A286E652 Uncharacterized Fe-S cluster protein YjdI n=1 Tax=Streptomyces zhaozhouensis TaxID=1300267 RepID=A0A286E652_9ACTN  ali  34  5........PEKKSYQGRAITVTFEAGRCLHAAECVGGLPEVFDTGRRPWISPDGADADRLAEVVRRCPTGALHYT.. 71
72 1.000e-19UniRef50_Q8TQ72 Uncharacterized protein n=11 Tax=Methanosarcinaceae TaxID=2206 RepID=Q8TQ72_METAC  ali  37  69.KEENRVPDDVKDYKGKKIIIHDNRGVCAHAEFCIKGASSVFKKGKKPWIDPEAANPEEIEKIIRSCPSGALSYSR. 143
73 1.000e-19UniRef50_G8TIX9 Uncharacterized protein n=5 Tax=Bacteroidetes TaxID=976 RepID=G8TIX9_NIAKG  ali  33  143........DKKIKYTNGDITVVWKPELCKHSGRCVTQLPKVFNLKTKPWVTITGADSETIKAQVDKCPTGALSW... 208
74 1.000e-19UniRef50_G2PLE0 Uncharacterized protein n=198 Tax=cellular organisms TaxID=131567 RepID=G2PLE0_MURRD  ali  35  3..........TKEYTNGEVTILWQPEKCIHSGICVKTLPKVYNPKEKPWVKPENATSKELINQVSKCPSGALSIK.. 67
75 1.000e-19UniRef50_A0A219ANC4 (4Fe-4S)-binding protein n=2 Tax=cellular organisms TaxID=131567 RepID=A0A219ANC4_9EURY  ali  33  4.....LTKEKVKEYSYNNFTVVWNAKKCIHAGECWRNLPEVFKPAEKPWVKINIKSPDEIKEVIDKCPSGALSYKE. 74
76 1.000e-19UniRef50_A0A1M4W6B6 Uncharacterized Fe-S cluster protein YjdI n=3 Tax=Balneolaceae TaxID=1813606 RepID=A0A1M4W6B6_9BACT  ali  34  1......MKLDIYSYQADDITIEYDQERCIHAAECVKNLPSVFDPDKRPWIQPEHASPDQIKKVIHSCPTGALKYRD. 70
77 1.000e-19UniRef50_Q9CHP2 Uncharacterized protein n=53 Tax=Lactobacillales TaxID=186826 RepID=Q9CHP2_LACLA  ali  54  26.NEEQLLKNNYRKYRGENMDIYYNVAICEHAGECVRGNPLVFEVGRKPWIIPDNGDVASNQSVINRCPSGALKY... 98
78 1.000e-19UniRef50_A0A143PF80 Uncharacterized protein n=13 Tax=Staphylococcus TaxID=1279 RepID=A0A143PF80_9STAP  ali  34  2..........IKTYTSENIDVSFDPNRCIHAAECVNNLNQVFDTKKRPWIDPEKAEADDIARVVELCPSGALEYDRK 68
79 1.000e-19UniRef50_B1VWR4 Uncharacterized protein n=29 Tax=Actinobacteria TaxID=201174 RepID=B1VWR4_STRGG  ali  38  10VTSQPPQRPAARSYDGEGIVVGFDAHRCLHAAECVRGLPAVFDVGRRPWIQPDNAPADEIADVVHRCPSGALQYHR. 85
80 2.000e-19UniRef50_A0A1D2WQC1 (4Fe-4S)-binding protein n=2 Tax=Methanobrevibacter TaxID=2172 RepID=A0A1D2WQC1_9EURY  ali  32  3.KQEELEQKGYKTYSNDEINVFWNPKLCQHATECIRGNNKVFDVSRRPWVDVSQAPAKEIAEIIDRCPTGALLYELK 78
81 2.000e-19UniRef50_A0A1G5JT34 Uncharacterized Fe-S cluster protein YjdI n=4 Tax=Bacteria TaxID=2 RepID=A0A1G5JT34_9CLOT  ali  36  65.KSHERDKNKWKSYKGEKITVHFNLGLCSHVGLCLKLLPSVFNLDSRPWINADGASVEEIIQLISKCPSGALAYTK. 139
82 2.000e-19UniRef50_A0A1C6MRW5 Uncharacterized Fe-S cluster protein YjdI n=2 Tax=Streptomyces sp. ScaeMP-e48 TaxID=1100823 RepID=A0A1C6MRW5_9ACTN  ali  36  4.......RTDRRSYEGRSITVTFEAGRCRHAAECVRGLPEVFDTARRPWIRPDGADAGRVAEVVRRCPSGALRYER. 72
83 2.000e-19UniRef50_UPI0009F5036C hypothetical protein n=1 Tax=Erysipelotrichaceae bacterium MTC7 TaxID=1768196 RepID=UPI0009F5036C  ali  52  1MNKKQLLENGYREYRGKDVNVYFKLSLCTHSAHCVRSNKDVFKVCRRPWILPDNGQTEEVIRIVDGCPSGALQY... 74
84 3.000e-19UniRef50_A0A1I1IQ61 Uncharacterized Fe-S cluster protein YjdI n=10 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1I1IQ61_9ACTN  ali  34  2.....SSETATKAYEGRSITVTFEARRCLHAAECVRGLPAVFDPGQRPWIRPDGAEAERLAEVVRRCPSGALRYE.. 71
85 3.000e-19UniRef50_K9DZX5 Uncharacterized protein n=37 Tax=Bacteria TaxID=2 RepID=K9DZX5_9BACE  ali  32  2........NIKKEYTNGELTIIWQPGLCQHAGICTKTLPNVYHPKEKPWITIENATTEELIAQIKKCPSGALSYR.. 68
86 3.000e-19UniRef50_A0A1B6Y8R7 Uncharacterized protein n=2 Tax=Balneola TaxID=455358 RepID=A0A1B6Y8R7_9BACT  ali  30  1......MQSKKFSYENKELEVTWDLKRCIHAKECVHGLPNVFDPGKKPWIDPDKEDSDKIVETIERCPTGALQYH.. 70
87 4.000e-19UniRef50_A0A101W3N1 Uncharacterized protein n=1 Tax=Gracilibacter sp. BRH_c7a TaxID=1734398 RepID=A0A101W3N1_9FIRM  ali  36  65.TNPDDDTNRWKEYTGKDILVYFNLSVCSHSAICLRKLPEVFNLKKRPWVNPDGADYRRVMQVIEECPSGALSY... 137
88 4.000e-19UniRef50_A0A2E0W4I2 Uncharacterized protein n=1 Tax=Ignavibacteriae bacterium TaxID=2026749 RepID=A0A2E0W4I2_9BACT  ali  37  1......MASEYLKYKSEELTVKYNPKICIHAAECVKGLPKVFNPKKKPWVEVGNASADEIIEVIKKCPTGALKYE.. 69
89 4.000e-19UniRef50_UPI0009DE964A hypothetical protein n=1 Tax=Bacillus TaxID=55087 RepID=UPI0009DE964A  ali  41  7.........KSKRYAGKDIAVFFNAEIYAHAAKCVKGLPEVFDINKKPWVNANGAEADEIAKVIDQCPSGALKYVKK 74
90 4.000e-19UniRef50_A0A0S1S9D6 Uncharacterized protein n=2 Tax=Bacteria TaxID=2 RepID=A0A0S1S9D6_9FLAO  ali  37  65.KLDGRVEDKRDDYVGQYITIHDNRGICAHAGKCTDGLPAVFHLKEEPWIYPDSATIKAIKETIDKCPSGALSYT.. 138
91 4.000e-19UniRef50_A0A1F3K172 Uncharacterized protein n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1F3K172_9BACT  ali  25  1......MEKNDRSYTNGEITVHWKPKECVHAGTCFRELRKVFDPSRRPWIDLSQASTEQIIDIVERCPTDALTYER. 70
92 4.000e-19UniRef50_A0A2V6SJ05 (4Fe-4S)-binding protein n=1 Tax=Candidatus Rokubacteria bacterium TaxID=2053607 RepID=A0A2V6SJ05_9BACT  ali  35  1MSEERGPG---RTYRIGDIRVIWRPAACIHSGVCVRGLPAVFRPQRRPWIDVAGAPSDRIVAQVEQCPSGALSWER. 73
93 4.000e-19UniRef50_A0A1R1BAK7 Uncharacterized protein n=1 Tax=Paenibacillus sp. FSL H7-0331 TaxID=1920421 RepID=A0A1R1BAK7_9BACL  ali  38  1......MEDQFKRYVGKDIEVLYYTEKCTHSGNCLSGSPGVFDVNKRPWVHADGDTADNIASQIHKCPSGALEYIRK 71
94 4.000e-19UniRef50_A0A2G7D4H2 Putative Fe-S cluster protein YjdI n=1 Tax=Verrucosispora sp. CNZ293 TaxID=2035249 RepID=A0A2G7D4H2_9ACTN  ali  40  8...........KTYEGRSVTVTFEARRCLHAAECVRGLPEVFDPGRRPWIRPDGAEAGRLAEVVRRCPSGALQYE.. 71
95 5.000e-19UniRef50_A0A156JXX9 Protein YjdI n=117 Tax=Bacteria TaxID=2 RepID=A0A156JXX9_ENTCL  ali  61  2..DQELLDAGYRAYTGEKIDVYFNTGICKHSGNCVRGSAALFDLKRKPWIAPDEVDAETVARVIDTCPSGALKYRLK 76
96 5.000e-19UniRef50_A0A1F3FZB1 Uncharacterized protein n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1F3FZB1_9BACT  ali  27  1......MRSVIKKYTNGEITVFWKSVFCIHSGECFTNLPKVFKPSESPWIDMLAASTEDIMRVVDLCPTDALSYK.. 69
97 5.000e-19UniRef50_A0A2N5YW94 Uncharacterized protein n=1 Tax=Marinilabiliales bacterium TaxID=2053303 RepID=A0A2N5YW94_9BACT  ali  20  1.....MRTKIVKEYTNGEITVRWKPDECIHATTCFKMLPEVFKPAERPWVKINAASTEKIIETVEACPTDALTW... 69
98 5.000e-19UniRef50_A0A1M5B8S1 Uncharacterized Fe-S cluster protein YjdI n=9 Tax=Bacteria TaxID=2 RepID=A0A1M5B8S1_9FLAO  ali  35  3..........THEYAAGEITVIWQPKKCIHAGVCVKTLPKVYNPKERPWLKPENAAAEELKNQIDLCPSGALSYK.. 67
99 6.000e-19UniRef50_A0A1Y0MRD5 Uncharacterized protein n=9 Tax=Bacteroidetes TaxID=976 RepID=A0A1Y0MRD5_9FLAO  ali  27  1.....MSNEVRKEYSNGEITVIWKPKLCIHAKECVSRLPEVYDPEKRPWIQPENPSAAALKEQIDACPSGALSYKME 72
100 6.000e-19UniRef50_N0CTZ5 Uncharacterized protein n=18 Tax=Bacteria TaxID=2 RepID=N0CTZ5_9ACTN  ali  36  4.......RTDRRSYEGRSITVTFEAGRCRHAAECVRGLPEVFDTGRRPWIRPDGADAGRVAEVVRRCPSGALRYER. 72
101 6.000e-19UniRef50_A0A1T4S8D4 Predicted amidohydrolase n=5 Tax=Carboxydocella TaxID=178898 RepID=A0A1T4S8D4_9FIRM  ali  41  3...........REYHTPDVIVYWDSDLCTHSGNCVRALPRVFRPMERPWVKTDRAAAEEIIKAIDLCPSGALRY... 65
102 7.000e-19UniRef50_I3YQG1 Uncharacterized protein n=60 Tax=Bacteroidetes TaxID=976 RepID=I3YQG1_ALIFI  ali  28  3......TEKKRIEYTNGEIVVVWQPHLCIHSGVCVRMLPEVYNPQERPWVKLENATTDRIVAQVEKCPSGALSYRK. 72
103 7.000e-19UniRef50_A3IDL5 Uncharacterized protein n=21 Tax=Bacillales TaxID=1385 RepID=A3IDL5_9BACI  ali  45  2...RDVLGMGYREYRGEEITVYFDKDMCQHAAECVKGLPEVFNVKAKPWIAPDEAAAKHVAEVINRCPSGALKYK.. 73
104 7.000e-19UniRef50_A0A2M8NY49 Iron-binding protein n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A2M8NY49_9CHLR  ali  32  1MSEKYTGASEDKRYEGENVDIMYNIKRCIHAAYCATRLSDVFDNKKRPWVNPDGATVDKIVTTIELCPSGALHYDRK 77
105 7.000e-19UniRef50_A0A0D5YTN4 Uncharacterized protein n=7 Tax=Bacteroidetes TaxID=976 RepID=A0A0D5YTN4_9FLAO  ali  33  1.....MEKEIVKEYSNGELTVIWKPKKCIHSEICVKTLPEVYRPNEKPWIKPGNATIDQLKDQISKCPSGALTY... 69
106 7.000e-19UniRef50_A0A2N1P5G9 Uncharacterized protein n=1 Tax=candidate division Zixibacteria bacterium HGW-Zixibacteria-1 TaxID=2013855 RepID=A0A2N1P5G9_9BACT  ali  36  78.KTEHRLKDRWRDYSGQKIIVHDNRSLCSHSGVCTRGLSAVFNTAKRPWIHPDGAPANDVAEIVKKCPSGALSYT.. 151
107 7.000e-19UniRef50_Q12YH8 Zinc finger domain-containing protein n=2 Tax=Methanosarcinaceae TaxID=2206 RepID=Q12YH8_METBU  ali  33  66.KEKDRVADRVDTYVGKYITIHRDRYVCSHVGHCIRNLPSVFKKGREPWADPDAADPEEIAKLIRTCPSGALSYT.. 139
108 8.000e-19UniRef50_D2TJK5 Uncharacterized protein n=15 Tax=Bacteria TaxID=2 RepID=D2TJK5_CITRI  ali  60  2..DKQLEQAGYRVYTGDNIDVYFNTAICQHSGNCVRGSAQLFNLQRKPWIMPDEVEVATVVKVIDSCPSGALQYRHK 76
109 9.000e-19UniRef50_X4ZEG4 Uncharacterized protein n=1 Tax=Paenibacillus sabinae T27 TaxID=1268072 RepID=X4ZEG4_9BACL  ali  45  2........SEPKVYYGKNINVMFNSEICIHSGVCVKGFPSVFNLSKRPWVDPDAATAEEIARHIDKCPSKALTY... 67
110 9.000e-19UniRef50_Q0AUF2 Putative flavoprotein n=4 Tax=Syntrophomonas TaxID=862 RepID=Q0AUF2_SYNWW  ali  31  413.KREEVVGNYIKEYANEDIIVYWDPALCQHDTHCFTRLPQVFNPEARPWVKIDGAPAEAIIRSINRCPSGALRY... 485
111 9.000e-19UniRef50_A0A1M6IBA6 Uncharacterized Fe-S cluster protein YjdI n=1 Tax=Parasporobacterium paucivorans DSM 15970 TaxID=1122934 RepID=A0A1M6IBA6_9FIRM :  ali  37  2...EKSNEQKVSKYSSDEITIGYYPDRCIHSGVCTRNLPSVFSMKTKPWVNPNGATVEEIKNLIDRCPSGALFYE.. 73
112 1.000e-18UniRef50_A0A2V7KW71 Uncharacterized protein n=1 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2V7KW71_9BACT  ali  33  5........KRRQTYEADDIIVTFDPDVCIHSGVCVRGLPDVFDIKHKRWVRPELASADVVAAQIMRCPSGALQFVRK 73
113 1.000e-18UniRef50_UPI000D6E7CA1 (4Fe-4S)-binding protein n=1 Tax=Reichenbachiella versicolor TaxID=1821036 RepID=UPI000D6E7CA1  ali  33  2.........PIRHYTKDGLTIKWDSSICVHSGVCVAGLSKVFKPKETPWIDMDAASLDEIEAQVKKCPSGAISIV.. 67
114 1.000e-18UniRef50_F2RF04 Uncharacterized protein n=4 Tax=Streptomyces TaxID=1883 RepID=F2RF04_STRVP  ali  36  13.......TPKLKEYEGEGITVTFEPRRCLHAAECVHGLPEVFDLSRRPWVRPDAAEAGLVAEVVRRCPSGALQYH.. 80
115 1.000e-18UniRef50_A0A1Y3QW87 (4Fe-4S)-binding protein n=9 Tax=Bacteria TaxID=2 RepID=A0A1Y3QW87_9BACT  ali  27  4.......EKKRIEYTNGEIVVVWQPHLCIHAGVCVKMLPEVYRPSERPWVKLENSTTDKIIAQVEKCPSGALSYRK. 72
116 1.000e-18UniRef50_L9X3Z1 Uncharacterized protein n=8 Tax=cellular organisms TaxID=131567 RepID=L9X3Z1_9EURY  ali  37  1......MEENVHTYSGDRIEVSYDVNRCIHARECVRGLPEVFDPDKRPWIEPDNADVDDLEDVIVECPTGALQFDR. 70
117 2.000e-18UniRef50_A0A143Z166 Divergent 4fe-4s mono-cluster n=9 Tax=Firmicutes TaxID=1239 RepID=A0A143Z166_9LACT  ali  58  1MNESELMAHGYRKYTGEQVDVYFNLSVCTYSGNCVRGNHAIFDTKRKPWILPDADSPEEVARVIHTCPSGALKYRLK 77
118 2.000e-18UniRef50_A4CKI5 Uncharacterized protein n=1 Tax=Robiginitalea biformata (strain ATCC BAA-864 / HTCC2501 / KCTC 12146) TaxID=313596 RepID=A4CKI5_ROBBH  ali  32  1.....MSDEIVKEYSKGNFHVIWKPRKCIHSKVCVEALPEVYRPQEKPWIKPDHASEEALREQIDRCPSGALGYRE. 71
119 2.000e-18UniRef50_A0A2S7KM99 Uncharacterized protein n=1 Tax=Aureitalea marina TaxID=930804 RepID=A0A2S7KM99_9FLAO  ali  37  2........DIRKEYDNGQLTVVWKPGLCFHAKECVKGLPGVFNPDRKPWIQVDQATTEALMATIDKCPSGALSY... 67
120 2.000e-18UniRef50_V4JAX9 Uncharacterized protein (Fragment) n=1 Tax=uncultured Thiohalocapsa sp. PB-PSB1 TaxID=1385625 RepID=V4JAX9_9GAMM  ali  34  1.....MSDNPIKDFPGNEIDVHWDKRLCIHIGECGYADNTLFQGDRDPWCVPDEVSRAEVREVCERCPSGALSYTDK 72
121 2.000e-18UniRef50_A0A2G5LAR9 Uncharacterized protein n=1 Tax=Maribacter sp. 4G9 TaxID=1889777 RepID=A0A2G5LAR9_9FLAO  ali  37  1.....MDKEITKEYTKEDLTIVWKPNKCIHSGVCVEKLPEVYKPKEKPWITPENANISDLQSQIKTCPSGALSYYMK 72
122 2.000e-18UniRef50_X1CE73 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1CE73_9ZZZZ  ali  32  66.KEDDRVPDKLETYEGEKLTIHDNRGACSHRGHCTDNAPKVFRMKVEPWIDPNTQDSDDTTKVIKTCPSGALSYTK. 140
123 3.000e-18UniRef50_A0A143BMQ4 Uncharacterized protein n=1 Tax=Gemmatimonas phototrophica TaxID=1379270 RepID=A0A143BMQ4_9BACT  ali  38  4.......DSITREYPGQELVVEWRQGLCAHSGNCVRANPRVFNPRRSPWIQTDQASDDEIREAVGRCPSGALRIR.. 71
124 3.000e-18UniRef50_A0A0S8JXV4 Uncharacterized protein n=3 Tax=Bacteroidales TaxID=171549 RepID=A0A0S8JXV4_9BACE  ali  26  1......MDPNDRKYSNKEITVHWKPAKCIHATTCYRELIEVFNPRNRPWVNMDGASTERIIDIVRRCPTDALTYE.. 69
125 3.000e-18UniRef50_UPI0008DA94AE hypothetical protein n=2 Tax=Rikenellaceae TaxID=171550 RepID=UPI0008DA94AE  ali  26  1......MNSRNRTYSNGTITVVWQPAECIHAGECFTTLRKVFDPSKRPWVRLDGASTEEIIGAIEMCPSRALTF... 68
126 3.000e-18UniRef50_A0A1L8RI55 Uncharacterized protein n=4 Tax=Bacteria TaxID=2 RepID=A0A1L8RI55_9ENTE  ali  50  2...EEWLQAGYRKYSGEKMDVYYHQGMCQHAAKCVKGNPAVFEVGRRPWIMPDNGEVGQLTDVIDTCPSGALKYR.. 73
127 3.000e-18UniRef50_A0A1M6FQN5 Uncharacterized Fe-S cluster protein YjdI n=1 Tax=Dethiosulfatibacter aminovorans DSM 17477 TaxID=1121476 RepID=A0A1M6FQN5_9FIRM  ali  31  62.KAENRCRDRMDTYKGKRITVYDNRGVCSHHRFCVEELPSVFKRGERLWIHPDEAEPEEIIKICEMCPSGALSY... 134
128 4.000e-18UniRef50_A0A1Y6D643 Uncharacterized Fe-S cluster protein YjdI n=1 Tax=Methylomagnum ishizawai TaxID=1760988 RepID=A0A1Y6D643_9GAMM  ali  36  1..........MQEYKNRQVIVRFNPYACSHAGECVRGLPQVFDPSKEPWIDVDAATPEAIAEVVECCPSGALSYE.. 65
129 4.000e-18UniRef50_P0AF60 Uncharacterized protein YjdI n=288 Tax=Bacteria TaxID=2 RepID=YJDI_ECO57  ali  61  2..DQALLDGGYRCYTGEKIDVYFNTAICQHSGNCVRGNGKLFNLKRKPWIMPDEVDVATVVKVIDTCPSGALKYRHK 76
130 4.000e-18UniRef50_A0A1F3KPI4 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium GWF2_35_48 TaxID=1797343 RepID=A0A1F3KPI4_9BACT  ali  25  1.....MSSRIVKRYSNGEITVIWQPDLCCHSTICYTELPEVFDPSSRPWIKPMNAPTDKIIKVVKACPTDALTFE.. 70
131 4.000e-18UniRef50_H2JWF1 Uncharacterized protein n=106 Tax=Terrabacteria group TaxID=1783272 RepID=H2JWF1_STRHJ  ali  35  3......TTPQKKAYETQDITVTYEARRCLHAAECVRGLPEVFDVNRRPWIRLDGAPAERVAEVVRRCPTGALQY... 70
132 4.000e-18UniRef50_A0A2E4EFN3 Uncharacterized protein n=3 Tax=Bacteroidetes TaxID=976 RepID=A0A2E4EFN3_9FLAO  ali  35  1..........MKKYRTENLTIGWEPDKCIHSAVCISQLASVFDINKRPWINVDGASEEEIAKQIDRCPSGALSYQKR 67
133 5.000e-18UniRef50_UPI000D3EB3B4 hypothetical protein n=1 Tax=Euzebya sp. DSW09 TaxID=2052804 RepID=UPI000D3EB3B4  ali  33  3..........RRTYATDEIEVGWDASLCIHTARCLKAAPEVFDVNRRPWIVPDAVSADEVIAAVATCPTGALTVRR. 68
134 5.000e-18UniRef50_W9B356 YjdI protein n=200 Tax=Bacteria TaxID=2 RepID=W9B356_KLEPN  ali  60  2..DKELLEAGYWAYTGEKIDVYFNTAICQHSGNCVRGSAKLFNLKRKPWIIPNEVDVATVVNVIDTCPSGALQYRHK 76
135 5.000e-18UniRef50_A0A221SV98 Uncharacterized protein n=3 Tax=Terrabacteria group TaxID=1783272 RepID=A0A221SV98_9DEIO  ali  33  7..EPGVPAHWGRAYTAPDVTVYYDARRCIHFAACVRGLPQVFNPDARPWIQAGAATAVEVAEVVRRCPTGALHYVLR 81
136 5.000e-18UniRef50_A0A0P9DL11 Uncharacterized protein n=1 Tax=Kouleothrix aurantiaca TaxID=186479 RepID=A0A0P9DL11_9CHLR  ali  30  1......MADRTHHYRTDAIEVSYDTGRCIHAAECVRRLPAVFNTERRPWVQPANASPDAIAEVVMRCPSGALHFTR. 70
137 5.000e-18UniRef50_F3YA16 Uncharacterized protein n=2 Tax=Melissococcus plutonius TaxID=33970 RepID=F3YA16_MELPT  ali  45  1MNEKTLIKNDYKKYYGKMIDVYYSKDICKHVGNCIKGDPNIFTVNRRPWIIPDNAMPDKVERVVNTCPTGALKFIRR 77
138 6.000e-18UniRef50_A0A1F3NL75 Uncharacterized protein n=7 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1F3NL75_9BACT  ali  24  2..ERDKSQSNNRKYSNDEITVYWKPDACVHASYCYRELIEVFDPGRRPWVDMKGAPTSLIIETVNLCPTEALTWK.. 74
139 6.000e-18UniRef50_Q11RZ2 Uncharacterized protein n=36 Tax=Bacteria TaxID=2 RepID=Q11RZ2_CYTH3  ali  30  1......MDDITKHYSNDEITVVWKPSLCTHSTLCWKGAKRVFNPMQRPWITPEGGTTAEIIERVDRCPSGALSYVR. 73
140 6.000e-18UniRef50_Q8A7N0 Uncharacterized protein n=125 Tax=Bacteria TaxID=2 RepID=Q8A7N0_BACTN  ali  33  6............EYTNGELTIAWQPEMCQHAGICVKMLPNVYHPKERPWVQIENATTEELIAQISKCPSGALSYR.. 68
141 7.000e-18UniRef50_A0A1F3ETV0 Uncharacterized protein n=4 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1F3ETV0_9BACT  ali  25  1......MKSKDRKYTNGEITVFWKPALCDHSTICFRKLPKVFNPIERPWVNINGEPTNKIIEIVDLCPTQALSY... 68
142 7.000e-18UniRef50_A0A0C2SDJ9 Uncharacterized protein n=1 Tax=Jeotgalibacillus soli TaxID=889306 RepID=A0A0C2SDJ9_9BACL  ali  33  1......MTSRTKHYTSDEIDVYFHPDRCTHVSECVKRLPSVFNPNNRPWVNPEQGTSDEIAYVIEKCPTGALEYVRK 71
143 8.000e-18UniRef50_A0A1X7BQT6 Iron-binding zinc finger CDGSH type n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A1X7BQT6_9RHOB  ali  35  217...RDRTPDGVKVFDGKQIDIHYNRLVCSHAGECGARLKAAFDTKRDPWIVPDNATPDQIKEVVGACPSGALSWSE. 289
144 8.000e-18UniRef50_A0A2K9PMW0 Uncharacterized protein n=5 Tax=Bacteroidetes/Chlorobi group TaxID=68336 RepID=A0A2K9PMW0_9FLAO  ali  27  2........SKIKEYSNGETTVVWEAEKCIHSAICAKGLSQVFRPKERPWVKIDAASTDAIINQVKQCPSGALRY... 67
145 9.000e-18UniRef50_UPI0006A949BC hypothetical protein n=2 Tax=Persicobacter TaxID=59740 RepID=UPI0006A949BC  ali  34  1..........MKEYQKGNTIVIWNPDLCTHSANCVNGLGSVFNPNTKPWINVDGASEAEIRAQVGKCPSGALSIKD. 66
146 1.000e-17UniRef50_A0A2E7AQM5 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2E7AQM5_9BACT  ali  44  85.............YEGEEITVHDNRGICAHIGYCADELPEVFRVGIEPWIDPDGAPGEQVKEQIRRCPSGAL..... 143
147 1.000e-17UniRef50_UPI0009F56196 hypothetical protein n=1 Tax=Exiguobacterium sp. KRL4 TaxID=1914536 RepID=UPI0009F56196  ali  40  16......................VDPEVCIHSGYCVKSLPTVFDVKKRPWIESGGAPVEDVIRVVDGCPSGALSYERR 70
148 1.000e-17UniRef50_A0A1S9CZ51 Uncharacterized protein n=4 Tax=Proteobacteria TaxID=1224 RepID=A0A1S9CZ51_9GAMM  ali  33  1..........MQEYKSDKLVVRYDPKICIHAGNCVRELPAVFDIAKEPWITIRGAPTEEIVNQVKRCPSGALSYE.. 65
149 1.000e-17UniRef50_A0A191TIB9 Uncharacterized protein n=1 Tax=Arachidicoccus sp. BS20 TaxID=1850526 RepID=A0A191TIB9_9BACT  ali  27  1......MPKNILHYTKGNLTVIWQPKLCQHSKICWHGLREVFDPFVRPWINMEGASAERIVEQVTRCPSGALTYE.. 69
150 1.000e-17UniRef50_A0A1E5T0A1 Uncharacterized protein n=4 Tax=Flammeovirgaceae TaxID=200667 RepID=A0A1E5T0A1_9BACT  ali  26  4.......EPVIKEYSSEEVTVVWEPAKCIHSGICLRGLPKVFDLKSRPWVNINGSDAKSIVETVRECPSKALTIK.. 71
151 1.000e-17UniRef50_A0A2V8ZSY2 Uncharacterized protein n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8ZSY2_9BACT  ali  31  4.......SDTARHYCDDAIEITYDAHRCIHAAECIRGLPAVFDSGRRPWIVPSAASADEIANVIARCPSGALHFKRR 73
152 1.000e-17UniRef50_UPI000CD58DE8 hypothetical protein n=1 Tax=Streptomyces TaxID=1883 RepID=UPI000CD58DE8  ali  35  39...EAPGRSAVRAYRGRSITVTFEAGRCQHAAECVRRLPEVFDPAARPWIRPDGADVERVAEVVGRCPSGALR.... 108
153 1.000e-17UniRef50_A0A2E0KVA1 Uncharacterized protein n=2 Tax=Anaerolineaceae bacterium TaxID=2024896 RepID=A0A2E0KVA1_9CHLR  ali  37  1MTDRNTGSD--RRYTGEAVDILYNVKRCIHAEFCVHRAAEVFDTQKRPWINANGASADKIATVIELCPSGALHYDRK 75
154 1.000e-17UniRef50_A0A1V5MWE0 3-oxoacyl-(Acyl-carrier-protein) reductase FabG n=1 Tax=Bacteroidetes bacterium ADurb.Bin408 TaxID=1852813 RepID=A0A1V5MWE0_9BACT  ali  30  282...EEENTTVIRKYTNGEITIVWQPHLCTHVAYCFSELPEVFNPAERPWINPYGASTEKIIAQITRCPTDALTY... 352
155 1.000e-17UniRef50_A0A1G8H9N3 Uncharacterized Fe-S cluster protein YjdI n=3 Tax=Planococcaceae TaxID=186818 RepID=A0A1G8H9N3_9BACL  ali  40  1......MKLVQKEYRGSEIDVYFTPALCIHAAECVKGLPLVFDTTRRPWVDPQQGSLEAIAQVIERCPSGALQYGRK 71
156 1.000e-17UniRef50_V7I1L1 Uncharacterized protein n=2 Tax=Youngiibacter TaxID=1408818 RepID=V7I1L1_9CLOT  ali  43  69...EDCPTSRIRRYQGDGITIIFNSVLCYHSGRCLKGLPEVFDRERRPWIKADAADWKRIAEVIETCPSGALDYELK 142
157 2.000e-17UniRef50_UPI000D38118C GNAT family acetyltransferase n=2 Tax=Bacillaceae TaxID=186817 RepID=UPI000D38118C  ali  48  1MSEQQLLNAGYRKYSGEKIDVFYSKDLCEHVGNCVKGSIDVFNPKRKPWVLVDAKSADEVARIIDTCPTKALQYV.. 75
158 2.000e-17UniRef50_Q0EZX6 Uncharacterized protein n=8 Tax=Zetaproteobacteria TaxID=580370 RepID=Q0EZX6_9PROT  ali  39  2........SDKQTYEGENISVCFDATRCIHAGNCVKGLPEVFRSGEGPWIHPNAATPDELAALCDTCPSGALTYRRK 71
159 2.000e-17UniRef50_UPI000C0883F0 hypothetical protein n=1 Tax=Bacillus sp. Marseille-P3800 TaxID=2014782 RepID=UPI000C0883F0  ali  44  1MKQE-LEEQGYRRYYGEAIDVYFNKDVCIHAAKCVQNLNEVFDTEKRPWIQPDQAKASDVEATVKLCPSGALQYKR. 75
160 2.000e-17UniRef50_A0A0S7BHD4 Uncharacterized conserved protein n=1 Tax=Longilinea arvoryzae TaxID=360412 RepID=A0A0S7BHD4_9CHLR  ali  31  1......MEDRIKDYTGKEIVVHFSPQRCTHVGECTARLARVFDTSRRPWVKPDAASAQEIAEVVLRCPTGALHFTR. 70
161 2.000e-17UniRef50_A0A1E5SXA0 Uncharacterized protein n=5 Tax=Cytophagales TaxID=768507 RepID=A0A1E5SXA0_9BACT  ali  28  1.....MEEPVVKEYTNGELTVIWKPQQCIHSGICLRGLPKVFNLKQRPWINMTAASSEDIVALVRDCPSKALSIK.. 70
162 2.000e-17UniRef50_UPI0003690AB1 hypothetical protein n=1 Tax=Smaragdicoccus niigatensis TaxID=359359 RepID=UPI0003690AB1  ali  34  8...........KEYTADGITVLFDGTRCRHFAECVKGLPAVFNTKERPWIQPAEGDPQAVAEVVERCPSGALRYV.. 71
163 2.000e-17UniRef50_G7W737 Uncharacterized protein n=6 Tax=root TaxID=1 RepID=G7W737_DESOD  ali  32  1..........MKNYQNEHIIVHWFPELCAHPGTCLRALPKVFNLKQRPWVNVDGAEPEVIIKTIDQCPSGALRY... 64
164 2.000e-17UniRef50_A0A2E0UIC2 Uncharacterized protein n=1 Tax=Ectothiorhodospiraceae bacterium TaxID=2026737 RepID=A0A2E0UIC2_9GAMM  ali  34  64..ETDRSNDRWRDYEGKEIMVHDNRTICSHAEECLKNSPSVFKAKEKPWIVPDAASRDEIIATVKKCPSGALSYT.. 136
165 3.000e-17UniRef50_A0A1C5E207 Uncharacterized Fe-S cluster protein YjdI n=1 Tax=Streptomyces sp. Ncost-T10-10d TaxID=1839774 RepID=A0A1C5E207_9ACTN  ali  39  1MVTERPPRPVARSYDGEGVTVRCDVHRCLHAAECARGLPTVFGTGRKPWIQPGNAPADDIADVIHRCPSGALQYHR. 76
166 3.000e-17UniRef50_A0A2W1RQA5 Uncharacterized protein n=4 Tax=Curtobacterium TaxID=2034 RepID=A0A2W1RQA5_9MICO  ali  30  1.....MVDSAVHHYPADGVIVTWDGSICRHFAVCVRQLPEVFDTARRPWVQPENADPARIVATVRACPSGALQIE.. 70
167 3.000e-17UniRef50_A0A1F2WT90 Uncharacterized protein n=1 Tax=Actinobacteria bacterium RBG_13_55_18 TaxID=1797197 RepID=A0A1F2WT90_9ACTN  ali  36  76.KESDGSVNGRRDYAGKRITIHDNRYLCSHAGFCWRELPAVFRKEARPWIDPDAADPEDIIAVIEKCPSGALSY... 148
168 3.000e-17UniRef50_S1RLW7 GNAT family acetyltransferase n=9 Tax=Lactobacillales TaxID=186826 RepID=S1RLW7_9ENTE  ali  55  3VTEEELLAQGYRKYTGEKVDIYYNRNICEHVSNCVRGNPQVFEVGRKPWILSDNGEAQEVMRVVNTCTTGALKYVYK 79
169 3.000e-17UniRef50_A0A2D5UI04 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2D5UI04_9BACT  ali  35  4.......KDIVKEYRTKEITVVWKPGICIHAANCLNSLPHVYQPDKSPWIMVENATTEELINQINTCPSGALSYK.. 71
170 3.000e-17UniRef50_U5VYK3 Uncharacterized protein n=12 Tax=Actinobacteria TaxID=201174 RepID=U5VYK3_9ACTN  ali  38  1.....MSEPNLKSYPGSDITVMFDGGRCLHFAECVRGLPEVFDVSARPWIAPDNAAAAALAAVVERCPSGALQYTR. 71
171 3.000e-17UniRef50_A0A1I0NZL6 Putative redox protein n=1 Tax=Chitinophaga sp. YR573 TaxID=1881040 RepID=A0A1I0NZL6_9BACT  ali  30  143........EKKINYTNGDVTVVWKPELCKHSARCVNGLPEVFDINAKPWVNMQGATSERIMEQTAKCPTGALT.... 207
172 3.000e-17UniRef50_UPI000C0BC6EA (4Fe-4S)-binding protein n=2 Tax=Sphingobacterium TaxID=28453 RepID=UPI000C0BC6EA  ali  31  1......MEEKIIKYPNGQITVLWRPKKCIHSAVCVNMLPAVYDPGSRPWVKPENATTQELVDQINRCPSGALQYE.. 71
173 3.000e-17UniRef50_A0A1X7INF0 Uncharacterized Fe-S cluster protein YjdI n=1 Tax=Sphingobacterium psychroaquaticum TaxID=561061 RepID=A0A1X7INF0_9SPHI  ali  40  4..........TKKYTNKDITVLWTPSKCIHARVCVKSLPQVYNPQERPWIVPENATAEELKRQIDRCPSGALGYE.. 69
174 3.000e-17UniRef50_UPI0009EE3935 hypothetical protein n=1 Tax=Ramlibacter tataouinensis TaxID=94132 RepID=UPI0009EE3935  ali  34  83..RPDRTPDGVVDYPGANLVVSFNRLQCSASGRCAKSLPLVFREGERPWIQPDRADADAIAEVVRRCPSGALRYT.. 155
175 3.000e-17UniRef50_A0A1I6H166 Uncharacterized Fe-S cluster protein YjdI n=1 Tax=Robiginitalea myxolifaciens TaxID=400055 RepID=A0A1I6H166_9FLAO  ali  37  1......MSEIVKEYKGEDFAVIWKPRKCIHSEICVKTLPEVYKPKDKPWIRPENAAVEALKKQIDQCPSGALTYRD. 71
176 4.000e-17UniRef50_A0A0C1IVB1 Uncharacterized protein n=1 Tax=Ruegeria sp. ANG-R TaxID=1577903 RepID=A0A0C1IVB1_9RHOB  ali  38  60...PDRTPDKVRVYEGENINIHYNRLLCSHAAECGARLKPVFDSSRKPWIEPDNATPKEIKDVIRACPSGALSFSE. 132
177 4.000e-17UniRef50_A0A2A4Q9F3 (4Fe-4S)-binding protein n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2A4Q9F3_9BACT  ali  26  6........DQKREYTNGELTVVWEPEKCMHSGVCMRGLFSVFQPGERPWVKMDASDSGTIENQVAQCPSGALSCKR. 73
178 4.000e-17UniRef50_E8UBU0 Uncharacterized protein n=14 Tax=Terrabacteria group TaxID=1783272 RepID=E8UBU0_DEIML  ali  34  1MSDQASTPPG-KAYPAPGITVYFDGQRCIHAARCVAALPLVFDPARRPWIRADLAGAAELAEVVRSCPSGALQY... 73
179 4.000e-17UniRef50_A0A2E2TEM8 (4Fe-4S)-binding protein n=2 Tax=Bacteria TaxID=2 RepID=A0A2E2TEM8_9FLAO  ali  36  3..........IKKYEKEDIKIVWESEKCIHSANCAKGLASVFKPQEKPWIQPEGATKQAIIDQVIQCPSRALSIER. 68
180 5.000e-17UniRef50_A0A0S1SCR0 Uncharacterized protein n=17 Tax=Bacteroidetes TaxID=976 RepID=A0A0S1SCR0_9FLAO  ali  30  1.....MDKEITKEYSNGELTVVWKPKACIHSEECIHALPNVYKPKEKPWITPENATTQELKDQIAKCPSGALSY... 69
181 5.000e-17UniRef50_UPI000BB30668 (4Fe-4S)-binding protein n=1 Tax=Flavobacterium sp. ACN6 TaxID=1920426 RepID=UPI000BB30668  ali  38  2........ETIKEYKKGDFLVIWKPKLCIHAGICVKTLPQVYNPKATPWIECDNASIEDLKRQIENCPSGALSYKE. 69
182 5.000e-17UniRef50_A0A229GML0 Uncharacterized protein n=1 Tax=Streptomyces sp. NBS 14/10 TaxID=1945643 RepID=A0A229GML0_9ACTN  ali  36  4.......ESEQKAYRTESITVIFEARRCLHAAECVHRLPEVFDPTKRPWIQPDRTTAERLAEVVRRCPSGALQYE.. 71
183 6.000e-17UniRef50_UPI000684E3A6 hypothetical protein n=1 Tax=Shimazuella kribbensis TaxID=139808 RepID=UPI000684E3A6  ali  32  1..................MKVRFHAKRCIHAARCVKGLPDVFDTKKRPWINVNGATAANIAEIIERCPSGALEYTR. 58
184 6.000e-17UniRef50_A0A0L1JTQ3 Iron-binding protein n=8 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A0L1JTQ3_9RHOB  ali  41  3.........KVRTYRGTSIEIDFDMARCIHARNCFLKLPQVFDPSRKPWVAPDAAPAEEVAAMIRTCPSGALTFRR. 69
185 6.000e-17UniRef50_A0A2M7WAP6 Uncharacterized protein n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A2M7WAP6_9PROT  ali  28  1.....MSEERIHTYTAPGIVVFFEPKLCTHVAECIQGLPQVFNTRDKPWVHPEQAGADPIAEVIERCPTSALRYER. 71
186 7.000e-17UniRef50_A0A1H0Z959 Uncharacterized Fe-S cluster protein YjdI n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A1H0Z959_9GAMM  ali  37  2.........GTETVRGKQVVIHFDGARCIHSRNCVLTHPDVFVPNVEGWIHPDAVSADEVALTARLCPSGAIRYER. 69
187 8.000e-17UniRef50_A0A1F3MIK9 Uncharacterized protein n=5 Tax=Bacteroidetes TaxID=976 RepID=A0A1F3MIK9_9BACT  ali  18  1......MTNNNREYTNGEITVFWKPDTCIHATICFMKLRKVFDPSKRPWVNMKGATTQEIISICDQCPTDALTWK.. 69
188 9.000e-17UniRef50_A0A1J4YN95 Uncharacterized protein n=4 Tax=unclassified Zetaproteobacteria TaxID=1131280 RepID=A0A1J4YN95_9PROT  ali  33  2........SRMHHYEGESIIVEFDLSRCIHTGDCTRGLPEVFDTHRRGWVHPDAADAAEVARICAACPTGALRCIDK 71
189 9.000e-17UniRef50_A0A1A8ZMB2 Ferredoxin n=3 Tax=Micromonospora TaxID=1873 RepID=A0A1A8ZMB2_9ACTN  ali  25  1..................MRVRVDRDRCCGSGNCVVTAPEVFDQGDEDGAEPAPDVVDRVRRAVDLCPAGAISLDE. 64
190 9.000e-17UniRef50_A0A2E8E0X2 Uncharacterized protein n=4 Tax=Bacteria TaxID=2 RepID=A0A2E8E0X2_9BACT  ali  36  65.KAADRATDKRDNYTGAAVTLHDNRGICAHAARCTDGLASVFRLGTEPWIDPDGADAEAIVAQVNQCPSGALSY... 137
191 1.000e-16UniRef50_A0A081BR50 Zinc finger domain-containing protein n=5 Tax=root TaxID=1 RepID=A0A081BR50_9BACT  ali  32  74.NSADSTLDKRQNFEGKEITIHFNRALCSSSERCVHGLPSVFVAGGKPWIRPDGDTVAKIIATIKQCPSGALSY... 146
192 1.000e-16UniRef50_UPI000944BBD7 hypothetical protein n=2 Tax=Proteiniclasticum ruminis TaxID=398199 RepID=UPI000944BBD7  ali  43  1MTEQELLETGYRKYYGDKLDIYFKRSLCTHSRVCLKGSPKVFNVRNRPWIDQREEDLKKLIAVLDACPTKALRY... 75
193 1.000e-16UniRef50_L0F7P3 Uncharacterized protein n=3 Tax=Firmicutes TaxID=1239 RepID=L0F7P3_DESDL  ali  30  1MEKDKVMPNNYRVYRTDDLIVYWDARQCSHAGKCWKNLPQVFRPKERPWVSLTSATPEEVIATVDKCPTDALKYE.. 80
194 1.000e-16UniRef50_A0A2A4NCX2 Uncharacterized protein n=1 Tax=Bacteroidales bacterium TaxID=2030927 RepID=A0A2A4NCX2_9BACT  ali  30  2........KTKKEYSNGVVTVVYEADLCIHSGVCFKGLPEVFQPGTRPWVKAQGATTEEIIKQVQKCPSRALSF... 67
195 1.000e-16UniRef50_A0A1F4BDV2 Uncharacterized protein n=1 Tax=Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26 TaxID=1797492 RepID=A0A1F4BDV2_9PROT  ali  31  1.....MSTSKIFRYDSDGIVVTYEARRCIHAEACVHGLPAAFDPKRKPWVDAGAAPADDIARVIERCPTGALQYQRK 72
196 1.000e-16UniRef50_A0A1P9WSI5 (4Fe-4S)-binding protein n=17 Tax=Bacteria TaxID=2 RepID=A0A1P9WSI5_9BACT  ali  23  2....NDASDITKTYTNGEITVVWKPAVCIHSKICWTQLIEVFNPRQRPWIDMAGAETTRIAEQVDRCPSKALSYFR. 73
197 1.000e-16UniRef50_D8J460 Uncharacterized protein n=7 Tax=Halobacteria TaxID=183963 RepID=D8J460_HALJB  ali  36  1......MKEDVHRYVGEDGTVTYDVNRCIHVKACVEWLSQVFDPDERPWIRPDNADAEEVAAVIRDCPTGALHFE.. 69
198 1.000e-16UniRef50_A0A0G2BAK8 Uncharacterized protein n=2 Tax=Candidatus Magasanikbacteria TaxID=1752731 RepID=A0A0G2BAK8_9BACT  ali  19  18MTLEPKLPDNLPEDSAQKIRIVVDRQGCIGARSCVVVAPGVFQLDEENVVDPDSTDEDTIMLAAQSCPVLAIRLYDE 104
199 2.000e-16UniRef50_A0A2N3IAP3 Uncharacterized protein n=4 Tax=Marinifilaceae TaxID=1573805 RepID=A0A2N3IAP3_9BACT  ali  27  1......MIKTKKEYSNGVVTVVYESDLCIHSGVCSKGLPDVFQPGTRPWVKAKGAGTEEIIKQVQKCPSRALSF... 68
200 2.000e-16UniRef50_A0A1F7UKK5 Uncharacterized protein n=7 Tax=Bacteria TaxID=2 RepID=A0A1F7UKK5_9BACT  ali  17  13...................KVEVDRDVCIGAAPCVTVAPGVFQLDEENVVNQNGADAETILLAAQACPVQAIKVYDE 73
201 2.000e-16UniRef50_UPI000B4B6359 hypothetical protein n=1 Tax=Robiginitalea sp. O458 TaxID=1982593 RepID=UPI000B4B6359  ali  41  4.......EEIEKEYAKGDFHIIWKPRKCIHSGICVKKLPEVYLPDSKPWIRPENASVEALKAQILKCPSGALTFREE 73
202 2.000e-16UniRef50_P46797 Ferredoxin n=20 Tax=Thermotogaceae TaxID=188709 RepID=FER_THEMA  ali  20  1..................MKVRVDADACIGCGVCENLCPDVFQLGDDGKAKVPETDLPCAKDAADSCPTGAISVEE. 60
203 2.000e-16UniRef50_A0A0M4DHH5 Zinc finger CDGSH type superfamily protein n=6 Tax=Streptomyces TaxID=1883 RepID=A0A0M4DHH5_9ACTN  ali  37  22............AYAGHSITVTFEAGRCRHAAECVRGLPEVFDTARRPWIRPDAADAGTVAEVVRRCPSGALRYER. 85
204 2.000e-16UniRef50_A0A1X7J9H1 Uncharacterized Fe-S cluster protein YjdI n=2 Tax=Bacteroidetes TaxID=976 RepID=A0A1X7J9H1_9BACT  ali  27  2.....KVKPTKKSYESDELVVDWQPSLCIHSEKCWRGLPEVFRKDEKPWVKTDGADDQRIMEQLKSCPSGALS.... 69
205 3.000e-16UniRef50_A0A2T4WQE7 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium TaxID=1898104 RepID=A0A2T4WQE7_9BACT  ali  33  3......IKPTKREYIGDEVTIIWQAHKCIHSEKCWRSLGEVFRYGQKPWVDPNGASGEGIRKQIDQCPSAALSYV.. 71
206 3.000e-16UniRef50_D9URY5 Uncharacterized protein n=7 Tax=Streptomyces TaxID=1883 RepID=D9URY5_STRS3  ali  38  9..DDPTRREGAKRYEGAELAVSYEVGLCLHAAECVRGLPAVFDVERRPWITPDGAPAGEVAEVIERCPSGALQYH.. 81
207 3.000e-16UniRef50_D1AQ76 Uncharacterized protein n=7 Tax=Fusobacteriales TaxID=203491 RepID=D1AQ76_SEBTE  ali  37  66..RKEEKKHGPKAYKGAKITVFYDRYLCKHIGKCTHGLPEVFDAKRTPWIIPDTQDVEKLIEVIRKCPSGALSY... 138
208 3.000e-16UniRef50_A0A1V5YEH8 Iron-binding zinc finger CDGSH type n=1 Tax=Euryarchaeota archaeon ADurb.Bin190 TaxID=1852877 RepID=A0A1V5YEH8_9EURY  ali  34  49..........MKEYSNQEIIVCWQPEKCIHSRECIKGLPQVFNHNHKPWVDMKGANSEEIMRIIDRCPSGALSYKK. 114
209 3.000e-16UniRef50_UPI0009FC4CC4 hypothetical protein n=1 Tax=Nocardia acidivorans TaxID=404580 RepID=UPI0009FC4CC4  ali  28  60.KDPERVPDQLDTYPGMGVTVTDNRGLCAHSGFCTDRVPTAFRAGQEPFVAPSGARADEIAAAVRACPSGAL..... 130
210 3.000e-16UniRef50_UPI000685E3E5 hypothetical protein n=1 Tax=Nocardia concava TaxID=257281 RepID=UPI000685E3E5  ali  29  676.KDPERVADQRDSYPGEQITVFDNRGICQHSGLCTDRLATVFRAGTEPFVAPNGGRMDEIVRAVRACPSGAL..... 746
211 3.000e-16UniRef50_W0I7K2 Ferredoxin n=26 Tax=cellular organisms TaxID=131567 RepID=W0I7K2_9EURY  ali  22  1..................MKVKVDKDTCIGCGVCASICPDVFEMDDDGKAKVEETDLECAKEAAESCPTGAIIIEE. 60
212 3.000e-16UniRef50_A0A1G3R2Y1 Uncharacterized protein n=2 Tax=unclassified Spirochaetes TaxID=1130380 RepID=A0A1G3R2Y1_9SPIR  ali  36  59.KGRPRLRDRVRDIVGREITIHDNRGLCAHDESCVRGLPAVFRNGRTPWIDPDGASPEQIMATIDKCPSGALAYT.. 132
213 3.000e-16UniRef50_A0A1G7R3Z7 Ferredoxin n=1 Tax=Blastococcus sp. DSM 44268 TaxID=1550231 RepID=A0A1G7R3Z7_9ACTN  ali  28  1..................MRVSVDLDRCEGHGMCVLAAPEAFDLDDEGLLDYDPAPPEELRAAVQTCPVAAITL... 60
214 3.000e-16UniRef50_A0A2S4DDD4 Uncharacterized protein n=1 Tax=Candidatus Entotheonella serta TaxID=1652106 RepID=A0A2S4DDD4_9BACT  ali  28  23.................ALRIVVDRLRCIGAGNCVDAAPDVFQLDEKDIINPVGAPPDTIVSAAENCPVDAIKVIDE 85
215 4.000e-16UniRef50_UPI00096B82F8 hypothetical protein n=1 Tax=Nitratireductor basaltis TaxID=472175 RepID=UPI00096B82F8  ali  37  150.NETENPAGRVFSYEGSKVTVYFNKLLCSHAAECGRHAPAIFNVEQKPWVQPDEGSVASVEEVIHACPSGALTYSE. 224
216 5.000e-16UniRef50_H8KMN6 Putative redox protein, regulator of disulfide bond formation n=21 Tax=root TaxID=1 RepID=H8KMN6_SOLCM  ali  27  143.......TEKVIDYKNDDITVEWRPELCQHSTRCWSQMLQVFDPREKKWIKVDGASPERIRQQIEKCPSGALAFH.. 210
217 5.000e-16UniRef50_UPI000A1C9FF4 hypothetical protein n=1 Tax=Tuberibacillus sp. Marseille-P3662 TaxID=1965358 RepID=UPI000A1C9FF4  ali  35  4......ITTEKHNYHSSDVTVTFDPNRCNHLGYCVKHLPNAFNPEKKPWINLERADVEDVIQTVEMCPTGALQYER. 73
218 5.000e-16UniRef50_A0A0A6MZJ8 tRNA (Guanine-N(7)-)-methyltransferase n=13 Tax=root TaxID=1 RepID=A0A0A6MZJ8_9THEM  ali  20  1..................MKVRVDADACIGCGVCENLCPDVFQLSDDGKAKVPETDLPCAKDAADSCPTGAISVEE. 60
219 5.000e-16UniRef50_A0A1E4BC61 Uncharacterized protein n=1 Tax=Gemmatimonadetes bacterium SCN 70-22 TaxID=1660163 RepID=A0A1E4BC61_9BACT  ali  32  27........DLTREYRTADITVQWYASRCIHSGYCARALHAVFDPRRRPWIDPTAASPDDIATTVLRCPSGALHFVR. 94
220 5.000e-16UniRef50_A0A1V5XVS5 Ferredoxin-1 n=22 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A1V5XVS5_9BACT  ali  17  7...................KIHVDRDLCIGAAPCVTVAPGVFQLDDENVVDATGADDDTILLAAQSCPVQAIVLFDE 67
221 5.000e-16UniRef50_W4LZ99 Uncharacterized protein n=2 Tax=Candidatus Entotheonella TaxID=93171 RepID=W4LZ99_9BACT  ali  28  2.................ALRIVVDRLRCIGAGNCVDAAPEVFQLDEKDIVNPIGAPPDTIVTAAENCPVDAIKIIDE 64
222 6.000e-16UniRef50_A0A2G5ZFM3 GNAT family acetyltransferase n=2 Tax=Planococcaceae TaxID=186818 RepID=A0A2G5ZFM3_9BACL  ali  52  5..EENYLNDGYKKYVGSDLDIFYSIKKCEHAGVCARGNAEVFNPKRRPWILPDNGEANQVMKVIDACPSGALGYIKK 79
223 6.000e-16UniRef50_H2J5K5 Ferredoxin n=8 Tax=Bacteria TaxID=2 RepID=H2J5K5_MARPK  ali  15  1..................MKVFVDRDACIGCGVCENLCPDVFKINDEGKAEMEETDLPCAQDAADSCPTQAISIEE. 60
224 6.000e-16UniRef50_A0A2M7YQ54 Uncharacterized protein n=1 Tax=bacterium CG_4_9_14_3_um_filter_65_15 TaxID=1975567 RepID=A0A2M7YQ54_9BACT  ali  38  60.SAREIEEEILQEYPGREITVYFNRSICSGAANCVQGLPSVFKSGDGHWIYPDNGTVEEIVDRVHACPSGALAY... 133
225 7.000e-16UniRef50_D7C2C1 Ferredoxin n=19 Tax=Bacteria TaxID=2 RepID=D7C2C1_STRBB  ali  29  1..................MRINADADRCVGAGQCVLAAPDLFDQDDDGTVEPGAATKDAAREAVHLCPSGAITLED. 62
226 7.000e-16UniRef50_A0ADH7 Ferredoxin soy n=51 Tax=Actinobacteria TaxID=201174 RepID=A0ADH7_STRAM  ali  19  1..................MRIGIDKDTCIGAGQCALTAPDVFTQDDDGYSEVDGGGSPLVREAARACPVGAISV... 61
227 8.000e-16UniRef50_P46374 Ferredoxin fas2 n=82 Tax=Actinobacteria TaxID=201174 RepID=FAS2_RHOFA  ali  22  1..................MKVVVNERRCFGSGQCVLVAPEVFEQSNDGTVKPSPDNHSLVRAAARSCPATAIRFEE. 63
228 9.000e-16UniRef50_A0A0A8S8M8 Uncharacterized protein n=18 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0A8S8M8_9ACTN  ali  40  4...........KTYTGPEVGVTFDGEVCRHAAECVRGMPEVFDIDKRPWINPTVADTPELRDVISRCPSGALRIVE. 72
229 9.000e-16UniRef50_A0A1R1IAY7 Uncharacterized protein n=5 Tax=Tessaracoccus TaxID=72763 RepID=A0A1R1IAY7_9ACTN  ali  36  130.SERDIPTHGRKRYNGPLVDVTFDSALCNHNGQCVRTMPEVFNTANRPWINPSAADEERLRTTVRNCPTGALQLLE. 208
230 1.000e-15UniRef50_A0A068DGU8 Putative yjdI domain protein n=44 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A068DGU8_9RHIZ  ali  35  4............TVEGEKIDVGFSAKRCIHSRNCVLGDPHVFVPNAPGWIHPDAASVEKIVAIAESCPSGAITYVRK 69
231 1.000e-15UniRef50_UPI0006486C0A hypothetical protein n=1 Tax=Firmicutes bacterium ZOR0006 TaxID=1339252 RepID=UPI0006486C0A  ali  34  67.......KSRKHAYMGNKITVFYDSNLCGHIAECVNGLPSVFNPEKIQWIQAKNATPEELIEVIKRCPSGALTYKLE 136
232 1.000e-15UniRef50_I0UWY2 Ferredoxin n=63 Tax=Bacteria TaxID=2 RepID=I0UWY2_9PSEU  ali  21  1..................MRITIDFDRCESHGLCALTAPEVFRIDDDGFAEPDPSERDNVVQAVRDCPVQAIRI... 60
233 1.000e-15UniRef50_P29604 Ferredoxin n=19 Tax=cellular organisms TaxID=131567 RepID=FER_THELI  ali  21  1..................MKVSVDKDACIGCGVCASICPDVFEMDDDGKAKVAETDLECAKEAAESCPTGAITVE.. 59
234 1.000e-15UniRef50_D3RPP7 Uncharacterized protein n=32 Tax=Bacteria TaxID=2 RepID=D3RPP7_ALLVD  ali  33  1.....MSNEPVTLFEGQEIDVSWDGRLCIHLGECGKAEGDLFVGGREPWCRPDAVSRAEVREVVERCPTGALSYRDK 72
235 2.000e-15UniRef50_A0A0K2GZ66 Uncharacterized protein n=1 Tax=Corynebacterium lactis RW2-5 TaxID=1408189 RepID=A0A0K2GZ66_9CORY  ali  41  7....ESQPEGYKAYEADGVTICWNAEVCQHSRNCGHGNADVFDYDRRPWIDSNAASPEDIAADIDRCPSGALKYRLK 79
236 2.000e-15UniRef50_A0A0U1P4B7 Ferredoxin-1 n=2 Tax=Bacillus TaxID=55087 RepID=A0A0U1P4B7_9BACI  ali  24  2...............GNKIRVYVDKNKCIGSTTCIYYAAQTFTLDSEGVVNVDGNDINKIQEAVDSCPVGAITIEK. 65
237 2.000e-15UniRef50_A0A1H5EUJ6 Ferredoxin n=4 Tax=Streptomyces TaxID=1883 RepID=A0A1H5EUJ6_9ACTN  ali  26  194....................VLLDRERCCSAGQCVGAAPEVFEQDEEEVAEPDARYADEVRFAADLCPSGAITLVDE 256
238 2.000e-15UniRef50_H5XDA1 Ferredoxin n=2 Tax=Pseudonocardiaceae TaxID=2070 RepID=H5XDA1_9PSEU  ali  21  1..................MRITIDYERCEGHGLCALTAPGVFQLDDQGVAKPADSERDNVMQAIQDCPVQAIRV... 60
239 2.000e-15UniRef50_A0A0J8U9B0 Ferredoxin n=17 Tax=Actinobacteria TaxID=201174 RepID=A0A0J8U9B0_9MYCO  ali  21  1..................MRVRVDEDRCAGHGMCLTLCPEVFEMSDDGWAEVPPGSEDAAREAIQNCPERAIS.... 60
240 2.000e-15UniRef50_A0A0S2NTM4 Ferredoxin n=3 Tax=Streptomyces TaxID=1883 RepID=A0A0S2NTM4_STRHL  ali  16  88.................KMRTVVDLTRCQGYAQCVFLAPDVFELHGEEGLAVPDDQEERVRQAAAACPVQAILLGEE 151
241 2.000e-15UniRef50_A0A1G6JIV2 Uncharacterized Fe-S cluster protein YjdI n=1 Tax=Williamwhitmania taraxaci TaxID=1640674 RepID=A0A1G6JIV2_9BACT  ali  26  1......MDKNNRKYSNKEITLYWQPSECIHASTCYTQLISVFNPRNRPWVDMDGASTERIIHIINECPTRALTFK.. 69
242 2.000e-15UniRef50_A0A2I2KMK0 Ferredoxin-2 n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A2I2KMK0_9ACTN  ali  22  1..................MRVNVDFDRCASSGTCVRLAPDIFEIRDDGYLEPDDSRRDDLQEAVDSCPTEAISLSE. 63
243 2.000e-15UniRef50_A0A2G2CES2 Uncharacterized protein n=3 Tax=Campylobacterales TaxID=213849 RepID=A0A2G2CES2_9HELI  ali  35  60.SKREISKEFLEDYKGKDITVHFNRSICAGTSSCVKGSPSVFLSGERDWIRPNEDSVESIIATIKTCPSGALSY... 133
244 2.000e-15UniRef50_A0A2H0NE89 Uncharacterized protein n=1 Tax=Candidatus Komeilibacteria bacterium CG11_big_fil_rev_8_21_14_0_20_36_20 TaxID=1974477 RepID=A0A2  ali  15  144................KTMKVKIDRELCTSVATCIAVAPNTFELDDEGIANPKGDDEKTILQAAQSCPVNAILVYD. 206
245 3.000e-15UniRef50_A0A1X7PDZ5 Uncharacterized Fe-S cluster protein YjdI n=1 Tax=Mesorhizobium australicum TaxID=536018 RepID=A0A1X7PDZ5_9RHIZ  ali  32  3..........VEIAEGRDVTIRFDGKRCIHARRCVMGEPGVFRANVEGWIHPDDAAPDDILRIAYACPSGAISVTRK 70
246 3.000e-15UniRef50_UPI000DD3AB2A hypothetical protein n=1 Tax=Rhodothermaceae bacterium TaxID=2026787 RepID=UPI000DD3AB2A  ali  35  1......MADKTFRYPGDALTITYDLARCIHAAECVRGLPAVFDPDRTPWIDPDAADADAIAAVIHRCPTGALHYTR. 70
247 3.000e-15UniRef50_A0A2S8BH66 Ferredoxin n=2 Tax=Mycobacterium talmoniae TaxID=1858794 RepID=A0A2S8BH66_9MYCO  ali  17  6.............FYGGQMKVSVNLDKCVGIGMCEVAAPNVFEVGDDGQSHVAEADVAGVKQAVANCPTEALTIQD. 73
248 3.000e-15UniRef50_A0A1H9RQ39 Uncharacterized Fe-S cluster protein YjdI n=15 Tax=Proteobacteria TaxID=1224 RepID=A0A1H9RQ39_9PROT  ali  33  1..................MKVTYDANTCIHAGNCVNSLPTVFKVDGEFVIDQTGASEAEIRQTVSNCPSGALQIIER 60
249 3.000e-15UniRef50_A0A0D0NG25 Ferredoxin n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A0D0NG25_KITGR  ali  18  1..................MTVTVDQDRCCGAGQCVRNAPEVFDQREEDGVVPPAELRSAVEDAVASCPAGAIRVTD. 64
250 4.000e-15UniRef50_A0A1I1XJQ9 Uncharacterized Fe-S cluster protein YjdI n=1 Tax=Dyella marensis TaxID=500610 RepID=A0A1I1XJQ9_9GAMM  ali  34  444.....SVEDGIERVEGEKLTLLFESKRCIHARFCVTGAPTVFLANQGPWIHPDTVDVERLAEIAHACPSGAIQYRRR 516
251 4.000e-15UniRef50_Q2JDK8 Ferredoxin n=13 Tax=Frankiaceae TaxID=74712 RepID=Q2JDK8_FRACC  ali  20  1..................MRVTVDYDRCASSGTCVRLVPNVFEIRDDGFLEPDDARWDDIQEAVDSCPTEAISISD. 63
252 4.000e-15UniRef50_A0A2P8AT93 Ferredoxin-2 n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A2P8AT93_9ACTN  ali  24  4.................AVRVGVDRDRCCGAGNCVVTAPEVFDQDDEDGAEPPADTVDRVRLAVELCPAGAISV... 66
253 4.000e-15UniRef50_C1AED3 Uncharacterized protein n=1 Tax=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) TaxID=379066 RepID=C1AED3  ali  36  145..........TRAYPANQITVEWREGRCAHSGNCVRALGVVFNPKLKPWINTSTASDDEIRAAVAKCPSGALAIAE. 210
254 4.000e-15UniRef50_L7F5F1 Ferredoxin transketolase n=45 Tax=Actinobacteria TaxID=201174 RepID=L7F5F1_9ACTN  ali  17  1..................MKVVVDETTCLGTGQCAMIAPEVFEQRANGVTEPHQSRRAAVREAALACPVAAIRLSE. 63
255 4.000e-15UniRef50_A0A0J6YDE5 Ferredoxin-1 n=55 Tax=root TaxID=1 RepID=A0A0J6YDE5_9MYCO  ali  21  1..................MRITVDRSLCQDHGQCTIAAPNVFTLDDDGKLEPDESERDAVAEAADVCPAQAISF... 60
256 4.000e-15UniRef50_A0A0N1MU00 Ferredoxin n=5 Tax=Bacteria TaxID=2 RepID=A0A0N1MU00_9SPHN  ali  24  1..................MKVRIDNDLCAGFGICVGICPEVFELHDDGYAEVPPELEELVRRAADQCPARAIFVTE. 63
257 4.000e-15UniRef50_A0A0G3V3E3 Ferredoxin n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A0G3V3E3_9ACTN  ali  30  2.................ALEIKINREICMGSGNCSFWAPDVFDLDDDGVAIVDGSPEEKVILAAQGCPTQAISIIR. 63
258 4.000e-15UniRef50_A0A0A1FVC3 FdxD-related protein n=38 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0A1FVC3_9MYCO  ali  21  1..................MRVRVDEDRCAGHGMCLTLCPEVFEMSDDGWAEVPTGLEDAAREAIQNCPERAIS.... 60
259 4.000e-15UniRef50_A0A1Z4K0M8 Uncharacterized protein n=1 Tax=Calothrix brevissima NIES-22 TaxID=1973478 RepID=A0A1Z4K0M8_9CYAN  ali  32  14.....RLQRDRTIYPGKEIEVWYDRKRCIHAAECGRGLKEVFNGKKTPWIDPDQATAEQVAKVVSRCPAGALNYK.. 83
260 4.000e-15UniRef50_A0A1N6K7Q1 Uncharacterized Fe-S cluster protein YjdI n=1 Tax=Chitinophaga niabensis TaxID=536979 RepID=A0A1N6K7Q1_9BACT  ali  32  1MAQEQ--KDNSREFTNGEITIVWRPLRCQFSTHCVKGLRAVFDPHTEPWINMQNGATEEIIEQVRQCPSGALS.... 71
261 4.000e-15UniRef50_A0A1Y2PCV6 Uncharacterized protein n=1 Tax=Tenacibaculum holothuriorum TaxID=1635173 RepID=A0A1Y2PCV6_9FLAO  ali  32  5.......REITKEYSNADLRVYWKPNTCIHAKKCWKGLLQVFNPQNRPWVNMEGATTKRIMKQIDECPSGALSYKMK 74
262 5.000e-15UniRef50_I2F8S6 Ferredoxin n=46 Tax=Bacteria TaxID=2 RepID=I2F8S6_9BACT  ali  17  1..................MKVYVDKDTCIGCGVCEGICPEVFKMNDDGKAEVPETEAACAQDAADSCPVQAIKVE.. 59
263 5.000e-15UniRef50_A0A1V5L6B2 Iron-binding zinc finger CDGSH type n=1 Tax=Actinobacteria bacterium ADurb.Bin444 TaxID=1852789 RepID=A0A1V5L6B2_9ACTN  ali  41  80.SGEPMATDEGEDYEGSSLTIHDNRAACSHVGYCVKGAPAVFDKDRRPWIKPDEGDAAEVKQTIQRCPSGALAYTE. 157
264 5.000e-15UniRef50_A0A1W9Y8P8 Ferredoxin n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A1W9Y8P8_9MYCO  ali  18  1..................MKVSVDRDKCMGHGMCYALAPSVFTDDDEGYGHVPPDQAEAARAGATNCPEGAISVED. 64
265 5.000e-15UniRef50_A0A1Z1W3Y9 Ferredoxin n=11 Tax=Streptomyces TaxID=1883 RepID=A0A1Z1W3Y9_9ACTN  ali  21  1..................MRVTIDTDVCIGAGQCVMTAPKVFTQDDDGFSELLPGCEEEVREAARACPVRAITLH.. 62
266 5.000e-15UniRef50_A0A2E9MA48 Uncharacterized protein n=2 Tax=Gemmatimonadetes bacterium TaxID=2026742 RepID=A0A2E9MA48_9BACT  ali  25  43.KDPDGVPDKRENFEGDKVVVHDNRGLCAHAGRC--TLETVFRPGKEPFVDANGASADQIIETIKQCPSGALSY... 113
267 5.000e-15UniRef50_A0A1Q4VUQ7 Ferredoxin n=12 Tax=root TaxID=1 RepID=A0A1Q4VUQ7_9ACTN  ali  20  1..................MKVVVDMNKCQDHGQCVFAAPDVFRFDEDGVAHPDEGLRADVEEAADVCPLQAIRIED. 62
268 5.000e-15UniRef50_UPI0009E04CD3 hypothetical protein n=1 Tax=Saccharothrix sp. NRRL B-16314 TaxID=1463825 RepID=UPI0009E04CD3  ali  19  184.................GVRVAVDHERCRHYALCQAQAPKVFRLLDDGRLNPDAEQAPQVRAAARVCPVRAIRV... 244
269 6.000e-15UniRef50_A0A1F8QRN4 Uncharacterized protein n=1 Tax=Chloroflexi bacterium RBG_16_57_11 TaxID=1797651 RepID=A0A1F8QRN4_9CHLR  ali  33  19...........REYRNSEIAVYWEPKLCTHVGNCFRGLPLVFQPQVRPWVLVNAGSAEDIARVVMTCPTGALHFER. 83
270 6.000e-15UniRef50_A0A1Q9RXD7 Uncharacterized protein n=1 Tax=Pseudonocardia sp. CNS-004 TaxID=1904967 RepID=A0A1Q9RXD7_9PSEU  ali  21  162....................VHADRDLCIGAGLCVLTAGAVFDQDDDGIVVLLDEDVAAVHDAVANCPAGALSISEE 221
271 6.000e-15UniRef50_A8F8X9 4Fe-4S ferredoxin iron-sulfur binding domain protein n=5 Tax=cellular organisms TaxID=131567 RepID=A8F8X9_PSELT  ali  22  1..................MKVRVDEAACIGCGVCESLCPEVFKLADDGKAKVPETELDCAKDAADSCPTGAISVEE. 60
272 6.000e-15UniRef50_A0A0X1KQC2 Ferredoxin n=6 Tax=Bacteria TaxID=2 RepID=A0A0X1KQC2_9THEM  ali  18  1..................MRVRVDEAACIGCGVCESLCPEVFKMSDDGKAKVPETEESCARDAADSCPTGAIHIEE. 60
273 6.000e-15UniRef50_A0A221W2F9 Ferredoxin-2 n=8 Tax=Actinobacteria TaxID=201174 RepID=A0A221W2F9_9PSEU  ali  22  1..................MRVEVDRDRCVGAGMCVLTCPEVFDQDEEQGAAPGPERRPAVTEAAEVCPSGAITVH.. 63
274 6.000e-15UniRef50_A0A058ZMN5 Uncharacterized protein n=15 Tax=Rhodobacteraceae TaxID=31989 RepID=A0A058ZMN5_9RHOB  ali  37  70.......PDRFFTYEGQEITVSFNPRLCSHAAQCGKLAKHIFDPSQKPWVQPDNGTVAEVEAVIAACPSGALQ.... 135
275 7.000e-15UniRef50_A0A1Q7HBL4 Uncharacterized protein n=3 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1Q7HBL4_9CHLR  ali  39  2..........RKVYRGKDIEVSFDLDQCVHIGECLRGDTAVFQLKRRPWVLADEASAEVVAQVVERCPSGALQYRR. 67
276 7.000e-15UniRef50_A0A1U6EZW1 Ferredoxin n=14 Tax=Actinobacteria TaxID=201174 RepID=A0A1U6EZW1_9MYCO  ali  19  1..................MRVVVDRDRCEGHGMCEALAPDLFRVGDDDVVRPGPADRDVAELAVDSCPVQALRLE.. 62
277 7.000e-15UniRef50_A0A1X2DRP8 Ferredoxin n=39 Tax=Corynebacteriales TaxID=85007 RepID=A0A1X2DRP8_9MYCO  ali  15  1..................MKVWVDPERCQGHGLCKMIAPDSFDLDDIDGHVVPTDQHDLVREAVRSCPEQAIILTD. 64
278 7.000e-15UniRef50_A0A0Q0VMJ9 Uncharacterized protein n=1 Tax=Methanoculleus sp. SDB TaxID=1735326 RepID=A0A0Q0VMJ9_9EURY  ali  36  73.TEEGGLPDRIDTYEGKQVTVYENRRACCHEGICTEYLPLVFRPGESPRIKPDEGYAYEVERVVRRCPSGALWYAR. 147
279 7.000e-15UniRef50_A0A1V6JQL5 Iron-binding zinc finger CDGSH type n=2 Tax=unclassified Bacteroidetes (miscellaneous) TaxID=37452 RepID=A0A1V6JQL5_9BACT  ali  23  1......MDKNNRRYSNDDITVFWRPAECVHATTCYTKLLSVFNPAKRPWVDMQGAPTEQIIDIVNQCPTNALTF... 68
280 7.000e-15UniRef50_A0A0G1MCJ1 Uncharacterized protein n=21 Tax=root TaxID=1 RepID=A0A0G1MCJ1_9BACT  ali  18  37...................KIIVDRNLCIGAASCIAVAPGVFQLDSENKAVVKGADDETILLAAKSCPTRAILVFDE 97
281 7.000e-15UniRef50_A0A1B1FYL4 Uncharacterized protein n=4 Tax=Flammeovirga TaxID=59739 RepID=A0A1B1FYL4_9BACT  ali  29  4.......SSKSKIYSTDEVKVRWKPDACIHAKKCQA-LPEVFNPNNRPWIDLSLAATEEIIKTVKTCPSGALTLV.. 70
282 7.000e-15UniRef50_A0A1S2QER7 Ferredoxin n=58 Tax=Streptomyces TaxID=1883 RepID=A0A1S2QER7_9ACTN  ali  24  4...................KVSIDTNVCIGAGQCALAAPKVFTQDDDGFSHEDGTDEPMVKEAARACPVGAITVSE. 65
283 8.000e-15UniRef50_A0A0Q9KC49 Ferredoxin n=2 Tax=Mycobacterium TaxID=1763 RepID=A0A0Q9KC49_9MYCO  ali  21  1..................MKVTVDEDRCAGHGMCLTLCPEVFEMTDDGWAEIPAELETAAREAIDNCPERAIS.... 60
284 8.000e-15UniRef50_A0A0G1SKL2 Uncharacterized protein n=10 Tax=root TaxID=1 RepID=A0A0G1SKL2_9BACT  ali  22  1MVQVNNTEDKSEAVRQDGYTITVDLDKCISAGPCSIVAPLTFYLRDSDGLDPDGDSLEKVKEAARSCPILAIFIKDK 81
285 8.000e-15UniRef50_A0A151BDB7 tRNA (Guanine-N(7)-)-methyltransferase n=16 Tax=cellular organisms TaxID=131567 RepID=A0A151BDB7_9ARCH  ali  22  1..................MKVKVDRDACIGCGLCASLCPDVFELDDEGVVNPEGCDGCDCADVAEQCPVGAITIEE. 61
286 8.000e-15UniRef50_A0A0L0JII4 Ferredoxin-1 n=66 Tax=Bacteria TaxID=2 RepID=A0A0L0JII4_9ACTN  ali  20  1..................MRIEIDRDVCIGSAQCALTAPGVFTQDEDGFSEVDGGGDPLLREAVRTCPVRAISISE. 63
287 8.000e-15UniRef50_UPI000DD850FA hypothetical protein n=1 Tax=Rhizobiales bacterium TaxID=1909294 RepID=UPI000DD850FA  ali  36  4............TVEGEKIDVSFNGKRCIHSRNCVLGNPDVFVPNPGEWIHPGAADVEQVVTLAQNCPSGAIGYLRK 69
288 8.000e-15UniRef50_S4NCJ6 Uncharacterized protein n=1 Tax=Streptomyces afghaniensis 772 TaxID=1283301 RepID=S4NCJ6_9ACTN  ali  21  2...............GDRWHVEVDRSLCIGSAQCLHHAPDGFRLDQSHPAAPDTDANERVLAAAESCPVEAITITR. 65
289 9.000e-15UniRef50_C5CIR4 4Fe-4S ferredoxin iron-sulfur binding domain protein n=4 Tax=Bacteria TaxID=2 RepID=C5CIR4_KOSOT  ali  17  1..................MKVYVDKDTCIGCGVCEGLCPEVFKMNDEGKAEVPETEASCAQDAADSCPVQAIKVE.. 59
290 9.000e-15UniRef50_A1SEW2 Uncharacterized protein n=23 Tax=Terrabacteria group TaxID=1783272 RepID=A1SEW2_NOCSJ  ali  38  4...........KRYTGPLVDVTDERELCIHSAVCVRGMPAVFDTSRRPWIDPTPDLADQLRAVVARCPSGALQIVE. 72
291 9.000e-15UniRef50_A0A0I9TBQ5 Uncharacterized protein n=11 Tax=Actinobacteria TaxID=201174 RepID=A0A0I9TBQ5_9MYCO  ali  15  1..................MKVLVDQDRCVGHGICEMKAPDVFAIGDDGVSHVSDDHRDAVADAVASCPSQALRLTD. 63
292 9.000e-15UniRef50_A0A060RBS1 Uncharacterized protein n=2 Tax=Mucinivorans hirudinis TaxID=1433126 RepID=A0A060RBS1_9BACT  ali  23  1......MKSRNRIYTNNEIVVFWRGGDCMHSTLCFSELREVFDPIKRPWVNLQGAPTKKILDIIERCPSTALTWVDE 73
293 1.000e-14UniRef50_A0A101EJI5 tRNA (Guanine-N(7)-)-methyltransferase n=1 Tax=Petrotoga mobilis TaxID=69499 RepID=A0A101EJI5_9BACT  ali  16  27...............GVAMKIVIDKEACIGDAICESLCPDVFQTADDGKAEVIDEDAPCVQDAIDACPTEAISIEE. 89
294 1.000e-14UniRef50_A0A2C9T3H2 Ferredoxin n=2 Tax=Mycobacteriaceae TaxID=1762 RepID=A0A2C9T3H2_9MYCO  ali  19  1..................MRVHVDRTKCSGIGLCEMTAPAVFEIGDDGQSEPPESERAAAQDAVSSCPTGALSIE.. 62
295 1.000e-14UniRef50_P18325 Ferredoxin-2 n=56 Tax=Actinobacteria TaxID=201174 RepID=FER2_STRGO  ali  18  1..................MRIHVDQDKCCGAGSCVLAAPDVFDQREEDGIVPPAALHDAVREAATICPAAAITVTD. 64
296 1.000e-14UniRef50_X1N8G1 Uncharacterized protein n=5 Tax=root TaxID=1 RepID=X1N8G1_9ZZZZ  ali  22  1..................MKVNVDRDLCIGVSNCVAIAPTVFKLDDKNVLDPSSVDDDALLEAAESCPENAIIVED. 61
297 1.000e-14UniRef50_A0A1I6MQ48 Uncharacterized Fe-S cluster protein YjdI n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A1I6MQ48_9GAMM  ali  30  444.....SVQDGIEQVEGEKLTLLFEAKRCIHARFCVTGAPTVFLANQGPWIHPDTMDAERLADIAHACPSGAIRYKRR 516
298 1.000e-14UniRef50_I1D4F6 Ferredoxin n=3 Tax=Pseudonocardiaceae TaxID=2070 RepID=I1D4F6_9PSEU  ali  22  10.............YRNQEMPITIDYDRCGGHGLCALTAPEVFQMDDQGVAEPADSERDNVIQAIPDCPVQAIRV... 78
299 1.000e-14UniRef50_A0A2M7ZHP2 Uncharacterized protein n=2 Tax=unclassified Ignavibacteriales TaxID=1951140 RepID=A0A2M7ZHP2_9BACT  ali  33  1......MSKEVQNYKKDELGISYDPKICTHSANCVNKLPEIFNIENKPWVNLNNATKEKLALAVKNCPSGSLKLINE 71
300 1.000e-14UniRef50_A0A1G8AB59 Zn-finger domain of CDGSH type-containing protein n=4 Tax=Mucilaginibacter TaxID=423349 RepID=A0A1G8AB59_9SPHI  ali  28  534.KLPGRTADRLDKYPATDFTVCDNRGICQHSGFCTDELPEVFRLGKEPFVDQTAASGERISQQTKRCPSGALSF... 606
301 2.000e-14UniRef50_A0A257G8L7 Ferredoxin n=1 Tax=Novosphingobium sp. PASSN1 TaxID=2015561 RepID=A0A257G8L7_9SPHN  ali  22  2..............SSPHLAISIDHATCIGSGNCVANAPGVFEQDDDGVIDAGAQLRELIEFAVLSCPVRAISIND. 66
302 2.000e-14UniRef50_Q825I7 Putative ferredoxin n=20 Tax=Streptomyces TaxID=1883 RepID=Q825I7_STRAW  ali  20  31....................IVIDRDLCIGAGQCALTAPGVFTQDDDGFSELDGAGDPMVREAARSCPVGAITV... 89
303 2.000e-14UniRef50_UPI000690536C divergent 4Fe-4S mono-cluster n=1 Tax=Prevotella sp. 10(H) TaxID=1158294 RepID=UPI000690536C  ali  37  2......................WRPEICQHSGICVRTLPQVYNPNERPWVKPQNATTEQLIAQIKMCPSEALRYE.. 54
304 2.000e-14UniRef50_A0A1C6TS80 Ferredoxin n=1 Tax=Micromonospora citrea TaxID=47855 RepID=A0A1C6TS80_9ACTN  ali  19  1..................MTVTVDLDLCQNHGQCVYAAPEVFAFDEDEVLEPPRSRHDQVRAAVAACPVRAIRLV.. 61
305 2.000e-14UniRef50_UPI00082F4FBE ferredoxin n=1 Tax=Altererythrobacter sp. MH-B5 TaxID=1172626 RepID=UPI00082F4FBE  ali  22  1..................MKVKVDAAKCQGNARCWTWAPNLFELNDEGYVNVPEGEEENARRAVKSCPERALTLEE. 63
306 2.000e-14UniRef50_K2A2W5 Uncharacterized protein (Fragment) n=1 Tax=groundwater metagenome TaxID=717931 RepID=K2A2W5_9ZZZZ  ali  21  25.........KRNSWSGGIMSVKVNQELCIGCGTCVSLCEDVFELNEEGKSQVKTSAAECIKQSIDACPVQAIS.... 93
307 2.000e-14UniRef50_A0A2R8BJL3 Uncharacterized protein n=4 Tax=Rhodobacterales TaxID=204455 RepID=A0A2R8BJL3_9RHOB  ali  35  73.......RDRVIAYEGAEMTVTYNPRICSHAAECSRLAGHVFNSNEKPWVQPDKGTRAELETVIAACPSGALAFE.. 140
308 2.000e-14UniRef50_A0A1M5MQ97 Flavorubredoxin n=1 Tax=Thermosyntropha lipolytica DSM 11003 TaxID=1123382 RepID=A0A1M5MQ97_9FIRM  ali  31  415..KEEAGTGNMREYVSSDLIVYWYPDKCIHDTNCFVNLPEVFAPEKRPWVNLKGADPVAIMRNIDNCPSGALQY... 486
309 2.000e-14UniRef50_A0A2J0LXU1 Cytochrome n=4 Tax=Candidatus Moranbacteria TaxID=1752737 RepID=A0A2J0LXU1_9BACT  ali  16  17...............NNGWTVEVDANACIGAAPCTAMAPNTFALNDDGKAGVDQDDQEIILNAARSCPVAAIIIKDE 82
310 2.000e-14UniRef50_UPI000A07B695 ferredoxin n=1 Tax=Nocardia vaccinii TaxID=1822 RepID=UPI000A07B695  ali  21  20..............EVRDWTVRVDRTACIGCGVCLDYAPSSFTHDDDGQAEPPGDELDRVRQAVGACPTGALQL... 82
311 2.000e-14UniRef50_E8N0G2 Putative ferredoxin n=5 Tax=Terrabacteria group TaxID=1783272 RepID=E8N0G2_ANATU  ali  15  1..................MKAFVDRDLCMGCGVCETIAPSVFKLEDDGIAVVPPEEEANVREAMDSCPEQAISIEE. 63
312 2.000e-14UniRef50_C6BXZ6 Uncharacterized protein n=4 Tax=Deltaproteobacteria TaxID=28221 RepID=C6BXZ6_DESAD  ali  30  61.TRENSDKKAPEHYVGKDITIVFDRYLCMGNGAC-GELESVFGTHDEPKYDPDAASVDEIIATIKNCPSGALSY... 132
313 2.000e-14UniRef50_UPI00098454C5 (4Fe-4S)-binding protein n=1 Tax=Cellulophaga sp. W5C TaxID=1888890 RepID=UPI00098454C5  ali  35  1..........MEKFIKDDLCIIWDASKCIHAGCCVKLLPNVYKPNETPWINTKNASKEKIKSQISKCPSGALTI... 64
314 2.000e-14UniRef50_UPI000B4AE823 ferredoxin n=1 Tax=Kineosporia sp. R_H_3 TaxID=1961848 RepID=UPI000B4AE823  ali  20  1..................MKVVVDMTLCQDHGQCAIAAPEVFRMDEDSKAEPDGSLSDAVQDAIDVCPVQAIFLER. 62
315 2.000e-14UniRef50_A0A1V4VSP8 Ferredoxin n=1 Tax=Pelotomaculum sp. PtaB.Bin104 TaxID=1811693 RepID=A0A1V4VSP8_9FIRM  ali  20  49..................MRVEVNQDLCISCGTCIDLCPEVFKWNDDDKAEVPVDLEEQAREAVESCPTEAIT.... 108
316 2.000e-14UniRef50_A0A1I5PRL1 GCN5-related N-acetyl-transferase n=10 Tax=Lachnospiraceae TaxID=186803 RepID=A0A1I5PRL1_9FIRM  ali  36  3...........RLYETDDISVFWNSDKCRHARKCVTGCPEVFDFKRKPWIDLSQDETQRIWQTIKQCPSGALDI... 65
317 3.000e-14UniRef50_A0A151ALE1 Ferredoxin n=4 Tax=Bacteria TaxID=2 RepID=A0A151ALE1_9CLOT  ali  13  1..................MKAFVDQDTCIGCGLCPSICPDVFDMGDDGKAHVPGDAEDCAVEAQESCPVSAIKVED. 63
318 3.000e-14UniRef50_A1TCN6 Uncharacterized protein n=10 Tax=Mycobacteriaceae TaxID=1762 RepID=A1TCN6_MYCVP  ali  15  1..................MKVRVDSERCQGHTLCAMIAPDSFELSDIDGTVVPADQEDAVREAAHSCPEQAISIEE. 64
319 3.000e-14UniRef50_D9WMI4 Uncharacterized protein n=27 Tax=Actinobacteria TaxID=201174 RepID=D9WMI4_9ACTN  ali  30  3..................MRITVNRELCVGSGNCVANVPEVFDQDDEEGLEPPEELHELVEVAAQMCPVGAIDV... 64
320 3.000e-14UniRef50_G7GR62 Putative 3Fe-4S ferredoxin n=6 Tax=Actinobacteria TaxID=201174 RepID=G7GR62_9ACTN  ali  22  1..................MRIEVDLDLCQGHGMCELEAPEVFEAHKDYVSEPDESLRAQVRAAVQYCPTQALRIVE. 62
321 3.000e-14UniRef50_UPI00096B8096 ferredoxin n=2 Tax=Bacteria TaxID=2 RepID=UPI00096B8096  ali  20  1..................MKVHVDKEICAGFGVCLGLCPKVFELHDDGYADVPPEFQEAVSAAVSQCPSNAISISD. 63
322 3.000e-14UniRef50_UPI00078069B4 ferredoxin n=1 Tax=Anaerolinea thermolimosa TaxID=229919 RepID=UPI00078069B4  ali  18  1..................MKAFVDPDTCLGCGVCETIAPNVFKLGSEPYATVAPEDEAAVREAMESCPEGAITIEE. 63
323 3.000e-14UniRef50_A0A2A4YXP8 Iron-binding protein n=2 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A2A4YXP8_9PROT  ali  36  3...........RSYEGQHVIISFESRKCIHARKCAQNAPHIFNVNADGWIQPDKGEVQQAIDVANLCPSGAITYQLK 69
324 3.000e-14UniRef50_A0A0D1LJT3 Uncharacterized protein n=11 Tax=Rhizobiales TaxID=356 RepID=A0A0D1LJT3_BRAEL  ali  26  77.KDARRVPDKLDVYAGQQAHVFDNRGTCAHSGFCTDRLNSVFHLGEEPFVAPSGARLDDLINAVRRCPSGAL..... 147
325 3.000e-14UniRef50_A0A291QIP7 Putative ferredoxin n=6 Tax=Streptomyces TaxID=1883 RepID=A0A291QIP7_9ACTN  ali  18  1..................MTIHVEKDRCVGAGMCALTAPGVFTQDDDGLSEVDGADDPMVHEAVRACPVSAIAIEE. 63
326 3.000e-14UniRef50_E3J4F2 FAD-dependent pyridine nucleotide-disulfide oxidoreductase n=10 Tax=Bacteria TaxID=2 RepID=E3J4F2_FRAIE  ali  21  1..................MRLVVDLTRCQGYAQCAFLAPDVFRMDEALWYDPEPDDREQVLRAAAACPVQALRVE.. 61
327 4.000e-14UniRef50_UPI000319CEF2 ferredoxin n=6 Tax=Actinobacteria TaxID=201174 RepID=UPI000319CEF2  ali  22  2................PGWSVIVDRTRCLGCGVCAAYAPGSFTQDDEGLAEPPADPVEQVRTAVDSCPTGALSL... 62
328 4.000e-14UniRef50_A0A2S0WPG2 Uncharacterized protein n=1 Tax=Aeromicrobium sp. 592 TaxID=2079793 RepID=A0A2S0WPG2_9ACTN  ali  38  3..........RKLYSGPVVSVSFDRDVCRHAAECVRGMPEVFDVARRPWIDPTRADTETLRRVVGRCPSGALEIVER 73
329 4.000e-14UniRef50_UPI000686B2DD ferredoxin n=1 Tax=Nocardia aobensis TaxID=257277 RepID=UPI000686B2DD  ali  14  1.....MPSLPRKSADQPQTRIRVDIDRCVGAGRCVQSAPGHFDQDDDGVVDVAAADEHRVREAADLCPGQAISIV.. 75
330 4.000e-14UniRef50_Q977X3 Ferredoxin n=393 Tax=root TaxID=1 RepID=FER_THEKO  ali  16  2.................AWKVSVDVDTCIGDAICASLCPDVFEMGDDGKAHPETTDLDCAQEAAEACPVGAITLEE. 62
331 4.000e-14UniRef50_K0EQY1 Ferredoxin n=40 Tax=Actinobacteria TaxID=201174 RepID=K0EQY1_9NOCA  ali  19  1..................MELRVDRERCIGAGMCVLTAPDMFDQADEDGRVPTPDQEQAVREAVEMCPSGAITFV.. 63
332 4.000e-14UniRef50_X7ZGF2 Uncharacterized protein n=34 Tax=Actinobacteria TaxID=201174 RepID=X7ZGF2_MYCKA  ali  12  1..................MKVWVDPERCQGHTLCAMIAPDSFRLSDIDGTVVPADQQDRVREAAQSCPEQAIVITD. 64
333 4.000e-14UniRef50_A0A2P8AX25 Ferredoxin-1 n=1 Tax=Micromonospora sp. MH33 TaxID=1945509 RepID=A0A2P8AX25_9ACTN  ali  25  5..................WRLDVDQDRCIGSGQCTATAPGSFELDDDRLAHPSEAPSEDVRSAAHLCPVAAITIDE. 65
334 4.000e-14UniRef50_UPI0005D196A5 hypothetical protein n=1 Tax=Lachnospiraceae bacterium P6B14 TaxID=1410631 RepID=UPI0005D196A5  ali  33  1.....MSDRPTRVYENNSIKVYWYADRCRKAKQCVMGSWQAFDMSRRPWIDVNAIPVEEMTAIIDRCPSGALRYEMK 72
335 4.000e-14UniRef50_A0A1D8G5D3 Ferredoxin-2 n=193 Tax=Bacteria TaxID=2 RepID=A0A1D8G5D3_9ACTN  ali  17  1..................MRISIDHDRCMGAGQCALAAPGVFTHDEDGFALLPGHDPADVREAARACPVRAITLHE. 61
336 4.000e-14UniRef50_A0A1V1RGZ6 Uncharacterized conserved protein n=1 Tax=Coriobacteriaceae bacterium EMTCatB1 TaxID=1927122 RepID=A0A1V1RGZ6_9ACTN  ali  40  82.........KRVDYVGARITVHDNRALCAHVEYCVRELPSVFDRSRRPWIDPDGASVEEIVRICEKCPSGALSY... 146
337 5.000e-14UniRef50_A0A250VPP0 Pyridine nucleotide-disulfide oxidoreductase n=17 Tax=Actinobacteria TaxID=201174 RepID=A0A250VPP0_STROL  ali  17  1..................MKVVVDLTRCQGYAQCAFAAPDVFVIQGDEALEPDDAQREKIVRAAAACPVQAIFL... 60
338 5.000e-14UniRef50_A0A291Q779 Aldehyde dehydrogenase n=15 Tax=Streptomyces TaxID=1883 RepID=A0A291Q779_9ACTN  ali  25  2...............GDRWHVEVDRSVCIGSGMCVGTAPDGFTLDQSHPTHPDTDANEKVLEAAEGCPVEAITIT.. 64
339 5.000e-14UniRef50_A0A1B1MPD2 Fe3S4 ferredoxin n=4 Tax=Streptomyces TaxID=1883 RepID=A0A1B1MPD2_STRLN  ali  21  1..................MKVVVDMNKCQDHGQCVFAAPDVFSMDGDGHLVPEEALRDEVEEAADVCPLQAIRIE.. 61
340 5.000e-14UniRef50_A0A1A2Q832 Ferredoxin n=29 Tax=Mycobacteriaceae TaxID=1762 RepID=A0A1A2Q832_MYCIT  ali  14  1..................MKVRVDSARCQGHTLCAMIAPGVFELDDIDGHRVPGKLRQQVRDAARSCPEQAITFE.. 63
341 5.000e-14UniRef50_W4LL67 Uncharacterized protein n=7 Tax=Bacteria TaxID=2 RepID=W4LL67_9BACT  ali  20  3................QNLKITVDYNKCVGNAMCEISAPNVFGLNEERVKDPAGDPVELILEAAENCPVTAITVED. 65
342 5.000e-14UniRef50_UPI000477E2B3 ferredoxin n=2 Tax=Nocardiaceae TaxID=85025 RepID=UPI000477E2B3  ali  20  1..................MNIRVDRNRCEGHAMCVSLVPEIFDVGDDGKVRVEASQVADAQLAVDSCPVQALRLTD. 63
343 5.000e-14UniRef50_I4BM42 Ferredoxin n=27 Tax=Actinobacteria TaxID=201174 RepID=I4BM42_MYCCN  ali  21  1..................MRVRVDEDRCAGHGMCLTLCPEVFEMTDDGWAVADPGEEAATREAIDNCPERAIS.... 60
344 5.000e-14UniRef50_A0A260IRK9 Ferredoxin n=2 Tax=Rhodococcus TaxID=1661425 RepID=A0A260IRK9_9NOCA  ali  19  1..................MKISVDLTLCQDYGQCVYAAPTVFTLNDNGLSNPSDDDRADVEAAVDACPLQAISIV.. 60
345 6.000e-14UniRef50_W5WBT0 Uncharacterized protein n=5 Tax=Bacteria TaxID=2 RepID=W5WBT0_9PSEU  ali  20  1..................MKVVIDQDKCVGAGQCVLAAPDVFDQRDEDGIVPPAELHEDVRQAARICPALAIELDE. 64
346 6.000e-14UniRef50_A0A1K2FMS9 Ferredoxin-2 n=53 Tax=Actinobacteria TaxID=201174 RepID=A0A1K2FMS9_9ACTN  ali  18  1..................MHIEIDKDACIGAGQCALTAPGVFTQDDDGFSHEDGAGDPMVREAARACPVGAITATD. 63
347 6.000e-14UniRef50_H0E1H1 Uncharacterized protein n=1 Tax=Patulibacter medicamentivorans TaxID=1097667 RepID=H0E1H1_9ACTN  ali  36  3..........VKRYVRDDATVTFDGARCLHAARCVKGLPAVFDTARRPWIQPENAAIDELATIIARCPSGALHLER. 68
348 6.000e-14UniRef50_A0A1V1VZB2 Putative 3Fe-4S ferredoxin n=2 Tax=Nocardioidaceae TaxID=85015 RepID=A0A1V1VZB2_9ACTN  ali  26  4...............GRDMHITIDADKCCGYGDCVLAAPELFDINDDGVAYPLVSDVEQAEQAAASCPVEAIELT.. 68
349 6.000e-14UniRef50_A0A0G0MMB0 Uncharacterized protein n=10 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A0G0MMB0_9BACT  ali  19  2................PKIRVVVDPDLCIGAASCVTIAPETFQLNEENWLEVTEEEKENIMLGAQSCPTLAIFIFDE 80
350 6.000e-14UniRef50_G8RYQ1 Ferredoxin n=53 Tax=Bacteria TaxID=2 RepID=G8RYQ1_MYCRN  ali  24  1..................MRVTVDEDRCAGHGMCLTLCPEVFEMSDDGWAEVPADLESAAKDAIANCPERAI..... 59
351 6.000e-14UniRef50_A0A291STT2 3Fe-4S ferredoxin n=5 Tax=Streptomyces TaxID=1883 RepID=A0A291STT2_9ACTN  ali  20  1..................MKITVNTDVCIGAAMCTGLSPQVFTLDEEGIVNPPEELRARIEQAVGFCPVAAIKIQD. 63
352 7.000e-14UniRef50_A0A2H5YIQ8 Ferredoxin-2 n=19 Tax=Bacteria TaxID=2 RepID=A0A2H5YIQ8_9BACT  ali  25  3................RRLRIAIDYDRCVGSGICVLTAPHVFEFNDQRVIDPTGDPEELVLEAAHGCPQMAIFVED. 65
353 7.000e-14UniRef50_A0A0G0CXH6 Ferredoxin n=36 Tax=Patescibacteria group TaxID=1783273 RepID=A0A0G0CXH6_9BACT  ali  18  21...................TVWVDRNLCIGAATCVAVSPKAFAMDNEAKAVVDEDTIENIIEAARACPVAAIFIEDE 82
354 8.000e-14UniRef50_A0A1M7G4E1 Ferredoxin n=1 Tax=Bradyrhizobium lablabi TaxID=722472 RepID=A0A1M7G4E1_9BRAD  ali  25  1..................MRITVNRSRCIAAGQCVLKSPHVFDQDEQDGIVPTPEFEASARLAARVCPSEAITVHDE 65
355 8.000e-14UniRef50_A0A1H4WHG9 Ferredoxin n=3 Tax=Streptomyces TaxID=1883 RepID=A0A1H4WHG9_9ACTN  ali  19  1..................MKVSIDPNLCYGSAECVHRAPAVFDFVDDYGVVQDGGDDPRVREAAEHCPSQAISVT.. 61
356 8.000e-14UniRef50_A0A2G1XD56 Ferredoxin n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A2G1XD56_STRCJ  ali  20  1..................MRVSIDSDVCIGSGMCALTAPSVFTQDDDGFGTVDGGGDPLVKEAVRSCPVQAVTVAE. 63
357 8.000e-14UniRef50_E4N5M3 Putative 3Fe-4S ferredoxin n=32 Tax=Actinobacteria TaxID=201174 RepID=E4N5M3_KITSK  ali  22  1..................MLVHVDPDRCCGAGQCVLAAPDVFDQDERDGARPPADLAREVADAVAACPGGAIRLEE. 64
358 8.000e-14UniRef50_A0A2M8KVC2 Uncharacterized protein n=5 Tax=Candidatus Roizmanbacteria TaxID=1752723 RepID=A0A2M8KVC2_9BACT  ali  17  4.......QNNTKSHDVHDWVVTVDRSLCIGAASCMAVAPKAFALDDEAKAYVNEETKEAVLDAARVCPVAAILIKDK 77
359 9.000e-14UniRef50_UPI000D718824 ferredoxin n=2 Tax=Prauserella marina TaxID=530584 RepID=UPI000D718824  ali  23  63....................IEADRDVCIGAGMCALTAPAVFDQDDEDGRVPPASEAGVVREAVELCPSGALTLRD. 124
360 9.000e-14UniRef50_A0A0J6WB30 Ferredoxin-2 n=41 Tax=Actinobacteria TaxID=201174 RepID=A0A0J6WB30_9MYCO  ali  15  1..................MRVSVDPTKCQDHGQCAIAAPLVFTMNDDGKLEPDDSERDHVEEAADVCPAQAIFIED. 62
361 9.000e-14UniRef50_A0A1V2QBI6 Uncharacterized protein n=5 Tax=Pseudonocardiaceae TaxID=2070 RepID=A0A1V2QBI6_9PSEU  ali  13  213..DQQRLDDDQPTVENGGLRVAVDHARCRHFALCQDQAPKVFRVLDDGRLNPDADQTPQVHAAARVCPMRAIRV... 290
362 9.000e-14UniRef50_UPI0008536D33 ferredoxin n=1 Tax=Streptomyces sp. SPMA113 TaxID=913267 RepID=UPI0008536D33  ali  20  1..................MKITVNTDVCIGAAMCTGLSPQVFTLDEEGIVNPPEELRARIEQAVGFCPVAAIKVQD. 63
363 9.000e-14UniRef50_UPI0007A4FBE6 ferredoxin n=1 Tax=Nocardia flavorosea TaxID=53429 RepID=UPI0007A4FBE6  ali  22  2................PGWSVQIDRTRCLGCGVCVAYAPGSFAQDGEGLADPPADSLDEVRTAVDSCPTGALSL... 62
364 9.000e-14UniRef50_D3CRJ0 Uncharacterized protein n=6 Tax=Frankia TaxID=1854 RepID=D3CRJ0_9ACTN  ali  24  27.....................HVDRDLCMGSGSCLFQAPATFDLDDEMKVVVESDSADAVRAAVESCPSGALRFV.. 82
365 1.000e-13UniRef50_A0A128A1U0 Molecular chaperone n=1 Tax=Candidatus Nitrosotalea devanaterra TaxID=1078905 RepID=A0A128A1U0_9ARCH  ali  19  133VRSETRSETEPVQVENDSVSVNVDPGRCIACCSCETIAPSVFRVEKNVKVNPQGANSEKILDAAQTCPTKAISVSEK 217
366 1.000e-13UniRef50_A0A2M7XCN2 Ferredoxin n=1 Tax=Candidatus Uhrbacteria bacterium CG_4_9_14_3_um_filter_50_9 TaxID=1975035 RepID=A0A2M7XCN2_9BACT  ali  21  4................PKIRVRVDEDLCIGAASCVTIAPETFQLNEDNWLEVTEDEKENILLGAQSCPTLAIFIYEE 82
367 1.000e-13UniRef50_A0A100JCK5 Ferredoxin-2 n=13 Tax=Actinobacteria TaxID=201174 RepID=A0A100JCK5_9ACTN  ali  18  1..................MRVAVDRSLCCGAGNCVLVAPGVFDQDEDDGVVPASSDEAATREAAAMCPASAITLRD. 64
368 1.000e-13UniRef50_A0A2U3NSZ9 Ferredoxin n=1 Tax=Mycobacterium sp. AB57 TaxID=1841860 RepID=A0A2U3NSZ9_9MYCO  ali  32  1..................MKVTVDQNICASSGNCVMHASELFDQRDDDGVHPSPEQSEGARQAVAACPAQAIHIEE. 64
369 1.000e-13UniRef50_A0A2W0ZYX5 Putative Fe-S cluster protein YjdI/Zn-finger domain of CDGSH type-containing protein n=1 Tax=Chloroflexi bacterium TaxID=2026724  ali  32  27.TKERTMP---REYVGEQIAIGWEPKLCIHAAECVRGMPEVFDTQSRPWVTVENDRADELAGLIARCPSGALSYRR. 100
370 1.000e-13UniRef50_A0A257GMJ0 Iron-binding protein n=2 Tax=Rhodobacterales TaxID=204455 RepID=A0A257GMJ0_9RHOB  ali  39  2..........VETVQGREVTIVFDGKRCVHSRNCVLSHPEVFVPNVKGWIYPDAAPAAEVVRIGQNCPSGAIRV... 66
371 1.000e-13UniRef50_A0A1X0B2H0 Ferredoxin n=1 Tax=Mycobacterium aquaticum TaxID=1927124 RepID=A0A1X0B2H0_9MYCO  ali  13  1..................MRVTVDLALCQDHGQCAIAAPNVFTMNDDGKLEPSDAERDYVEEAADVCPAQAILIED. 62
372 1.000e-13UniRef50_L0KFQ3 Uncharacterized protein n=31 Tax=Bacteria TaxID=2 RepID=L0KFQ3_MESAW  ali  33  4............TVEGEKIDVGFSGKRCIHSRNCVLGDPHVFVPNAPGWIHPEAASVEKIVALAENCPSGAITYARK 69
373 1.000e-13UniRef50_K6X5M8 Putative 3Fe-4S ferredoxin n=1 Tax=Gordonia namibiensis NBRC 108229 TaxID=1208314 RepID=K6X5M8_9ACTN  ali  21  3...............GSTMRVVVDHAKCGGHGRCIAVAPDLFDLDDDGVSFPGDDQESAAEEAVANCPQSAIRIE.. 67
374 1.000e-13UniRef50_A0A1Z2L061 Ferredoxin n=7 Tax=Streptomyces TaxID=1883 RepID=A0A1Z2L061_9ACTN  ali  20  4..................IRVSIDSDNCIGSGQCALTASSVFTQDDDGFGMVDGAGDPLVREAVRACPVQAIALEE. 66
375 1.000e-13UniRef50_UPI00047EF45E ferredoxin n=1 Tax=Actinomadura rifamycini TaxID=31962 RepID=UPI00047EF45E  ali  24  2...............GRVMKLYADPKACVGAGLCVLRLPDVFDQDEDDGTVPDPAQESTVLNAVKACPTGALRVDR. 68
376 1.000e-13UniRef50_V7FNE6 Iron-binding protein n=7 Tax=Alphaproteobacteria TaxID=28211 RepID=V7FNE6_9RHIZ  ali  33  3............VVEGENIEIGFSGKRCIHSRNCVLGDPRVFVPNPDQWIHPEAASVEKIVALAEGCPSGAITYVRK 68
377 1.000e-13UniRef50_G7H3R4 3Fe-4S ferredoxin n=56 Tax=Actinobacteria TaxID=201174 RepID=G7H3R4_9ACTN  ali  24  1..................MRIEVDLDLCQGHGMCEMEAPEVFEAHRDYVKEPDESLRPAVEAAVRYCPTQALRIVE. 62
378 1.000e-13UniRef50_A0A100JTM6 Ferredoxin-2 n=17 Tax=root TaxID=1 RepID=A0A100JTM6_STRSC  ali  27  1..................MKVEVDLNKCQDHGQCVYAAPDLFALDDEGVADVDEASAEEVHEAAEVCPLQAITVHE. 70
379 1.000e-13UniRef50_A0A0D7N9X0 Uncharacterized protein n=13 Tax=Bacteria TaxID=2 RepID=A0A0D7N9X0_9BRAD  ali  26  77.KDPRRVPDKLDVYAGQQAFVSDNRGTCAHSGFCTDRLKSVFHLGEEPFVTPSGARLDDLVNAVRKCPSGAL..... 147
380 1.000e-13UniRef50_A0A0G1HTB9 Ferredoxin n=28 Tax=Patescibacteria group TaxID=1783273 RepID=A0A0G1HTB9_9BACT  ali  15  1..................MRVRVDRDLCIGAASCIALLPEVFELDEEGKAIIKSKDLQMILEAARSCPTNAIFIED. 74
381 1.000e-13UniRef50_E2Q1J2 Putative ferredoxin n=24 Tax=Bacteria TaxID=2 RepID=E2Q1J2_STRC2  ali  19  1..................MYIVVDLNRCQGYAQCVFLAPKVFELHGEEALRVPEDQQDPVRRAVAACPVQAITV... 60
382 1.000e-13UniRef50_A0A1V2MX59 Ferredoxin n=36 Tax=Streptomyces TaxID=1883 RepID=A0A1V2MX59_9ACTN  ali  23  2...............GDRWHVEVDRSVCIGSGMCVNHAPDAFHLDTARQSHPRTEDREQILAAAEGCPVEAITLT.. 64
383 1.000e-13UniRef50_A0A1Y0MUB6 (4Fe-4S)-binding protein n=3 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1Y0MUB6_9FLAO  ali  26  1......MDTTMHKFSNGGLTVTFDPKKCINAECCAKELSSVFRTSVIPWIHLEGAPAEQIVRQVKRCPSGALR.... 67
384 1.000e-13UniRef50_A0A2A4LV01 Iron-binding protein n=2 Tax=Rhizobiales bacterium TaxID=1909294 RepID=A0A2A4LV01_9RHIZ  ali  28  1......MPNKQPSNETDKIKVDYIAKRCIHSRKCVLGLPNVFKPGKGGWILAENADVEELVDVIKSCPSGALTFER. 71
385 1.000e-13UniRef50_A0A2H0TZM8 Uncharacterized protein n=12 Tax=root TaxID=1 RepID=A0A2H0TZM8_9BACT  ali  16  21..........MKIRAGGKIRIVVDREACIGAQSCVVVAPGVFQMDDDNVTDPNGENEDTVMLGAQSCPVLAIHLYDE 91
386 1.000e-13UniRef50_A0A239Z0D3 Ferredoxin n=4 Tax=Bacteria TaxID=2 RepID=A0A239Z0D3_CLOCO  ali  22  1..................MKAYVDKETCIGCGLCPSVAPEVFEMDDDGKAEVPDGSEELSKEAEASCPTSAISVEE. 63
387 1.000e-13UniRef50_A0A0U5M035 Ferredoxin-1 n=50 Tax=Bacteria TaxID=2 RepID=A0A0U5M035_STRRE  ali  22  1..................MRVTADRDRCVGSGQCAMLSPDVFDQDDDGLVEPAEDLREEVHRAADLCPARSLHVH.. 62
388 1.000e-13UniRef50_A0A0G0GJJ2 Ferredoxin n=6 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A0G0GJJ2_9BACT  ali  22  1..................MKIEVDRELCISVAACLQAAPNTFELDDEGIANPSGDDKEAILKAAQCCPVNAIILTE. 61
389 1.000e-13UniRef50_A0A1X1VGK1 Uncharacterized protein n=4 Tax=Corynebacteriales TaxID=85007 RepID=A0A1X1VGK1_9MYCO  ali  22  14...............GTAVRAIVDHDRCEGHGRCFAVAPDLFDLDDDGYITVPEGRHDDAREAASSCPRAAIRLVD. 79
390 1.000e-13UniRef50_Q5SFA7 Ferredoxin n=6 Tax=Streptomyces TaxID=1883 RepID=Q5SFA7_STRBI  ali  20  1..................MRVTVDQSRCLGAGQCEQLAPEVFRQDEEGVPEPDPASWPRVLQTVDLCPVQAVLIDE. 63
391 2.000e-13UniRef50_A0A2P9F194 Ferredoxin-2 n=15 Tax=Bacteria TaxID=2 RepID=A0A2P9F194_9ACTN  ali  20  1..................MKVRVDTTRCCGAGQCVLLAPEVFDQRDEDGIVVAPPHHPAVREAAAVCPTSAITVAEE 65
392 2.000e-13UniRef50_A0A0Q8GY15 Iron-binding protein n=6 Tax=Betaproteobacteria TaxID=28216 RepID=A0A0Q8GY15_9BURK  ali  34  1..........MEVVQGDKLALTFEARRCIHARFCVTGAPKVFLANQGPWLHPDAMPVERLVEIAHACPSGAIQYRRK 68
393 2.000e-13UniRef50_A0A1V5HXY5 Ferredoxin n=16 Tax=Bacteria TaxID=2 RepID=A0A1V5HXY5_9BACT  ali  17  1..................MKVSVDKDECIGCGVCAQICPEVFSMDEDAGVVIRPEGSDCAVEAADSCPVGCITVED. 60
394 2.000e-13UniRef50_A0A0M4DMQ7 Ferredoxin n=37 Tax=cellular organisms TaxID=131567 RepID=A0A0M4DMQ7_9ACTN  ali  23  1..................MQITVDMDVCQSHGQCVFAAPETFSFDDDEYLRPDDALRDRIEKAAASCPVRAITV... 60
395 2.000e-13UniRef50_A0A0F7IIK1 Ferredoxin n=15 Tax=cellular organisms TaxID=131567 RepID=A0A0F7IIK1_9EURY  ali  17  1..................MKAVVDEDVCTGCGTCADICPEVFELGDDGIAHVVGDFADCCTEAADSCPVGAITIED. 61
396 2.000e-13UniRef50_B3VA37 Ferredoxin n=107 Tax=Actinobacteria TaxID=201174 RepID=B3VA37_STRC0  ali  25  2...............GDRWRIEVDRSLCIGSGMCVSHAPDGFDLDSARQSHPRTATAEACEAAAENCPVEAIALT.. 64
397 2.000e-13UniRef50_A0A1G4S4M1 Ferredoxin n=2 Tax=Sphingobium faniae TaxID=570446 RepID=A0A1G4S4M1_9SPHN  ali  27  5....................VSVNRNLCMGAGECVWTAPKVFEMDDEGVVNPDGADDAALKMAMNGCPNFAIRYR.. 62
398 2.000e-13UniRef50_A0A1V2P1C9 Ferredoxin n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A1V2P1C9_9ACTN  ali  22  1..................MKVTVDQDACIASGQCVLTTPEVFDQRDEDGIDPPESLSSQVREAAVLCPARAIQVVD. 64
399 2.000e-13UniRef50_A0A221W5B3 Ferredoxin-2 n=50 Tax=Bacteria TaxID=2 RepID=A0A221W5B3_9PSEU  ali  23  1..................MRISVDQDKCCGAGSCVLVAPEVFDQRDEDGIVPAADVHDRVREAADVCPASAIQL... 62
400 2.000e-13UniRef50_A0A024M1E2 Ferredoxin n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A024M1E2_9MYCO  ali  20  1..................MKISVDHDLCLGSALCTGLVPDVFDLAEDGTLVPDVALLNDIEEAVRSCPVRALRLDR. 63
401 2.000e-13UniRef50_L7VD37 Ferredoxin n=164 Tax=Actinobacteria TaxID=201174 RepID=L7VD37_MYCL1  ali  20  1..................MKVRVDDQRCRGHGMCLTLCPEVFSLTDDGYADVPMELEEAVREAIQCCPEQAIS.... 60
402 2.000e-13UniRef50_A0A133UEV9 Uncharacterized protein n=5 Tax=cellular organisms TaxID=131567 RepID=A0A133UEV9_9EURY  ali  19  5.....................VVDKDTCQGHMVCVGIAPEVFEIEDDGVKNPEGADESTIQEAIDGCPADAISWKKK 63
403 2.000e-13UniRef50_E3J9F7 Ferredoxin n=8 Tax=Actinobacteria TaxID=201174 RepID=E3J9F7_FRAIE  ali  24  4...................HITIDRDLCMGSGQCLIYAPNTFDLDDDAVVDPDGDSDAELASAVTGCPTQAISVAR. 63
404 2.000e-13UniRef50_A0A0Q9RH08 Ferredoxin n=5 Tax=Actinobacteria TaxID=201174 RepID=A0A0Q9RH08_9ACTN  ali  22  1..................MKVLVDWDLCEGHGQCEFAAPEVFTIDDEGDLEPGEGQRAAVEQAIRRCPTHALAVEE. 63
405 2.000e-13UniRef50_A0A258SBT7 Uncharacterized protein n=2 Tax=Sphingomonas TaxID=13687 RepID=A0A258SBT7_9SPHN  ali  35  446..EPIQADDGRELIPGQSIDLIFDAQRCIHARHCVLGQPKVFKANEGPWIDPDATTTEGLVTVAHMCPSGAIQYRR. 520
406 2.000e-13UniRef50_A0A087RNU8 Chaperone protein DnaJ 1 n=18 Tax=TACK group TaxID=1783275 RepID=A0A087RNU8_9ARCH  ali  22  159....................VEIDKSLCIGCCSCETIAPNVFSVDKLKHINPKGANEEKIMDAAETCPTKAILVDEK 222
407 2.000e-13UniRef50_UPI000486962E ferredoxin n=1 Tax=Hamadaea tsunoensis TaxID=53368 RepID=UPI000486962E  ali  24  6..............SGPQWRVTVDPSRCIGSGLCAASAPRHFTL-QGPYATAVGDPDEEISDAAECCPTEAITVEE. 69
408 2.000e-13UniRef50_A0A1H0U4U5 Ferredoxin n=6 Tax=Actinobacteria TaxID=201174 RepID=A0A1H0U4U5_9PSEU  ali  17  6...................TVRIDQARCIGSGQCVLAAPDVFDQSDDDGAEPPAELLPAVRDAVDRCPAQVVTLEE. 68
409 2.000e-13UniRef50_A0A069JPK4 Ferredoxin n=31 Tax=Actinobacteria TaxID=201174 RepID=A0A069JPK4_9ACTN  ali  25  1..................MRIQADTERCVGAGMCALTAPDLFDQSDEDGTVVGPDADAAAREAVERCPSGALTLTER 66
410 2.000e-13UniRef50_A0A177HXP9 Ferredoxin-2 n=175 Tax=Actinobacteria TaxID=201174 RepID=A0A177HXP9_9ACTN  ali  21  1..................MRLVVDLNRCQGYAQCAFLAPDVFTMHGDEALMPDDAQREHVLRAAEACPVKAITVE.. 61
411 2.000e-13UniRef50_A0A1H8EI58 Ferredoxin n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A1H8EI58_9ACTN  ali  20  1..................MHIIVDTGKCEGFGNCVMADPDTFDLGDDGLVVAEEHDRARVEEAARSCPVEAITLERR 64
412 2.000e-13UniRef50_A0A1U7DNG5 (4Fe-4S)-binding protein n=11 Tax=Bacteria TaxID=2 RepID=A0A1U7DNG5_9FLAO  ali  30  1......MEINSKEFSNKDITVTYDPCICTLSGKCSKELSEVFSNSIIPWVNLENTETKRIIEQIKRCPSGALKY... 68
413 2.000e-13UniRef50_A0A1F9KDU4 Uncharacterized protein n=2 Tax=Deltaproteobacteria bacterium RIFCSPLOWO2_12_FULL_60_19 TaxID=1797894 RepID=A0A1F9KDU4_9DELT  ali  20  1..................MKITVDRAKCEGYGKCMQAAPKVFKLDEKFVLDATGDTDQKILLAAKLCPTKAILLDEE 62
414 2.000e-13UniRef50_A0A224X9Y6 Uncharacterized protein n=3 Tax=Lactococcus TaxID=1357 RepID=A0A224X9Y6_9LACT  ali  44  11VTEADLLSLGYRKYYSDDLDVFYNKDICAHVGNCVRGDSKVFEVGRRPWIITNAESVEQCITVVNSCPSGALKW... 85
415 2.000e-13UniRef50_A0A1M7M3Q1 Truncated hemoglobin YjbI n=11 Tax=Actinobacteria TaxID=201174 RepID=A0A1M7M3Q1_9ACTN  ali  30  192.KDPKRVPDHRETHVGQQVDVLDNRGICQHSGYCTDRLASVFHQRGEPFVTPSGGRMDEIVRAVRDCPSGALSF... 264
416 2.000e-13UniRef50_G4HTD6 Uncharacterized protein n=18 Tax=Mycobacteriaceae TaxID=1762 RepID=G4HTD6_MYCRH  ali  19  1..................MRVHVDRTKCSGIGLCEMAAPAIFEIGDDGQSDPPESERSAAEEAVSNCPTGALSIE.. 62
417 2.000e-13UniRef50_A0A1G5FNQ2 Predicted acetyltransferase, GNAT superfamily n=13 Tax=Lachnospiraceae TaxID=186803 RepID=A0A1G5FNQ2_9FIRM  ali  35  3...........RTYENEDIVVFWNSDKCFHAKRCVNGSPKTFCPGQKPWIKLDMAETKEIWQAISQCPSRALT.... 64
418 2.000e-13UniRef50_A0A076MQ00 Ferredoxin n=15 Tax=Actinobacteria TaxID=201174 RepID=A0A076MQ00_AMYME  ali  27  1..................MRIVADTDLCIGAGQCVLTEPEVFDQDDDGTVNPEGGQVDSAREAVKLCPAVALSLQE. 63
419 3.000e-13UniRef50_A0A0G1XEH7 Uncharacterized protein n=14 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1XEH7_9BACT  ali  15  1..................MKIHVERDLCIGAASCIAVAPDVYELDDENKANPKGADDQTLLDSAKACPTQAIIVLD. 61
420 3.000e-13UniRef50_A0A1C3NYJ4 Uncharacterized protein n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A1C3NYJ4_9ACTN  ali  25  8...................KVSVDTGTCIGSGQCVRLAPAVFAQRDEDVARPVGPQRQDAETAAALCPSGAIRLV.. 69
421 3.000e-13UniRef50_M7MG78 Uncharacterized protein n=12 Tax=Flavobacteriaceae TaxID=49546 RepID=M7MG78_9FLAO  ali  26  1.....METNNPNVFSNKDITVTYNPRVCIHAERCARELSNVFRDSVIPWIDLDGASTKKIINQIKKCPSGALDY... 69
422 3.000e-13UniRef50_A0A1V5WSM9 Ferredoxin-1 n=7 Tax=cellular organisms TaxID=131567 RepID=A0A1V5WSM9_9BACT  ali  21  9...................KIVVDQDICIGCGGCVSVAPDYFELNDEGKSVVNESDQKLIEEAITACPVQAISLE.. 68
423 3.000e-13UniRef50_K8NR81 Uncharacterized protein n=1 Tax=Afipia felis ATCC 53690 TaxID=883080 RepID=K8NR81_AFIFE  ali  25  4...............GCRVRISIDYDKCVGSRICTAVAPNVFTLNEDAVIDAEGDTLETIKMAAEACPVSAITIGEK 68
424 3.000e-13UniRef50_A0A1Q4HF95 Ferredoxin n=4 Tax=Mycobacteriaceae TaxID=1762 RepID=A0A1Q4HF95_9MYCO  ali  20  1..................MRVTVDRDRCVGNGVCEALAPELFVVDDNGFAEIPPEQQQLVLDAVSSCPAQALR.... 60
425 3.000e-13UniRef50_A0A2E9ZDY1 Ferredoxin n=2 Tax=Bacteria TaxID=2 RepID=A0A2E9ZDY1_9GAMM  ali  18  1..................MRVIVDHVKCAGTGMCESFAPEVFEVQPDGSLEPPEGISKAVRAAAESCPVEAISLEE. 63
426 3.000e-13UniRef50_A0A0T9K778 Ferredoxin n=264 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0T9K778_MYCTX  ali  19  1..................MKVRVDPEICQGHGICHMTAPDLFLLRDEDGADVPPGQEGLAQLAADSCPERAITV... 62
427 3.000e-13UniRef50_F6EK17 Ferredoxin reductase n=107 Tax=Actinobacteria TaxID=201174 RepID=F6EK17_HOYSD  ali  18  1..................MRICVDYTRCTGHGICETIAPSVFEVGDDEVVHPPDDLRPDIQDAIDECPTQALSFGD. 63
428 3.000e-13UniRef50_A0A133VIQ8 Ferredoxin n=1 Tax=candidate divison MSBL1 archaeon SCGC-AAA382A20 TaxID=1698280 RepID=A0A133VIQ8_9EURY  ali  25  5.....................VVDRDVCNGSAVCVEIAPGVFDLNDQGKADPQGASEEIVQQAIGACPVDAISWKEK 63
429 3.000e-13UniRef50_A0A1A2N1N8 Ferredoxin n=2 Tax=Corynebacteriales TaxID=85007 RepID=A0A1A2N1N8_9MYCO  ali  24  1..................MKVEVDTGRCQAHGLCAMIAPAVFGLDDGGYVQPGEDQREAVDEAVGCCPTEALAVID. 63
430 3.000e-13UniRef50_A0A1D9E096 Ferredoxin n=5 Tax=Bacteria TaxID=2 RepID=A0A1D9E096_9MICO  ali  24  2..................IKINVDMTKCQHYGQCVFEAPEVFRLNEDDKLEADDSERANIEAAIDVCPMQAIFIVD. 63
431 3.000e-13UniRef50_A0A133UVD3 Ferredoxin n=3 Tax=Archaea TaxID=2157 RepID=A0A133UVD3_9EURY  ali  28  5.....................VVDKNACVGAAVCVGVAPEVFDLDEEGKADPEGADEETIQRAIDGCPEDAISWQEE 63
432 3.000e-13UniRef50_UPI00047689DD hypothetical protein n=4 Tax=Streptomyces TaxID=1883 RepID=UPI00047689DD  ali  23  189................PSLTVLLDRDRCCSAGQCVGAAPEVFEQDEDGRVHPDARYADEVRFAADLCPGGAITLLD. 254
433 3.000e-13UniRef50_A0A1H9KJ99 Ferredoxin n=8 Tax=Actinobacteria TaxID=201174 RepID=A0A1H9KJ99_9PSEU  ali  20  1..................MRVVVDSHRCVGSGMCVLTQPDVFDQDEDDGAEPGPEQERDVLTAVQSCPAQAIS.... 61
434 3.000e-13UniRef50_UPI00059DF010 ferredoxin n=1 Tax=Mycobacterium sinense (strain JDM601) TaxID=875328 RepID=UPI00059DF010  ali  20  1..................MKVSVNGGRCEGHGMCEATAPDFFTLDEDGYKVVPPGRERAVRLGVESCPVAALTVTE. 64
435 3.000e-13UniRef50_A0A1X0GQ80 Ferredoxin n=59 Tax=Actinobacteria TaxID=201174 RepID=A0A1X0GQ80_9MYCO  ali  18  1..................MKVFVDFDTCDGNAVCMSICPEVFELGDDGYLHPGEDLREKVKGAEVSCPTQAITIQD. 63
436 4.000e-13UniRef50_A0A1Q8L2P5 Ferredoxin n=2 Tax=Pseudonocardia TaxID=1847 RepID=A0A1Q8L2P5_9PSEU  ali  24  33...............GGAGRIVVDVDRCIGAAQCVLSAPEIFDQDDDGFVVPPADRADRVGLAARICPSGAIR.... 95
437 4.000e-13UniRef50_A0A100XGG5 Uncharacterized protein n=23 Tax=Actinobacteria TaxID=201174 RepID=A0A100XGG5_MYCTH  ali  22  1..................MKAFVDRDKCAGIGMCEATAPNLFEVSDDGQAEIAGEDRAAAREAVDNCPAGALTITE. 63
438 4.000e-13UniRef50_A0A250VT10 Ferredoxin n=1 Tax=Streptomyces olivochromogenes TaxID=1963 RepID=A0A250VT10_STROL  ali  22  1..................MKVIVDQNKCVASGQCVLATPRVFDQREEDGIVPPEDLADDVRQAVALCPAQAIWLEE. 64
439 4.000e-13UniRef50_A0A0F7VU35 Ferredoxin 4Fe-4S single cluster domain no Rif homologue n=30 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0F7VU35_9ACTN  ali  17  1..................MEIAIDRDACIGAGMCALTAPRVFTQDDSGFSDHAGADDPLVRTAVRVCPVSALTLRD. 62
440 4.000e-13UniRef50_A0A1Y5I740 Uncharacterized protein n=1 Tax=Ostreococcus tauri TaxID=70448 RepID=A0A1Y5I740_OSTTA  ali  14  87........TTRRAKPGEDRAVFVDEFTCIGCKQCVWAAPATFRMNEDRVFAQWLNDEDDIQQAIDSCPVDCIHWVKR 159
441 4.000e-13UniRef50_A0A1E3TRL1 Ferredoxin n=15 Tax=Actinobacteria TaxID=201174 RepID=A0A1E3TRL1_9MYCO  ali  20  1..................MRVEVDLAKCTGHGICESIAEDVFEVSDDGWVHIPESDRERLQQAVTQCPAGALRMRE. 63
442 4.000e-13UniRef50_A0A1K2G1A6 Ferredoxin-1 n=14 Tax=Streptomyces TaxID=1883 RepID=A0A1K2G1A6_9ACTN  ali  24  1..................MRITIDRDRCIGSGQCVMTAPGVFTQDDDALVALDGAGDPRVREVPLACPVQAVTITE. 63
443 4.000e-13UniRef50_A0A0N0AV98 Uncharacterized protein n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A0N0AV98_9ACTN  ali  27  3..................LRITADTSVCIGAGQCVMTAPDLFDQDDIGTVVVVPAEAESVHEAAYLCPSRAITYTE. 65
444 4.000e-13UniRef50_A8UI88 Uncharacterized protein n=53 Tax=Bacteroidetes TaxID=976 RepID=A8UI88_9FLAO  ali  25  1......MDTNANVFSNDKITVTYEPSCCANAGICALQLSDVFRNSVIPWIDLDGAQTKAIINQINKCPSGALKY... 68
445 4.000e-13UniRef50_A0A1H3HA05 Ferredoxin n=2 Tax=Pseudonocardiaceae TaxID=2070 RepID=A0A1H3HA05_9PSEU  ali  21  1..................MKVHADRDRCVGSALCVLTEPAVFDQDDGGLVVVSDEESGRVRDAIDLCPSQALRL... 57
446 4.000e-13UniRef50_A0A2N0GQP2 Ferredoxin n=7 Tax=Actinobacteria TaxID=201174 RepID=A0A2N0GQP2_9ACTN  ali  21  5...................RLGVDRERCIGAGMCAMTAPGVFDQDPDDGLDPAPDRLAAARMAAGVCPSGAITVT.. 66
447 4.000e-13UniRef50_A0A0S2W1H2 Ferredoxin n=13 Tax=Clostridiales TaxID=186802 RepID=A0A0S2W1H2_9FIRM  ali  15  1..................MKVMIDRDGCISCGLCAGTCPEVFQMADDGLAEPTGENEEQVRMAADGCPVAVIHIED. 62
448 4.000e-13UniRef50_A0A2E6GIP5 Ferredoxin n=3 Tax=Synechococcales TaxID=1890424 RepID=A0A2E6GIP5_9PROC  ali  19  70....................IWVDESTCIGCRYCVHVATNTFLVDEDRVIRQNGDDVDIVQEAIDTCPVDCIHWVD. 129
449 4.000e-13UniRef50_UPI0009FDE11C ferredoxin n=1 Tax=Citricoccus sp. CH26A TaxID=1045009 RepID=UPI0009FDE11C  ali  25  52..............EGVLMRIELDRKVCQGHGVCLMTAPNLFTLDEDGLANQPEEFEDEGRLAVASCPELALTLIE. 119
450 4.000e-13UniRef50_A0A1V6AND6 Ferredoxin n=23 Tax=Bacteria TaxID=2 RepID=A0A1V6AND6_9FIRM  ali  15  1..................MKVTIDQDGCIGCGLCADTCPSVFCMNDDGFAEVCGEPDETVREAAEGCPVSVIHIEE. 62
451 4.000e-13UniRef50_A0A0J6Y481 Ferredoxin-2 n=374 Tax=Actinobacteria TaxID=201174 RepID=A0A0J6Y481_9MYCO  ali  18  5...................RVEVDADLCQGHAMCELEAPDVFSVPRRGIVEPPDEIREDVERAVEMCPTRAISITDK 67
452 5.000e-13UniRef50_A0A2M7Z714 Ferredoxin-1 n=5 Tax=Candidatus Magasanikbacteria TaxID=1752731 RepID=A0A2M7Z714_9BACT  ali  22  12..............TGKIRRIVVDREGCIGARSCVVVAPEIFQMDDENIVNPDASDDDILKMAAEACPVLAVHLYDE 77
453 5.000e-13UniRef50_A0A2E0WBB4 Uncharacterized protein n=1 Tax=Micrococcales bacterium TaxID=2026762 RepID=A0A2E0WBB4_9MICO  ali  29  8....ESTEKATRDYDQGEITVHWDAGKCTHSANCVRALPRVFRPKARPWINVSAADADALAAAVDTCPSGALAYT.. 78
454 5.000e-13UniRef50_A0A2A3IVU2 Ferredoxin n=1 Tax=Streptomyces sp. Ag82_O1-15 TaxID=1938855 RepID=A0A2A3IVU2_9ACTN  ali  21  1..................MRLVVDLNRCQGFAQCVFLAPDVFALHRDEALRFDEAERDQVEKAAAACPVQALLV... 60
455 5.000e-13UniRef50_A0A239K4X1 Ferredoxin n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A239K4X1_9NOCA  ali  18  4..................MKIEVDWDLCEGHGQCEFAAPDVFTIDDDGELEPGEDQRKSVEQAVRRCPTRALVIGD. 66
456 5.000e-13UniRef50_A0A1Y2N4Z9 Ferredoxin-1 n=10 Tax=Actinobacteria TaxID=201174 RepID=A0A1Y2N4Z9_PSEAH  ali  17  1..................MHVSVDKDLCIGAGQCVVTAPDVFDQDDDGIVHPAETDHDAVREAEHVCPARVIAVE.. 62
457 5.000e-13UniRef50_A0A1S1NQ00 Ferredoxin n=23 Tax=Corynebacteriales TaxID=85007 RepID=A0A1S1NQ00_9MYCO  ali  17  1..................MKVWVDSERCQGHTLCSMIAPESFVLDDIDGHSVPADQEAAVREAAQSCPEQAINLEE. 64
458 5.000e-13UniRef50_UPI000A379F43 ferredoxin n=1 Tax=Crossiella equi TaxID=130796 RepID=UPI000A379F43  ali  20  1..................MKVLVDQERCCGAGSCVLAAPDIFDQREEDGIVPDDADRPLVEDAVSRCPAAAISVVE. 64
459 5.000e-13UniRef50_A0A2W6BSL0 Ferredoxin n=3 Tax=Pseudonocardiales bacterium TaxID=2201155 RepID=A0A2W6BSL0_9PSEU  ali  22  1..................MRVEVNPNICEGHGQCNAAAPEIYDLDEGGYCDVPPDLEPQAEQGALACPVQAITITR. 63
460 5.000e-13UniRef50_A0A229HJ72 Ferredoxin n=1 Tax=Streptomyces sp. NBS 14/10 TaxID=1945643 RepID=A0A229HJ72_9ACTN  ali  12  1..................MKVVIDEDRCRGHAVCCTFCPEVFDIGDDGYAVVEPADEQAVRTAAMSCPERAITV... 61
461 5.000e-13UniRef50_A0A2X2G487 3Fe-4S ferredoxin n=2 Tax=Rhodococcus wratislaviensis TaxID=44752 RepID=A0A2X2G487_9NOCA  ali  18  24.............FETQPMHLDVNQDRCIGAGMCVLTAPEVFDQNEDGRVLLLDPTPPPVRQAAHTCPAAAITILDR 93
462 5.000e-13UniRef50_A1UJD7 Uncharacterized protein n=48 Tax=Actinobacteria TaxID=201174 RepID=A1UJD7_MYCSK  ali  12  1..................MKVRVDPDRCQGHTLCSMIAPDSFVLSDIDGTVVPDDQQNAVREAASSCPEQAISIED. 64
463 6.000e-13UniRef50_A0A1E4IBQ6 Ferredoxin n=5 Tax=Actinobacteria TaxID=201174 RepID=A0A1E4IBQ6_9PSEU  ali  18  1..................MNIHVDPASCQGHNRCTMLAPDLFDIDDEGFASVPPDLAELAQLAEDNCPERAISLHR. 64
464 6.000e-13UniRef50_D6A955 Fe3S4 ferredoxin n=14 Tax=Actinobacteria TaxID=201174 RepID=D6A955_STRVD  ali  19  1..................MKVTVDMSLCQDHGQCAIASPAVFRMDDEGRLEPDASLRDEVEEAADVCPVQAIFI... 60
465 6.000e-13UniRef50_A0A1Q4DS03 Ferredoxin n=5 Tax=Actinobacteria TaxID=201174 RepID=A0A1Q4DS03_9PSEU  ali  24  1..................MKIVADRDVCIGAGLCVGTSDTVFDQDDDGIVDPEGADADLAREAVSLCPSSALRIVD. 63
466 6.000e-13UniRef50_A0A1G2KV49 Uncharacterized protein n=2 Tax=Parcubacteria group TaxID=1794811 RepID=A0A1G2KV49_9BACT  ali  16  2.....................VIDRDLCIGAASCIAVAPGVFELDSENKAVVKGADDETILLAAKSCPTQAILVFDE 60
467 6.000e-13UniRef50_A0A2N8LFY0 Ferredoxin n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A2N8LFY0_9MYCO  ali  16  7..................VTVSVDKSHCQLYGICQAEAPDVFDLGADGRLRAAGGDSDAVRQAARCCPTQAITLTER 69
468 6.000e-13UniRef50_A0A1V5VPZ0 Ferredoxin n=17 Tax=root TaxID=1 RepID=A0A1V5VPZ0_9BACT  ali  24  1..................MKITVDKDKCIGCGACTALAAKTFRLGDDGVIEPAKDSLEEINNTAESCPVEAIKIK.. 60
469 6.000e-13UniRef50_A0A1G2QP40 Uncharacterized protein n=4 Tax=Patescibacteria group TaxID=1783273 RepID=A0A1G2QP40_9BACT  ali  16  5LKDKNRPSGPVRV---GNLIIEVDRDLCIGAGTCSAIAPLAFALDNDGKSTVDGVQTDLLLEAARSCPVIAIIMKKE 82
470 6.000e-13UniRef50_A0A1E2Z831 Uncharacterized protein n=1 Tax=Candidatus Thiodiazotropha endolucinida TaxID=1655433 RepID=A0A1E2Z831_9GAMM  ali  30  1.....MGKKQVFLYTGTEIDVEWDERLCIHIGECGNSKGELFIAGRDPWCQPDLSPLSEVKDIVERCPSRLLIFTRR 72
471 7.000e-13UniRef50_A0A1Q4W0G8 Ferredoxin n=8 Tax=Actinobacteria TaxID=201174 RepID=A0A1Q4W0G8_9ACTN  ali  21  1..................MRVTVDRQRCIGSGMCVITADEVFAQRDEDGAEVADELGDRVRQAAHLCPSRAITV... 62
472 7.000e-13UniRef50_A0A1I2MHE2 Ferredoxin n=5 Tax=Actinobacteria TaxID=201174 RepID=A0A1I2MHE2_9MYCO  ali  17  1..................MKVHVDDDRCRGHGVCVAVCPDVFTLTDGGYADVPPELAAEVPEAVTGCPEHAITL... 61
473 7.000e-13UniRef50_A0A1I6RL58 Ferredoxin n=5 Tax=Actinobacteria TaxID=201174 RepID=A0A1I6RL58_9PSEU  ali  25  4....................IVVDTTKCVGAAQCVLSAPDLFDQDDDGFVNPTGELAQSAATAATLCPSQAITVQD. 64
474 7.000e-13UniRef50_UPI000AF41A75 hypothetical protein n=1 Tax=Streptomyces sp. NRRL WC-3744 TaxID=1463935 RepID=UPI000AF41A75  ali  33  13...DRTMRPGAKRYEGADITVSYESRICLHQAECLRGLPTVFDVEHRPWIDVGAAFAAAIADVIERCPSGALQYH.. 84
475 7.000e-13UniRef50_A0A178WTS6 Ferredoxin-2 n=66 Tax=Actinobacteria TaxID=201174 RepID=A0A178WTS6_9PSEU  ali  20  1..................MKVTVDEERCCGAGTCVLLAPEVFDQREEDGIVPGEELHATVREAASVCPGVAISVDE. 64
476 7.000e-13UniRef50_A0A193KIA9 Iron-binding protein n=4 Tax=Vibrio breoganii TaxID=553239 RepID=A0A193KIA9_9VIBR  ali  31  12...................TLFFDAKKCIHSRNCVLNRPDVFVPNVEGWIHPERASSDELHAIADNCPSGAIRFVE. 69
477 7.000e-13UniRef50_A0A1X1SM35 Ferredoxin reductase n=2 Tax=Corynebacteriales TaxID=85007 RepID=A0A1X1SM35_9MYCO  ali  23  1..................MRVQVDETKCSGIGMCEMTAASVFEVGDDGQAHPDADEVEAVQEAISNCPTQALSL... 61
478 7.000e-13UniRef50_I0H383 Putative ferredoxin n=25 Tax=Actinobacteria TaxID=201174 RepID=I0H383_ACTM4  ali  21  3.................ELRVVVDRELCCGAGQCVLLAPAVFDQDEDDGIEPAEAHRKVVTEAAAVCPTGAIAI... 65
479 7.000e-13UniRef50_A0A1A3EB03 Ferredoxin n=4 Tax=Corynebacteriales TaxID=85007 RepID=A0A1A3EB03_9MYCO  ali  18  1..................MKLHVDREMCQGHSRCYAAHPELFDIDDEGTANIPPEWEDRARNAIGNCPERAIHIVKE 64
480 7.000e-13UniRef50_A0A1G1W881 Uncharacterized protein n=1 Tax=Candidatus Woykebacteria bacterium RBG_13_40_15 TaxID=1802593 RepID=A0A1G1W881_9BACT  ali  18  4...................KIQIDRTLCMGDGICTAIAPNTFELNSEGVKNPTGDSDEKILEAVKACPVKAMLLKDE 64
481 7.000e-13UniRef50_A0A1H0DH70 Ferredoxin n=1 Tax=Desulfonauticus submarinus TaxID=206665 RepID=A0A1H0DH70_9DELT  ali  18  1..................MDVLIDRDLCIGCEACVEICPNVFEINKAYVINPEGASLQELKDAVESCPVKCIFLED. 62
482 7.000e-13UniRef50_A0A0G0ZMU5 Uncharacterized protein n=13 Tax=root TaxID=1 RepID=A0A0G0ZMU5_9BACT  ali  16  12...............GKVIKVQIDRDLCIGAATCVAVAPKMFALDNEAKAITGEESFQSVMDAAKSCPVAAIIIEDE 77
483 8.000e-13UniRef50_A0A1S1RJH8 Ferredoxin n=7 Tax=Actinobacteria TaxID=201174 RepID=A0A1S1RJH8_9ACTN  ali  16  1..................MKVSIDSDLCQGHARCWDICPEVFEVDEQGYPEVPPIHEARAREAAENCPERAITI... 61
484 8.000e-13UniRef50_A0A1F3BBK7 Uncharacterized protein n=4 Tax=cellular organisms TaxID=131567 RepID=A0A1F3BBK7_9ARCH  ali  22  1..................MRVEVDADKCLGFGSCVIVSPDVFRLDERPGQEAGGKDFENLQIAAQSCPTQAITIIDR 72
485 8.000e-13UniRef50_A0A0M7R0Z3 Ferredoxin n=30 Tax=Actinobacteria TaxID=201174 RepID=A0A0M7R0Z3_STRVZ  ali  15  1..................MDVHVDRDRCLGAGMCALTAPQVFDQDEEEGARPPQERHAAVRVAAGVCPASVITLTR. 64
486 8.000e-13UniRef50_A0A1A2VUI5 Uncharacterized protein n=17 Tax=Actinobacteria TaxID=201174 RepID=A0A1A2VUI5_9MYCO  ali  24  1..................MRAIVDHDRCEGHGRCYAVAPELFDLDDDGYITVPAQWHEQAREAESACPRAAIRLVD. 63
487 8.000e-13UniRef50_A0A0F7JYQ9 Uncharacterized protein n=8 Tax=Proteobacteria TaxID=1224 RepID=A0A0F7JYQ9_9GAMM  ali  36  3...................RVTWDAEVCTHAGKCVAGLPQVFKIEDGSVINEQAASEEEIKRVAAQCPSGALRYQE. 60
488 8.000e-13UniRef50_A0A1E4PK12 Ferredoxin n=12 Tax=Actinobacteria TaxID=201174 RepID=A0A1E4PK12_9PSEU  ali  25  1..................MHVVADRDVCIGAGMCVMSAEDVFDQDDDGLVRLDPADGTAVRRAVEGCPSGALRI... 59
489 8.000e-13UniRef50_A0A024QWH8 Ferredoxin n=11 Tax=Bacteria TaxID=2 RepID=A0A024QWH8_MYCNE  ali  15  1..................MKVSVDGSRCQGHTLCAMIAPDAFELDDVDGHVVPADQEDAVREAVHSCPEQAIIIE.. 63
490 8.000e-13UniRef50_A0A1A0Q4X8 Ferredoxin n=27 Tax=Actinobacteria TaxID=201174 RepID=A0A1A0Q4X8_9MYCO  ali  24  1..................MRVQADRDVCIQAGNCVMVAGEVFDQDDDGIVEVPGDQLAVVEEAVKLCPSQALRLVE. 63
491 8.000e-13UniRef50_A0A0D8I2S5 Uncharacterized protein n=4 Tax=Corynebacteriales TaxID=85007 RepID=A0A0D8I2S5_9NOCA  ali  18  7...................RVHIDRGMCEAHALCVEIAPEIFDLVDDDVANPPEALWPKALAAVSACPRQAISIVDE 68
492 9.000e-13UniRef50_A3DLF4 Ferredoxin n=14 Tax=TACK group TaxID=1783275 RepID=A3DLF4_STAMF  ali  21  4..................VKVIVDRDTCIGCGVAPATCPEVFVLGEDNGKNVPEDLLECVKSAVDACPVSAISYE.. 78
493 9.000e-13UniRef50_A8L286 Uncharacterized protein n=9 Tax=Actinobacteria TaxID=201174 RepID=A8L286_FRASN  ali  18  1..................MRIEVDPDRCEGHARCWDISPSVFELDEQGHPEVPAELAEQAADAARNCPERAITVSD. 63
494 9.000e-13UniRef50_A0A0F7W4F6 Ferredoxin fas2 n=42 Tax=Actinobacteria TaxID=201174 RepID=A0A0F7W4F6_9ACTN  ali  22  1..................MHVEVDQPKCVASGQCVMLAPDVFDQDDDGIVDPAPEHHDDVRESAAVCPAAAIRLVEK 64
495 9.000e-13UniRef50_A0A1N0JKD8 Ferredoxin n=28 Tax=Actinobacteria TaxID=201174 RepID=A0A1N0JKD8_9MYCO  ali  21  1..................MKVNVDYNRCEGHGVCVAQAPDAFELDDDGGREVPAGIETAVRSAVDACPVAALS.... 62
496 9.000e-13UniRef50_I4F2Y0 Ferredoxin n=44 Tax=Actinobacteria TaxID=201174 RepID=I4F2Y0_9ACTN  ali  22  3...................RVVVDREVCMGAGVCEMEAPEVFELDADGVLQVHETDLTAVETAVRACPTGALQLVD. 60
497 1.000e-12UniRef50_A0A173YHB3 Ferredoxin n=8 Tax=Faecalibacterium TaxID=216851 RepID=A0A173YHB3_9FIRM  ali  15  1..................MKAFVDPDLCIGCTQCAGICPEVFSMEGTLAVELPGELVPTAIDAAQNCPVSAITISE. 62
498 1.000e-12UniRef50_UPI000684DC2E hypothetical protein n=1 Tax=Patulibacter americanus TaxID=588672 RepID=UPI000684DC2E  ali  33  1..........MRRYTRDGAAVTYEVALCRHAGECVRGLPAVFDTARRPWIRPQNASIDDLERVIALCPTRALKFER. 66
499 1.000e-12UniRef50_A0A1A3C3N0 Ferredoxin n=14 Tax=Bacteria TaxID=2 RepID=A0A1A3C3N0_9MYCO  ali  22  1..................MRIEIDRNRCEGHGMCEVVAPEYFSLDDDGNLNVSDRDEAHVRDAAMVCPVAALRLADR 64
500 1.000e-12UniRef50_UPI00064FFAA3 hypothetical protein n=1 Tax=Candidatus Nitrosotenuis cloacae TaxID=1603555 RepID=UPI00064FFAA3  ali  20  153.....................SVEHSLCIGCCSCEIIAPQVFHIDKSSVINQNGASLEKIIDAAQTCPTKAIKVEE. 214
501 1.000e-12UniRef50_D2BFL3 Ferredoxin reductase n=7 Tax=Actinobacteria TaxID=201174 RepID=D2BFL3_STRRD  ali  19  1..................MKVIVDMDVCKDHGQCVFSAPEVFQINENGRADPDDTLRDAVEEAADVCPLQAITVE.. 61
502 1.000e-12UniRef50_A0A1F7VFT6 Uncharacterized protein n=15 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A1F7VFT6_9BACT  ali  20  4............RKKGKYKKIVIDRDACIGAASCVAVGPGSFQLDAENKVDPEKYDDETLLLAAQSCPVNAISVFDE 71
503 1.000e-12UniRef50_A0A1J4Q9E3 Ferredoxin n=1 Tax=Streptomyces malaysiense TaxID=1428626 RepID=A0A1J4Q9E3_9ACTN  ali  25  1..................MRITVDHDRCVGSGLCAMADPDSFTQSDEDGTVPQGEPGEPVRKAVDLCPSRALRLVE. 63
504 1.000e-12UniRef50_UPI000A018101 hypothetical protein n=1 Tax=Pseudonocardia thermophila TaxID=1848 RepID=UPI000A018101  ali  28  67................PDVRILTSRERCEGHGLCAALAPEVFDLDDEAVVEVPAEHAEAARRGVQACPVAALRIAD. 133
505 1.000e-12UniRef50_A0A1V0A121 Ferredoxin-1 n=7 Tax=Actinobacteria TaxID=201174 RepID=A0A1V0A121_9ACTN  ali  26  1..................MEIQGDQDVCIGAGMCALTAPGVFDQDENGLVDPSGDARKKALRAERLCPSGALRV... 61
506 1.000e-12UniRef50_A0A0Q8PVF3 Ferredoxin n=62 Tax=Actinobacteria TaxID=201174 RepID=A0A0Q8PVF3_9ACTN  ali  22  1..................MKIKVDFDLCEANGLCEAMAPEVFELDDDDFLQLSTEETDNVRRAVAACPRAAITLVEE 64
507 1.000e-12UniRef50_L7KT93 Putative ferredoxin n=17 Tax=Actinobacteria TaxID=201174 RepID=L7KT93_9ACTN  ali  24  1..................MRIEVDLDLCQGHGMCELEAPEVFATKTDHVATPDESRRAEVEAAVQYCPTQALRLTE. 62
508 1.000e-12UniRef50_UPI0009FD171A hypothetical protein n=3 Tax=Proteobacteria TaxID=1224 RepID=UPI0009FD171A  ali  26  457.TAQPPAAGQPEIVEGEKLTLIVDGQRCIHARHCVTGAPKTFVANVGPWLHPDETDVETLVGIAHACPSGAVAYRRK 533
509 1.000e-12UniRef50_D1C1S3 Uncharacterized protein n=3 Tax=Sphaerobacter thermophilus TaxID=2057 RepID=D1C1S3_SPHTD  ali  22  4................RKVRVRVDPTRCTAFGFCAEFLPEAFALDDWGYAELPAELESLAREAARLCPTGAISVE.. 67
510 1.000e-12UniRef50_A0A1B2U9M7 Ferredoxin n=20 Tax=Corynebacteriales TaxID=85007 RepID=A0A1B2U9M7_9NOCA  ali  16  1..................MKVVVDDDACRGHGVCLAACPEVFDLSDGGYAEVPAEHQDSVREAAGGCPERAIRL... 61
511 1.000e-12UniRef50_A0A2T0BAD1 Ferredoxin n=1 Tax=Clostridium liquoris TaxID=1289519 RepID=A0A2T0BAD1_9CLOT  ali  20  1..................MRAFINKEACIGCGLCPSIASDVFEMDDDGKADVPGGSEDAAKEAETSCPTNAISVEE. 63
512 1.000e-12UniRef50_E3J9B4 Ferredoxin n=9 Tax=Actinobacteria TaxID=201174 RepID=E3J9B4_FRAIE  ali  28  3...............GGAATIAVDRARCVGSGMCVVYAPDTFTHDEEAKVDPLGDPAEVVESAVEACPTGALTLV.. 65
513 1.000e-12UniRef50_R4LEA6 RimH n=7 Tax=Bacteria TaxID=2 RepID=R4LEA6_9ACTN  ali  28  2.....................IVDRERCVGAAQCVLSAPRFFDQDDDGWVVAPQDPPEEVQLAVRLCPSGALR.... 57
514 1.000e-12UniRef50_A0A066YNF3 Uncharacterized protein n=2 Tax=Streptomyces TaxID=1883 RepID=A0A066YNF3_9ACTN  ali  21  1..................MKVSVDLNRCEGYGQCVFAAPDAFTLHGTYVPNPPDEMRDAVHRAALACPVRAITV... 60
515 1.000e-12UniRef50_V5RVV9 Uncharacterized protein n=12 Tax=Bacteria candidate phyla TaxID=1783234 RepID=V5RVV9_9BACT  ali  20  5...................KVAVDRNVCIGSATCVVISPDAFELDSEGISTVKKDDEETLLKAAKSCPVQAISIFDE 66
516 1.000e-12UniRef50_A0A100Z8K3 Uncharacterized protein n=1 Tax=Mycobacterium sp. GA-2945b TaxID=1772273 RepID=A0A100Z8K3_9MYCO  ali  22  3..............TSDNLDIRVDSEACMGSGNCEFTAPTVFRLDDTGIARVIDAHADHVRMAARQCPTGAIEIR.. 66
517 1.000e-12UniRef50_A4EGN9 Uncharacterized protein n=7 Tax=Alphaproteobacteria TaxID=28211 RepID=A4EGN9_9RHOB  ali  31  65..DHSKIRNKEIAYSGTAVTVHYTPVLCSHAGECARLAKDIFNPQEKPWIKPDGGSLQDILAVISACPSGALRL... 140
518 1.000e-12UniRef50_A0A0P6Y1K8 Ferredoxin n=3 Tax=Anaerolineaceae TaxID=292628 RepID=A0A0P6Y1K8_9CHLR  ali  17  1..................MKVFVDPDICMGCGVCETIAPEIFQLGDAIHAPVPESYRDLVQQAVDECPEEAISFED. 63
519 1.000e-12UniRef50_A0A2H1FC17 Molecular chaperone n=9 Tax=unclassified Thaumarchaeota TaxID=651142 RepID=A0A2H1FC17_9ARCH  ali  20  150.................AVSVNVDPGKCIACCSCETIAPSVFRVEKNVKVNPKGANSEKILDAAQTCPTKAISVSEK 216
520 1.000e-12UniRef50_A0A0N1FQQ2 Ferredoxin 1 n=13 Tax=Bacteria TaxID=2 RepID=A0A0N1FQQ2_9ACTN  ali  14  1..................MKATVDDDRCRGHGMCLTFCPEVFDIGDDGYAVVPPEFEDATRSAALNCPERAITLE.. 62
521 1.000e-12UniRef50_A0A2W5N074 Uncharacterized protein n=1 Tax=Rhodanobacter denitrificans TaxID=666685 RepID=A0A2W5N074_9GAMM  ali  35  594.....PLDEGRERIPGAGIDLIYSGKRCIHARHCVLGLPRVFKANEGPWIAPDAATTEALVTVAQMCPSGAIQYRR. 665
522 1.000e-12UniRef50_A0A1V1RDX7 Ferredoxin n=4 Tax=Bacteria TaxID=2 RepID=A0A1V1RDX7_9ACTN  ali  15  1..................MKPTVDRALCIGCRLCEDTCPDVFRIDEEGLAEPPHELYGDVKAAAEICPTSAISIE.. 62
523 1.000e-12UniRef50_B5I805 Ferredoxin n=39 Tax=Streptomyces TaxID=1883 RepID=B5I805_9ACTN  ali  23  2...............GDRWLVEVDRSLCIGSAQCVHTAPEGFRLDQSHPADPETDANEKILAAAENCPVEAIMIR.. 64
524 1.000e-12UniRef50_UPI0008D9AD23 hypothetical protein n=2 Tax=Proteobacteria TaxID=1224 RepID=UPI0008D9AD23  ali  24  1.....MSKTTIFEYKGDAQTVTWDRRLCIHVGECGRAKGDLFVTGRDPWCDPNLSDMDKTEAIVARCPTGALAVK.. 70
525 1.000e-12UniRef50_A4T7M1 Uncharacterized protein n=36 Tax=Actinobacteria TaxID=201174 RepID=A4T7M1_MYCGI  ali  18  5...................RVELDEDLCQGHAMCELEAPDVFRVPKRGVVEPPDELREAVEMAVEMCPTRALTITEK 67
526 1.000e-12UniRef50_A0A2H0W1J2 Uncharacterized protein n=5 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A2H0W1J2_9BACT  ali  19  17.....................KVIRDKCIGAAPCVAIAPEVFDLDEENIAVIKDVDDQTILMAAKSCPTQAIVVEDE 75
527 1.000e-12UniRef50_A0A2N6G5N9 Uncharacterized protein n=1 Tax=Arcobacter sp. TaxID=1872629 RepID=A0A2N6G5N9_9PROT  ali  32  66.SQNDLEEEILQVYDSKSVTVTFNRSICAGSENCVKKFPDIYTSGSNDWINLEKGTIEDIIASVEDCPSGALSYT.. 139
528 1.000e-12UniRef50_A0A1C6LP73 Ferredoxin n=6 Tax=Actinobacteria TaxID=201174 RepID=A0A1C6LP73_9ACTN  ali  19  51....................VVVDLNRCQGYAQCAFLAPEVFTMHGEESLVVPDGQLERVRRAVAACPVQAILMGEE 111
529 2.000e-12UniRef50_A0A0G3UY32 Ferredoxin n=6 Tax=Bacteria TaxID=2 RepID=A0A0G3UY32_9ACTN  ali  20  1..................MQIKIDRDLCQGHGVCESEAPAVFSVPPKSATNPDESLRPQIMAAVKYCPTHAISISEE 65
530 2.000e-12UniRef50_A0A2L0EWD1 Ferredoxin n=15 Tax=Bacteria TaxID=2 RepID=A0A2L0EWD1_SORCE  ali  18  2.................RMRVLVEHEKCCGAGQCVMVAPKVFDQRDDGIVVPPPEQYRAVREAVSICPGAALRLEE. 65
531 2.000e-12UniRef50_A0A0U0Y532 Ferredoxin n=267 Tax=Bacteria TaxID=2 RepID=A0A0U0Y532_9MYCO  ali  23  1..................MKITVDEQKCVAGGQCVLAAPEVFDQRDEDGIHPDADQFDATREAAQICPAAAIFLSEE 65
532 2.000e-12UniRef50_A0A1X0HX82 Ferredoxin n=2 Tax=Mycobacteriaceae TaxID=1762 RepID=A0A1X0HX82_MYCPF  ali  13  1..................MRVTLDDDICRGHGVCAAICPTVFTIADGGYAEVTIADVPAVRDAADNCPEHAIHITD. 63
533 2.000e-12UniRef50_A0A160DYE6 CDGSH-type iron sulfur-containing domain-containing protein n=6 Tax=Proteobacteria TaxID=1224 RepID=A0A160DYE6_9GAMM  ali  31  447...........EHIEGRDLTLIYEGRRCIHARFCVTGAPTVFLANQGPWIHPDTLDVERLVEIAHACPSGAIRYARR 513
534 2.000e-12UniRef50_UPI000CE361DF ferredoxin n=1 Tax=Cryobacterium sp. Y50 TaxID=2048286 RepID=UPI000CE361DF  ali  21  2..................IDVTIDLSRCQGYGNCVSAAPEVFDINDEGHADIGEERLTEVQAAVKVCPVAAISV... 62
535 2.000e-12UniRef50_A0A2N2NM62 Ferredoxin n=6 Tax=Bacteria TaxID=2 RepID=A0A2N2NM62_9CHLR  ali  22  1..................MRVFVDPDLCMGCGVCESIAPDIFELGDELHAKVILDPIPEVEEAIAECPEVAIQITEE 64
536 2.000e-12UniRef50_A0A0G1MAA9 Uncharacterized protein n=5 Tax=Microgenomates group TaxID=1794810 RepID=A0A0G1MAA9_9BACT  ali  20  31................GKYKIKVERDLCIGAASCVAVAPETFQLDNENKAVTLPGTPEDIIMAAQACPTKAIVI... 91
537 2.000e-12UniRef50_A0A2H6IBL4 Ferredoxin n=10 Tax=Bacteria TaxID=2 RepID=A0A2H6IBL4_9BACT  ali  20  1......MADNGRKCYNSAMNVTVDQDTCIGCGACAEICPAVFFLDESRVIDPDACEYACCEAAEENCPVEAISIE.. 74
538 2.000e-12UniRef50_I4BDB1 Ferredoxin n=14 Tax=Actinobacteria TaxID=201174 RepID=I4BDB1_MYCCN  ali  27  1..................MKVSADRELCIQAGNCVMVASEVFDQDDEGIVDVTGEAAEHAREAVKLCPSSALSIRE. 63
539 2.000e-12UniRef50_UPI00082A1ADB ferredoxin n=2 Tax=Nocardia TaxID=1817 RepID=UPI00082A1ADB  ali  20  1..................MRVVVDRGRCIGAGQCVYVAPEIFDQDDDGLVVVKDSDTEDVRQAEILCPARAI..... 60
540 2.000e-12UniRef50_A0A158J7C8 Ferredoxin-2 n=13 Tax=Bacteria TaxID=2 RepID=A0A158J7C8_9BURK  ali  20  1..................MKIKVDATKCIGAGLCVVAAPEVFSQNEDDGLVPPPHLHEACREAARLCPALVISFDE. 64
541 2.000e-12UniRef50_A0A1X1UC34 Ferredoxin reductase n=7 Tax=Bacteria TaxID=2 RepID=A0A1X1UC34_9MYCO  ali  17  1..................MKVAVDTTKCSGIGLCEMAAPTVFEVGDDGQAEPSEDERAAVEQAVRECPTSALSIQD. 63
542 2.000e-12UniRef50_UPI000B9B2CB8 hypothetical protein n=1 Tax=Rhodococcus sp. 06-1059B-a TaxID=2022496 RepID=UPI000B9B2CB8  ali  28  3................GDVKVNVDRELCIGSGNCAFWVPEVFELDDDSKVDPQGASIERIVEMEAQCPVGAIKVTR. 67
543 2.000e-12UniRef50_A4RQN8 Uncharacterized protein (Fragment) n=1 Tax=Ostreococcus lucimarinus (strain CCE9901) TaxID=436017 RepID=A4RQN8_OSTLU  ali  13  10........TTRKAKPGETRAVFVDEFTCIGCKQCVWQAPATFRMNDDRVFAQWLNDEDDIQCAIDSCPVDCIHWVER 82
544 2.000e-12UniRef50_A0A1J4ULS8 Uncharacterized protein n=4 Tax=unclassified Candidatus Micrarchaeota TaxID=1801634 RepID=A0A1J4ULS8_9ARCH  ali  20  14.....................KVDEEKCIGCGHCEATAPNTFEMGKSHVKNPKGDPKEFIEKAVRECPVNAITLR.. 69
545 2.000e-12UniRef50_A0A1V6CB94 Ferredoxin n=10 Tax=root TaxID=1 RepID=A0A1V6CB94_9BACT  ali  19  1..................MKVRIDENLCTGCGLCSDNCPEVFEMGDTTARVVPAEYEEKAQEAAENCPVDAISIE.. 61
546 2.000e-12UniRef50_A0A024K3F3 Ferredoxin reductase n=12 Tax=Mycobacteriaceae TaxID=1762 RepID=A0A024K3F3_9MYCO  ali  18  1..................MRVGVDTTKCSGIGLCEVAAPSVFEIGDDGQSEPPEDQRAAVEQAVRDCPTGALSIQD. 63
547 2.000e-12UniRef50_E3JAI4 Ferredoxin n=2 Tax=Frankia TaxID=1854 RepID=E3JAI4_FRAIE  ali  30  9.....................SVDRESCLGSGSCAFHAPGTFDLDDDLKVVVDGDPDAAVAAAIDSCPSGALR.... 62
548 2.000e-12UniRef50_A0A1P8F836 Ferredoxin n=4 Tax=Bacteria TaxID=2 RepID=A0A1P8F836_9CHLR  ali  20  1..................MRVEIDRDKCIGAGDCVEEAPTVFELDSFGKADPKSVDDGKLLAAARSCPVDAIAVFD. 61
549 2.000e-12UniRef50_A0A1V1Z0D6 Oxidoreductase (Fragment) n=3 Tax=Streptomyces TaxID=1883 RepID=A0A1V1Z0D6_9ACTN  ali  26  294...................KIYVDWTLCRGHGLCADILPEVFELGADGFPTVAQAQEAKALRAVRRCPALALRIEE. 355
550 2.000e-12UniRef50_A0A1Q7W2S3 Uncharacterized protein n=1 Tax=Actinobacteria bacterium 13_1_20CM_3_71_11 TaxID=1803477 RepID=A0A1Q7W2S3_9ACTN  ali  20  189............RLRGRQVLVNVDPGRCVRFGFCEHEAPEIFQLRGDGRLTVPTGHVEQVIQAARVCPARAIVLSR. 256
551 2.000e-12UniRef50_Q936S8 Putative ferredoxin n=32 Tax=Bacteria TaxID=2 RepID=Q936S8_9PSED  ali  21  1..................MKVTVDNNRCQGHARCVYFAPEVFEIDDEGYSRVPVELQESVKKACANCPELAIKI... 63
552 2.000e-12UniRef50_A0A2G2B157 Uncharacterized protein n=1 Tax=Marinosulfonomonas sp. TaxID=2030815 RepID=A0A2G2B157_9RHOB  ali  35  68..QDGSTRDKVYTYEGSDATVHYNKLLCSHAGECVKHAGNIFNPENKPWCAPNEGTLEQIKTVVAACXSGALSY... 139
553 2.000e-12UniRef50_A8LUX9 Ferredoxin n=12 Tax=Salinispora arenicola TaxID=168697 RepID=A8LUX9_SALAI  ali  20  11....................VAIDRERCLGSGQCLVMAPDVFDQDEEGLVTPPADVTSDIEDAVNNCPAVALTLT.. 70
554 2.000e-12UniRef50_A0A1V0AHE5 Ferredoxin n=8 Tax=Actinobacteria TaxID=201174 RepID=A0A1V0AHE5_9ACTN  ali  22  1..................MKITVDEDKCCGAGSCVLIAPEVFDQREDDGIEPGAGQHAAVREAAAVCPGAAIEVSE. 64
555 2.000e-12UniRef50_H1AQ85 Uncharacterized protein n=11 Tax=cellular organisms TaxID=131567 RepID=H1AQ85_9FIRM  ali  19  3...................KITVNES-CIGCGACTGVAPDVFEMNDEGLASVVGDDVASAKEAAESCPVEAIEVED. 58
556 2.000e-12UniRef50_A0A1E2UN17 Uncharacterized protein n=4 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1E2UN17_9GAMM  ali  32  1.....MAKKQVFRYKGTEIDVTWEERLCIHIGECGYSQGELFVAGRDPWCKPDLSSPAEVEEVVARCPSGSL..... 67
557 2.000e-12UniRef50_A0A100JT99 Ferredoxin fas2 n=2 Tax=Streptomyces scabiei TaxID=1930 RepID=A0A100JT99_STRSC  ali  23  55...................RIVVDFDRCEGHGLCEQTAPEVFRLDDEGELEVAPVDERAVAAAVRVCPVAALKVR.. 115
558 2.000e-12UniRef50_Q8R952 Ferredoxin 1 n=23 Tax=Thermoanaerobacterales TaxID=68295 RepID=Q8R952_CALS4  ali  14  14..................MKVYVDQDECIACGVCIDMCPDVFDWNEDGKSHVPADLEDCVRDAMSSCPTEAIK.... 73
559 2.000e-12UniRef50_A0A0J6W1M0 Ferredoxin reductase n=9 Tax=Actinobacteria TaxID=201174 RepID=A0A0J6W1M0_9MYCO  ali  22  1..................MALRVDTTKCSGIGLCEATAPAVFEVGDDGQAEPDAADRNAAREAVDNCPTGALSFDD. 63
560 2.000e-12UniRef50_L7V8Z9 Ferredoxin reductase n=26 Tax=Mycobacteriaceae TaxID=1762 RepID=L7V8Z9_MYCL1  ali  22  1..................MRLVVDLNKCQGYAQCVPLAPEVFKLVGEEALNPDDSQRQRVLRAAASCPVQAIILE.. 61
561 2.000e-12UniRef50_A0A1W6LIN1 Iron-binding protein n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A1W6LIN1_9BURK  ali  35  2........PPVETARSDQVEVSFDGSRCIHARYCVTRAPATFLANDGPWIHPGATPVESLVAVIHQCPSGALHYR.. 69
562 2.000e-12UniRef50_X5LBU3 Putative ferredoxin n=2 Tax=Mycobacteriaceae TaxID=1762 RepID=X5LBU3_9MYCO  ali  27  2........SDLRSIDAPGNHVTVDRSKCIGSGNCVMWAAATFDLDDDELVQPDDDSPESIVEAAQNCPVGAIT.... 69
563 2.000e-12UniRef50_A0A0F4K2J7 Zinc finger CDGSH type superfamily protein n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A0F4K2J7_9ACTN  ali  36  1..................MTVSFDARVCRHAAECVHGLPAVFDTARRPWIMPDAAEPGVIAEVVRRCPTGALAYR.. 57
564 2.000e-12UniRef50_A0A1F2YEC9 Uncharacterized protein n=1 Tax=Actinobacteria bacterium RBG_19FT_COMBO_70_19 TaxID=1797208 RepID=A0A1F2YEC9_9ACTN  ali  20  2..................LRARVDRHRCIGAGTCITIAPTAFDWHEGGVVDPASVEDELLREAALACPTGAITIEE. 64
565 2.000e-12UniRef50_A0A2M8EMG0 Ferredoxin n=14 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A2M8EMG0_9BACT  ali  16  1......MSDNIQTITKDNVEIRVHRDLCISAGPCTVYAPNTFDIDDEGIAAIKDGDWEKIFEAAKSCPVMAIEV... 71
566 2.000e-12UniRef50_Q39QU1 Ferredoxin n=46 Tax=Bacteria TaxID=2 RepID=Q39QU1_GEOMG  ali  21  6.....................WVDQEACISCGLCVSVCPGVFRFAENGKSDPAGASEQEIQQAIDGCPVQAISWKE. 63
567 2.000e-12UniRef50_D7BYH0 Uncharacterized protein n=37 Tax=Bacteria TaxID=2 RepID=D7BYH0_STRBB  ali  21  1..................MRLVVDLNRCQGFAQCVFLAPDVFALNGEEALQFDEAQRELVERAAAACPVQAILV... 60
568 2.000e-12UniRef50_A0A117JS85 Ferredoxin n=8 Tax=Corynebacteriales TaxID=85007 RepID=A0A117JS85_9MYCO  ali  13  1..................MKVRVDSGRCQGHTLCAMIAPDSFELSDDGTASPPDDQQDAVREAVSSCPEQAISIDD. 64
569 2.000e-12UniRef50_UPI00036392EC hypothetical protein n=1 Tax=Thioalkalivibrio TaxID=106633 RepID=UPI00036392EC  ali  34  1..................MKVIWDSNKCIHSGNCVNSLPAFFIQDDKLIVKPENASWEEVLKVVSACPAKAFTVKE. 59
570 2.000e-12UniRef50_UPI000A38209C ferredoxin n=1 Tax=Amycolatopsis lexingtonensis TaxID=218822 RepID=UPI000A38209C  ali  15  201.................ALRVDVDSHRCHAYGVCQSEAPQVFQLGQDGRLEPGPGEAPNVRAAARACPMRAIHLV.. 262
571 2.000e-12UniRef50_A0A2D9ALR8 Ferredoxin n=2 Tax=Bacteria TaxID=2 RepID=A0A2D9ALR8_9RHOB  ali  13  1..................MKVCIDENLCQGHARCVYFAPDVFEIDDEGYANVPADQQDNVRKAAANCPERTIIVTD. 65
572 2.000e-12UniRef50_A0A2H0YV61 Uncharacterized protein n=2 Tax=Candidatus Kerfeldbacteria TaxID=1817907 RepID=A0A2H0YV61_9BACT  ali  22  3...................KIEVDRDACISVASCVDIAPEVFELDDEGKANPKGNPDNTILEAAQSCPVNAVILYDE 63
573 2.000e-12UniRef50_UPI00058C7594 ferredoxin n=1 Tax=Microbacterium gorillae TaxID=1231063 RepID=UPI00058C7594  ali  26  1..................MRVNLDLGKCMGYGNCVDAAPEVFDLNEDTIAEPGSELEEAAQRAMRACPAKAITL... 62
574 2.000e-12UniRef50_J2JQ63 Ferredoxin n=4 Tax=Streptomyces TaxID=1883 RepID=J2JQ63_9ACTN  ali  19  1..................MKITVDRDRCVGAGMCAMTAGEVFEQHEEDGTEPPAQLTDDVAEAEQLCPSRAITV... 62
575 2.000e-12UniRef50_A0A200GYV0 Ferredoxin-2 n=116 Tax=Terrabacteria group TaxID=1783272 RepID=A0A200GYV0_MYCPC  ali  12  1..................MKVWVDSQRCQGHTLCSMIAPDSFQLSDIDGSVVPADREDQVREAAQSCPEQAIMITD. 64
576 2.000e-12UniRef50_C6E3C4 4Fe-4S ferredoxin, iron-sulfur binding protein n=20 Tax=cellular organisms TaxID=131567 RepID=C6E3C4_GEOSM  ali  18  5....................VYVDQQVCIGCGLCMSIVPEVFRLNDAGVSEVNGAGEAKIQEAIDSCPVNCIHWR.. 62
577 2.000e-12UniRef50_Q83WF4 Ferredoxin MycCII n=22 Tax=Bacteria TaxID=2 RepID=MYCII_MICGR  ali  19  1..................MRIVLDAERCVGAGQCEATAPELFTQGDDGLRPVTPELLGPAREAVDRCPVRAIRIE.. 62
578 2.000e-12UniRef50_A0A177HJV9 Ferredoxin-2 n=34 Tax=Actinobacteria TaxID=201174 RepID=A0A177HJV9_9ACTN  ali  22  1..................MRIEVDRELCCGSGMCVLTDPETFDQSEEDGVVPSAERQAVVRSAVSGCPTSAIRLVE. 64
579 2.000e-12UniRef50_A0A1K2FYH6 Ferredoxin-2 n=18 Tax=Bacteria TaxID=2 RepID=A0A1K2FYH6_9ACTN  ali  17  1..................MRIEIDEDLCCGAGSCVLAAPTVFDQNDDDGTVPGAELRTAVREAAARCPTAAIRVV.. 63
580 3.000e-12UniRef50_I0RFP2 Ferredoxin 1 n=13 Tax=Actinobacteria TaxID=201174 RepID=I0RFP2_MYCXE  ali  20  1..................MRVAVDDQRCRGHGVCTTLCPEVFQLNDDGVPEVPAGLESAARQAIADCPEQAIS.... 60
581 3.000e-12UniRef50_Q0RKF0 Putative ferredoxin n=62 Tax=Actinobacteria TaxID=201174 RepID=Q0RKF0_FRAAA  ali  17  1..................MRAAIDRDLCVGHGLCYMLAPDVFQDDDEGYGQVTADRVQDARRAAGSCPERAITLT.. 63
582 3.000e-12UniRef50_UPI0003B66DC8 ferredoxin n=1 Tax=Frankia sp. Iso899 TaxID=1283283 RepID=UPI0003B66DC8  ali  25  1..................MRIELDTQLCQAYGNCLLAAPDVFELTDSTPVVPAEELRAEVSEAVLSCPVQALTLID. 64
583 3.000e-12UniRef50_A0A2E5J928 Uncharacterized protein n=3 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A2E5J928_9GAMM  ali  31  1..................MXVTYDADVCTHAGECVKGAPNVFKVDGKFVIDTSADTEDNIRATVGNCPSGALKIEE. 59
584 3.000e-12UniRef50_A0A2N2E2D1 Ferredoxin n=2 Tax=Bacteria TaxID=2 RepID=A0A2N2E2D1_9BACT  ali  18  2....................VRVDQDKCIGCGLCVGMAPEVFTMNADFKSEVNPEVTDAARDAAASCPVDAISV... 56
585 3.000e-12UniRef50_A0A132PQZ7 Ferredoxin n=63 Tax=Bacteria TaxID=2 RepID=A0A132PQZ7_9MYCO  ali  18  5...................RVELDEDLCQGHAMCELEAPDVFKVPKRGVVEPPDEIREDVERAVEMCPTQAISIKEK 67
586 3.000e-12UniRef50_A0A0N7I2E7 Ferredoxin n=2 Tax=Bacteria TaxID=2 RepID=A0A0N7I2E7_SPHMC  ali  20  1..................MKIKVDQHNCIGAGNCAQLAPKVFSQREEDGVVPGDSEAEDVAKAVKICPAQAISVSE. 64
587 3.000e-12UniRef50_A4FDJ2 Ferredoxin n=374 Tax=Bacteria TaxID=2 RepID=A4FDJ2_SACEN  ali  20  1..................MKITVDEEKCCGAGSCVLAAPEVFDQRDEDGVEPAENLHAAVREAADVCPAAAIALSE. 64
588 3.000e-12UniRef50_A0A0T9MYD0 FdxD n=2 Tax=Bacteria TaxID=2 RepID=A0A0T9MYD0_MYCTX  ali  21  4...................KVAIDQGRCQGHGRCAVIAPDVFDLDEHGGIVVPDGQVGEARDAVLSCPESAITIT.. 64
589 3.000e-12UniRef50_A0A0L8QA79 Ferredoxin n=19 Tax=Streptomycetaceae TaxID=2062 RepID=A0A0L8QA79_KITAU  ali  21  19...............GPRWYVEVDRGVCIGSGMCVATAPGGFELDQSHPVRPECAASDDVLAAAEGCPVEAISVTD. 82
590 3.000e-12UniRef50_G4KW13 Ferredoxin n=7 Tax=Bacteria TaxID=2 RepID=G4KW13_OSCVS  ali  21  1..................MRAHVDQDTCISCGLCVSSVPDVFQLNGDGKAEIAEGPDDAVQEAIDTCPVSAIR.... 56
591 3.000e-12UniRef50_A0A1H3BDB8 Ferredoxin n=2 Tax=Saccharopolyspora shandongensis TaxID=418495 RepID=A0A1H3BDB8_9PSEU  ali  25  3.................QWRIRIDQSICVGSGTCTSIAPDLFQLDEEDRSCPPAGALPALIEAAELCPTGAIDVVD. 64
592 3.000e-12UniRef50_D5P757 Ferredoxin n=16 Tax=Mycobacteriaceae TaxID=1762 RepID=D5P757_9MYCO  ali  16  16..............ESGAMTVAVDADRCTGHGRCYTLAPDVFDADEVGVAEVSGDLETQAVTAERNCPEGAISLSR. 83
593 3.000e-12UniRef50_UPI000DCB395F UPI000DCB395F related cluster n=1 Tax=unknown TaxID= RepID=UPI000DCB395F  ali  28  6..................VRLHADTEICISAGMCARTAPDVFDQDDATGVVPEAADLDAVRRAVACCPSGALTLT.. 68
594 3.000e-12UniRef50_UPI000A020CF4 ferredoxin n=1 Tax=Mycobacterium triplex TaxID=47839 RepID=UPI000A020CF4  ali  20  1MTGGGGSAARARTARGERLRVSIDSGKCQGHGRCVLIAPAYFDMDDAGFGEVDAADKADVDEAVLSCPEHAVILE.. 81
595 3.000e-12UniRef50_A0A0N1GSK9 Uncharacterized protein n=5 Tax=Bacteria TaxID=2 RepID=A0A0N1GSK9_9ACTN  ali  20  19.......................DPARCVGAGQCVLTAPRVFDQGDDGQVRPAADLVATVREAVDRCPGRAL..... 72
596 3.000e-12UniRef50_A0A1G6LCS6 Uncharacterized Fe-S cluster protein YjdI n=1 Tax=Melghirimyces thermohalophilus TaxID=1236220 RepID=A0A1G6LCS6_9BACL  ali  36  59.TRQRELRRGIENYVGAQITIHDHRYLCAHYGAC--RLKGVFEPRKRPWIDPDGQDVNAVIDVIEDCPSGALTY... 130
597 3.000e-12UniRef50_A0A1Q8IDP2 Uncharacterized protein n=3 Tax=Corynebacteriales TaxID=85007 RepID=A0A1Q8IDP2_9NOCA  ali  18  3...................KVYVDRRKCQGLGLCESIAPRVFEVTEDGVLSLPTEDRELIISAVEGCPNEALSISEE 66
598 3.000e-12UniRef50_D8UIV6 Molecular chaperone n=1 Tax=Volvox carteri f. nagariensis TaxID=3068 RepID=D8UIV6_VOLCA  ali  20  142....................VFVDEITCIGCGKCVRACPRTFEIGRARVISQDADDVDSVQIAIECCPVDCIHWV.. 201
599 3.000e-12UniRef50_A0A286GDC2 Ferredoxin n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A286GDC2_9ACTN  ali  21  3...................RVQVDADLCVGSGACEALAPDVFEVDDDGVLEPGEDDMRDVTDAVRSCPTRALSLAE. 64
600 3.000e-12UniRef50_A0A239CZ50 2`-carboxy-2,3-dihydroxybiphenyl 1,2-dioxygenase small subunit and ferredoxin fusion protein n=2 Tax=Actinobacteria TaxID=201174  ali  24  1..................MHVKLDTQNCQAYANCLLTAPEVFDLDEESGINPPENLRAVVEEAVRSCPVQALILE.. 63
601 3.000e-12UniRef50_A0A132PLX7 Uncharacterized protein n=5 Tax=Mycobacteriaceae TaxID=1762 RepID=A0A132PLX7_9MYCO  ali  22  11.....................RVDRSLCEGHALCVDLAPDVFVLGDDEVAAADTTPPEQVKAAVDACPRQAITF... 67
602 3.000e-12UniRef50_G0A3D1 Uncharacterized protein n=8 Tax=Proteobacteria TaxID=1224 RepID=G0A3D1_METMM  ali  39  1..................MKIQWDKQTCSHSGNCVKSLPEVFKVVDGQVIEPDKATDAEVVNVINQCPSGALKRVD. 59
603 3.000e-12UniRef50_A5V739 Uncharacterized protein n=6 Tax=Bacteria TaxID=2 RepID=A5V739_SPHWW  ali  15  1..................MKVIVDHARCQGHALCMLKAPQVYQLNDDGYTEVPPELEEQARLGAINCPEGAIRLDKR 64
604 3.000e-12UniRef50_F8C287 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein n=15 Tax=cellular organisms TaxID=131567 RepID=F8C287_THEGP  ali  25  6.....................TIDEELCIGCGTCVEICPEVFELNESQVKNQDACSQCNCEEAINSCPVGAISWKEE 65
605 3.000e-12UniRef50_P29603 Ferredoxin n=58 Tax=cellular organisms TaxID=131567 RepID=FER_PYRFU  ali  18  2.................AWKVSVDQDTCIGDAICASLCPDVFEMNDEGKAQPDEELYNCAKEAMEACPVSAITIEE. 66
606 3.000e-12UniRef50_A0A1G8H1Q7 Uncharacterized Fe-S cluster protein YjdI n=4 Tax=Flavobacteriales TaxID=200644 RepID=A0A1G8H1Q7_9FLAO  ali  21  1......MDNNENVFSNNEITVTYAPRCCTNAEFCAKQLSNVFRNSVIPWIDLEGAQTDDIINQINKCPSGALKYH.. 69
607 3.000e-12UniRef50_A0A1V5BCU1 Uncharacterized protein n=2 Tax=Methanothrix TaxID=2222 RepID=A0A1V5BCU1_9EURY  ali  24  1..........MKEYINGEIAVFWKPEKCIHSAECLKGLLGVFDLQKSSWVDIEGAASEEI................. 50
608 3.000e-12UniRef50_Q28SX5 Uncharacterized protein n=1 Tax=Jannaschia sp. (strain CCS1) TaxID=290400 RepID=Q28SX5_JANSC  ali  37  83..................VTVSYSKALCSHAGSCVQMGDGAFDPQRKPWCKPGETSIETLRAIIAACPSGALQL... 138
609 4.000e-12UniRef50_A0A2M6WBQ1 Ferredoxin n=1 Tax=Candidatus Komeilibacteria bacterium CG10_big_fil_rev_8_21_14_0_10_41_13 TaxID=1974476 RepID=A0A2M6WBQ1_9BACT  ali  22  1..................MKITVDKNKCIGCGACRMLASQTFGVDEDGKLAADKDKEEDIRLAANSCPTAAIEITE. 61
610 4.000e-12UniRef50_A0A0M5LUC5 Ferredoxin n=15 Tax=Bacteria TaxID=2 RepID=A0A0M5LUC5_9PSEU  ali  13  1..................MKVIVDFDRCESNAVCMGVAPEVFEVRDDDYLNPAEALRPKVEEAARSCPKAAITIED. 63
611 4.000e-12UniRef50_A1RCH9 Ferredoxin n=42 Tax=Bacteria TaxID=2 RepID=A1RCH9_PAEAT  ali  15  3...................RVSVDPAKCQGHARCLAFAPDVFDFDDEGYAFVPDDRAQPVKLAVANCPERAISVSE. 65
612 4.000e-12UniRef50_A0A212PFV7 Ferredoxin n=2 Tax=Geobacter sp. DSM 9736 TaxID=1277350 RepID=A0A212PFV7_9DELT  ali  24  4....................VYVDREQCISCGLCVSLVPEVFRFEEDKSIDPHGAPENRIQECVDGCPVSAIHWREE 62
613 4.000e-12UniRef50_A0A1Y2NFN3 Ferredoxin fas2 n=78 Tax=Bacteria TaxID=2 RepID=A0A1Y2NFN3_STRPT  ali  19  14....................VVVDLNRCQGYAQCAFLAPEVFTMHGEESLVVPDGQLEQVRRAAVACPVQAIVMGEE 74
614 4.000e-12UniRef50_A0A2E3TWC6 Uncharacterized protein n=1 Tax=Pelagibacteraceae bacterium TaxID=2026775 RepID=A0A2E3TWC6_9PROT  ali  37  1..................MKVKWNDKICIHAGECVKNLPNVFKVDEKXVIDESGSTXDXIKRVVGLCPSGALEIED. 59
615 4.000e-12UniRef50_UPI000B3D49B8 ferredoxin n=1 Tax=Sphingomonas sp. CDS-1 TaxID=2004404 RepID=UPI000B3D49B8  ali  17  1..................MRVSINRGLCQGHAMCWLTCPEVFRINDEDGHAVPEGFEEKVDQAQRCCPEGAIIIH.. 63
616 4.000e-12UniRef50_A0A2V8T4X8 Ferredoxin n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8T4X8_9BACT  ali  20  2...............GRSMKIEIDRDLCIGSGCCVAAAPRVFLIDEEKKALVVNAHAADLYEAARLCPTVAVILYDE 66
617 4.000e-12UniRef50_A0A1M6UXH3 Ferredoxin n=11 Tax=Bacteria TaxID=2 RepID=A0A1M6UXH3_PSETH  ali  24  1..................MKISVDRDRCEGYGVCAEVAPDLLHLDDDGELVVDPEQTETAASAARVCPVAALSLRD. 63
618 4.000e-12UniRef50_G7CH23 Uncharacterized protein n=3 Tax=Mycobacterium thermoresistibile TaxID=1797 RepID=G7CH23_MYCT3  ali  15  2..KEESMDTTTKV---GRLYVEVDQSVCQGHALCHRALPEVFLSDDETGLSVPPELEDEVKAAASNCPERAIRLR.. 77
619 4.000e-12UniRef50_A0A256YPV6 Ferredoxin n=6 Tax=cellular organisms TaxID=131567 RepID=A0A256YPV6_9ARCH  ali  22  1..................MKVWVDKSKCIGCGVCTALCPEGFEIGEDGKSQVKNPNANCNKEIASNCPVGAIQIEE. 59
620 4.000e-12UniRef50_V6JLR5 Ferredoxin n=52 Tax=cellular organisms TaxID=131567 RepID=V6JLR5_STRRC  ali  16  1..................MRLVVDLNKCQGYAQCAFLAPDVFAMHGEESLHAPEEQRERLARAVAACPVQAIT.... 59
621 4.000e-12UniRef50_A0A239L8R5 Sulfoxide reductase heme-binding subunit YedZ n=4 Tax=Asanoa TaxID=195964 RepID=A0A239L8R5_9ACTN  ali  18  180..QERATRRNGNAGVGDELLVNVDGNRCARFGFCEHEAPKVFALRGDGKATVPPDLANDVIRAVEVCPARAIQLNR. 257
622 4.000e-12UniRef50_A0A229H2N2 Ferredoxin n=26 Tax=Bacteria TaxID=2 RepID=A0A229H2N2_9ACTN  ali  20  1..................MRVGVRKDLCMGAGMCALTAPEVFTQSEDDGTHPSQDRHALVRRAVTLCPAGAITVTE. 64
623 4.000e-12UniRef50_A0A0H5RZ14 Ferredoxin FdxD n=66 Tax=Bacteria TaxID=2 RepID=A0A0H5RZ14_9MYCO  ali  18  10....................VRVDAGLCEGHALCIQLAPEVFDLSDDEVASADQDTWDNVKSAVDACPRQAISL... 70
624 4.000e-12UniRef50_K0F6I2 Ferredoxin n=6 Tax=Corynebacteriales TaxID=85007 RepID=K0F6I2_9NOCA  ali  21  1..................MKIVADRARCEGHGMCEALAPNLFRVGDDGIVEPLADDLDLVQLVVDSCPVEALR.... 60
625 4.000e-12UniRef50_A0A1H9J0P1 Uncharacterized Fe-S cluster protein YjdI n=2 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1H9J0P1_9FLAO  ali  29  1......MKIESKEFSNEDITVTYDPCICTLSGKCAKELSNVFSDTIIPWINLDDGKTKDIIKQIKKCPSGALQFYKK 71
626 4.000e-12UniRef50_A0A1X2KNG8 Ferredoxin n=7 Tax=Mycobacteriaceae TaxID=1762 RepID=A0A1X2KNG8_9MYCO  ali  23  1..................MGVRVDTARCSGIGMCEMAAPSTFEVGEDGQANPEGADLEAARQAVSDCPTGALSI... 61
627 4.000e-12UniRef50_UPI0005F79FA6 hypothetical protein n=1 Tax=Williamsia sp. Leaf354 TaxID=1736349 RepID=UPI0005F79FA6  ali  31  1..................MHVTVDRDICCASGNCEMAAPAVFELADSGEVQVDDAAVEAVRRAISECPTQALTLIE. 62
628 4.000e-12UniRef50_A0A1H8YLN8 Ferredoxin n=7 Tax=Actinobacteria TaxID=201174 RepID=A0A1H8YLN8_9PSEU  ali  18  1..................MKVTVDEDRCCGAGTCVLLVPEVFDQREDDGVVPAEGFHAAVREAANVCPAAAITVAE. 64
629 4.000e-12UniRef50_A0A090N2N5 3Fe-4S ferredoxin n=1 Tax=Ostreococcus tauri TaxID=70448 RepID=A0A090N2N5_OSTTA  ali  14  124........TTRRAKPGEDRAVFVDEFTCIGCKQCVWAAPATFRMNEDRVFAQWLNNEDDIQQAIDSCPVDCIHWVKR 196
630 4.000e-12UniRef50_A0A100JNE6 Ferredoxin-1 n=86 Tax=Terrabacteria group TaxID=1783272 RepID=A0A100JNE6_STRSC  ali  21  1..................MKISVDYARCEGHGLCADQAPDVFSLDDDENLDVPDEHTPAARAAVNVCPVAALRV... 63
631 5.000e-12UniRef50_A0A0G4ED11 Uncharacterized protein n=1 Tax=Vitrella brassicaformis (strain CCMP3155) TaxID=1169540 RepID=A0A0G4ED11_VITBC  ali  16  152.DKRGIWEDAKYALEKRDNVVFVDEFTCIGCTNCNGWAPGVFKMGRARAYNQDGASRDDIQNAIDTCPVDCIYWV.. 229
632 5.000e-12UniRef50_I0YK34 Six-hairpin glycosidase n=2 Tax=Viridiplantae TaxID=33090 RepID=I0YK34_COCSC  ali  12  171....................VFVDETTCVGCRHCTYCAPNTFGMGRARVHTQWGDDEDAVKEAVDMCPVDCISFVNR 231
633 5.000e-12UniRef50_D6K896 Uncharacterized protein n=3 Tax=Streptomyces TaxID=1883 RepID=D6K896_9ACTN  ali  20  8..................MRVHADRSRCMAAGHCAVTVPGVFDHGDDGLVVPGEDYLEEIELAVDLCPSRALSVTR. 70
634 5.000e-12UniRef50_A0A1Q8CSL2 Uncharacterized protein n=1 Tax=Actinophytocola xanthii TaxID=1912961 RepID=A0A1Q8CSL2_9PSEU  ali  22  3...................RVIVDENRCCGAGLCAQELPDVFDQGEDAVVNPPAELAERLEAVTFACPSGAIRLVRE 65
635 5.000e-12UniRef50_A0A1B2HTL9 Uncharacterized protein n=7 Tax=Actinobacteria TaxID=201174 RepID=A0A1B2HTL9_9PSEU  ali  24  1..................MKVDVDPSLCEAHGVCTTILPEVFDLDEDEVLEVTPAEAPVAERAVASCPKGALRVSR. 63
636 5.000e-12UniRef50_A0A1U2PIQ2 Ferredoxin n=35 Tax=Actinobacteria TaxID=201174 RepID=A0A1U2PIQ2_9MYCO  ali  24  1..................MRIEVDLDICQGHGMCQMEAPDVFEAEVDHVPQPDESKRAEVEAAVQYCPTQALRIVE. 62
637 5.000e-12UniRef50_R7KDJ2 Ferredoxin n=1 Tax=Clostridium sp. CAG:451 TaxID=1262809 RepID=R7KDJ2_9CLOT  ali  24  1..................MKVKVNRDACIGCGACAAICPYVFEIDDEGLSKVVNSDVDDVKDAIDSCPTGAI..... 59
638 5.000e-12UniRef50_A0A1Q8JY10 Uncharacterized protein n=9 Tax=Actinobacteria TaxID=201174 RepID=A0A1Q8JY10_9PSEU  ali  18  1..................MRIHLDVDACTGHGVCEALAEDIFEVNDDGYVDPSEHRREAVQEAVAQCPTRALRLTD. 63
639 5.000e-12UniRef50_D5V4G2 Iron sulfur domain-containing, CDGSH-type n=1 Tax=Arcobacter nitrofigilis (strain ATCC 33309 / DSM 7299 / LMG 7604 / NCTC 12251 / CI)  ali  34  66.SEKKLKEEIIQVYNSKDVTVTFNRSICAGSAQCVNEFPSIYSSNSHDWINLDTETTQEIIKSIEGCPSSALSY... 139
640 5.000e-12UniRef50_UPI000486A4F2 ferredoxin n=1 Tax=Solirubrobacter soli TaxID=363832 RepID=UPI000486A4F2  ali  21  3...................RVHVDMNLCQSHGECVYVAPDIFELGDDDVLEISDDEREVAQEAADACPMLAIRLSD. 63
641 5.000e-12UniRef50_A0A1S1NNE8 Ferredoxin n=85 Tax=Bacteria TaxID=2 RepID=A0A1S1NNE8_9MYCO  ali  14  1..................MKAWVDPDRCRGHGICTTICSEVFAINEDGYSEVPAELHDAVRDAVKQCPEQAI..... 59
642 5.000e-12UniRef50_A0A2A5E910 Ferredoxin n=1 Tax=Candidatus Hydrogenedentes bacterium TaxID=2030809 RepID=A0A2A5E910_9BACT  ali  17  1..................MKINVDLELCEGFXSCMRLCPEVFQVDDQDVVHVPPELEEKVQMAAKRCPRQAISISD. 63
643 5.000e-12UniRef50_A0A0Q5QVG1 Ferredoxin n=29 Tax=Corynebacteriales TaxID=85007 RepID=A0A0Q5QVG1_9ACTN  ali  24  1..................MRIEVDRDICQGHGMCEMEAPDIFRAQVDTVASPDASHRDAVERAVQYCPTQALRIID. 62
644 5.000e-12UniRef50_A0A1V2I1H8 Uncharacterized protein n=16 Tax=root TaxID=1 RepID=A0A1V2I1H8_9ACTN  ali  20  1..................MRIVVDRDRCMGHAVCALMAPDLMELDDLGYAKVEPADEALARRAAGACPEGAIAVVD. 63
645 5.000e-12UniRef50_A0A1E3SL55 Ferredoxin n=2 Tax=Mycobacteriaceae TaxID=1762 RepID=A0A1E3SL55_9MYCO  ali  25  1..................MKVVVDQDRCVGNGVCESIAGDLFVVDDDAIARPPADRYESALEAVESCPSQALRISE. 63
646 5.000e-12UniRef50_A0A2H0SXZ4 Uncharacterized protein n=2 Tax=Candidatus Pacebacteria TaxID=1752724 RepID=A0A2H0SXZ4_9BACT  ali  15  19VTTEHVEDKTVQTKMAGKYKVEVIRDKCISAGSCVAIAPGVFELDEEQIAVQDGDDDQTKLLAAQSCPTAAVIVTD. 97
647 5.000e-12UniRef50_I0S3I1 Uncharacterized protein n=82 Tax=Actinobacteria TaxID=201174 RepID=I0S3I1_MYCXE  ali  20  2..................VKVIVDPDRCTGHGRCYSLAPEVFDADECGVADVSGPLEEQAANAEQNCPEQAITLSR. 64
648 5.000e-12UniRef50_A0A1J4Q2H8 Ferredoxin n=9 Tax=Streptomyces TaxID=1883 RepID=A0A1J4Q2H8_9ACTN  ali  24  3................DRWHVEVDRSLCVGSGQCLHHAPAHFRLDRSHPTDPDTDAAEPVLTAAETCPAEAISITLR 66
649 5.000e-12UniRef50_A0A2H0S8S8 Ferredoxin n=2 Tax=Bacteria candidate phyla TaxID=1783234 RepID=A0A2H0S8S8_9BACT  ali  14  4...................KLVIDQDSCIGCELCVNICPNVFKMVDGHVVDQNGDTSENIEQAIKSCPVQSIRWE.. 61
650 6.000e-12UniRef50_A0A1Y2MJ92 Ferredoxin-2 n=29 Tax=Actinobacteria TaxID=201174 RepID=A0A1Y2MJ92_PSEAH  ali  13  2................DPMKVIVDFDRCESNAVCMGVAPEVFEVRDDDYLNPAEALRPKVEEAARSCPKAAITIE.. 65
651 6.000e-12UniRef50_W7TBV5 Ferredoxin n=3 Tax=Actinobacteria TaxID=201174 RepID=W7TBV5_9PSEU  ali  17  1..................MQVFVDQEKCCGAGSCVLLAPDVFDQREDDGIVPPSELHGAVHEAVNVCPGAAIRV... 62
652 6.000e-12UniRef50_A3PEW5 Uncharacterized protein n=38 Tax=Cyanobacteria TaxID=1117 RepID=A3PEW5_PROM0  ali  19  32....................VWVDEAKCIGCQYCVHVASNTFTVDESRAIRQDGDSSDVIQEAIDTCPVDCIHWVK. 91
653 6.000e-12UniRef50_A0A2V4ADT3 Uncharacterized protein n=2 Tax=Prauserella TaxID=142577 RepID=A0A2V4ADT3_9PSEU  ali  24  1..................MRVTIDFEKCDSHAVCALTAPKIFWVDDHGYTQPDEAERENAVRAAQQCPAQAIQIVE. 62
654 6.000e-12UniRef50_A9BJ58 tRNA (Guanine-N(7)-)-methyltransferase n=15 Tax=cellular organisms TaxID=131567 RepID=A9BJ58_PETMO  ali  15  1..................MKIVIDKEACIGDAICESLCPDVFQMADDGKAEVIDEDAPCVQDAIDACPTEAISIEE. 60
655 6.000e-12UniRef50_UPI000372B106 ferredoxin n=1 Tax=Frankia discariae TaxID=365528 RepID=UPI000372B106  ali  23  9.....................VVDRERCIGSGMCVDYAPGTFTQDEQAKAVVTDDPADVVGIAVESCPTGALRLTR. 66
656 6.000e-12UniRef50_A0A158C958 Ferredoxin-2 n=15 Tax=Proteobacteria TaxID=1224 RepID=A0A158C958_9BURK  ali  22  7.................KLRVAVDQDVCVGAGLCVLSTADVFDQRDEDGVEPDEALYEKVLGAARKCPSKAIKVEK. 71
657 6.000e-12UniRef50_A0A0X3T219 Uncharacterized protein n=1 Tax=Streptomyces albus subsp. albus TaxID=67257 RepID=A0A0X3T219_9ACTN  ali  25  3...................RISVDGGRCVGSGNCVRIAPELFDQGEDGRARPWDADASQAREAAELCPAAAIGWSPE 68
658 6.000e-12UniRef50_A0A117E5Y9 Ferredoxin-1 n=15 Tax=Actinobacteria TaxID=201174 RepID=A0A117E5Y9_9ACTN  ali  18  1..................MRITADRERCVGAAQCVLAAPGVFDQDEEGLVEPGEGDRRVVRLAVGLCPASAIRIDE. 63
659 6.000e-12UniRef50_W5TF33 Putative ferredoxin n=9 Tax=Bacteria TaxID=2 RepID=W5TF33_9NOCA  ali  15  1..................MRINIDPQRCEGHALCAGIAPGVFEVGPDDLANPGEDSWRQIRAAANSCPTLAISLNE. 63
660 6.000e-12UniRef50_A0A1Q9TB55 Ferredoxin n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A1Q9TB55_9PSEU  ali  13  1..................MKVVVDFDLCESNAVCMGIAPEVFEVREDDFLNPPEALRPKLEEAVASCPRAAIKLVD. 63
661 6.000e-12UniRef50_A0A2G9YQY1 Ferredoxin n=42 Tax=cellular organisms TaxID=131567 RepID=A0A2G9YQY1_9BACT  ali  20  1..................MVIEIDKDLCIGCGTCVSLCPKVFQMGKDNKAAAINQSAQNCDEVVESCPVGAIKVTK. 60
662 6.000e-12UniRef50_A0A250WUR3 Uncharacterized protein n=1 Tax=Chlamydomonas eustigma TaxID=1157962 RepID=A0A250WUR3_9CHLO  ali  18  162................EDRAVFVAENECIGCGQCTRCAPNTFYMEDEHVSNQWADNEELIVEAVDSCPVDCIYYVKK 226
663 6.000e-12UniRef50_UPI0009FA5F11 ferredoxin n=1 Tax=Frankia sp. ACN1ag TaxID=102891 RepID=UPI0009FA5F11  ali  20  1..................MRVTIDRDLCVGHGLCYMLAPDVFHDDDEGYGQVTADRVEGARRAAGSCPERAI..... 60
664 6.000e-12UniRef50_A0A2E8H5S2 Uncharacterized protein n=1 Tax=Gemmatimonadaceae bacterium TaxID=2026741 RepID=A0A2E8H5S2_9BACT  ali  30  65..QEDRRPDELDSFVGREIAIHDNRGLCAHAGVCTGNLESVFQQETEPRIDADGAAVEEIVDVINRCPSGAIS.... 137
665 7.000e-12UniRef50_V4PEU9 Uncharacterized protein n=4 Tax=Alphaproteobacteria TaxID=28211 RepID=V4PEU9_9CAUL  ali  32  435...ENGQAPAVERAEGKDVIIEFEAKRCIHARFCVLQQPGVFKANVGPWIVPDDADADNLVTTAQNCPSGAIQYSRK 510
666 7.000e-12UniRef50_A0A1C5Q7G8 Ferredoxin n=5 Tax=Clostridiales TaxID=186802 RepID=A0A1C5Q7G8_9FIRM  ali  13  1..................MKAFVDPDLCIGCTQCTGICPEVFQMTGILAVAVPGELPPDTVEAAQACPVSAITISE. 62
667 7.000e-12UniRef50_A0A2E8KAM6 Uncharacterized protein n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A2E8KAM6_9GAMM  ali  25  31..............RGEQLKVTVDRNICCGYGVCVETIDEVFAFDGEEKLTITSDWQQKVRFACQQCPSQALTLED. 96
668 7.000e-12UniRef50_J9SKY1 Uncharacterized protein n=6 Tax=cellular organisms TaxID=131567 RepID=J9SKY1_9ACTN  ali  22  1..................MKIVVDRDACQGHGRCAVYAPEVYELDDEGYCAVPPAQEEDAISGADACPENAIEVID. 63
669 7.000e-12UniRef50_A0A1V5JHH6 Ferredoxin n=35 Tax=cellular organisms TaxID=131567 RepID=A0A1V5JHH6_9BACT  ali  25  1..................MDVKLNRNDCIGCGVCVQICPEVFELDEEAGVARQGGTPGAIREAVESCPVGCISV... 59
670 7.000e-12UniRef50_UPI000A31294F ferredoxin n=1 Tax=Nocardioides TaxID=1839 RepID=UPI000A31294F  ali  27  124..................VQVHIDRPSCQAYGNCADEAPEVFELDDQGYVDVPDALEQAARAAILSCPARALS.... 184
671 7.000e-12UniRef50_D3D375 Uncharacterized protein n=3 Tax=Frankia TaxID=1854 RepID=D3D375_9ACTN  ali  18  33..................MRVVVDFKLCESNALCVGIAPSVFELDDNDYLEPGEDLRADLKAAVAACPKQAISLAD. 95
672 7.000e-12UniRef50_A0A255IFT4 Ferredoxin n=1 Tax=Romboutsia maritimum TaxID=2020948 RepID=A0A255IFT4_9FIRM  ali  21  1..................MKGFVDKDTCIGCGACTGICPEVFDMDTDGLAVSIEELQETAIEAQEGCPVGAITVE.. 62
673 7.000e-12UniRef50_A0A1G6CIV8 Ferredoxin n=3 Tax=Deltaproteobacteria TaxID=28221 RepID=A0A1G6CIV8_9DELT  ali  26  5....................VYVDLDECIGCESCVEICPEVFKMDEAEVIMPEGGPEDQIEEAMETCPVQCIHWQE. 64
674 7.000e-12UniRef50_A0A2G9ZNI0 Ferredoxin n=9 Tax=root TaxID=1 RepID=A0A2G9ZNI0_9BACT  ali  23  1..................MAIKVNTDKCIGCGMCASLCPQVFKINSAGKSEVSSDDKECARSAAQACPVMAISV... 57
675 7.000e-12UniRef50_A0A099D3Z1 Ferredoxin n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A099D3Z1_9ACTN  ali  17  1..................MKIVVDQEKCQNHGLCAISAPANFALDTDGKLQYNEENIDDIEDAVDSCPLQAITLSR. 62
676 7.000e-12UniRef50_A0A1M3GSK3 Uncharacterized protein n=8 Tax=Proteobacteria TaxID=1224 RepID=A0A1M3GSK3_9PROT  ali  29  1..................MKVVWDDQACCHNGNCVKTLPEVFKVENGQFIQPQNASEQQVRQVVAACPAKALRIE.. 58
677 7.000e-12UniRef50_A0A1X7DSS1 Ferredoxin n=3 Tax=Bacteria TaxID=2 RepID=A0A1X7DSS1_9DELT  ali  17  5....................VTVDIDVCIGCEACVETCPEVFSMGPGDLANPDGASEDKIEEAMDTCPVNCILWED. 63
678 7.000e-12UniRef50_A0A0J6W9X5 Ferredoxin-1 n=54 Tax=Actinobacteria TaxID=201174 RepID=A0A0J6W9X5_9MYCO  ali  27  3...................KVSADRELCIQAGNCVMVASEVFDQDDDGIVDVDGQPADHAREAVKLCPASALTL... 62
679 7.000e-12UniRef50_A0A075FV71 Heat shock protein DnaJ domain-containing protein n=1 Tax=uncultured marine thaumarchaeote AD1000_66_F10 TaxID=1455930 RepID=A0A0  ali  22  30....................VDVDESLCIGCCSCEIIAPKVFTIDKLKMINPKGASYEKIMDAAETCPTKAIQVGER 93
680 7.000e-12UniRef50_A0A2T6N7U9 Uncharacterized protein n=1 Tax=gamma proteobacterium symbiont of Ctena orbiculata TaxID=1968598 RepID=A0A2T6N7U9_9GAMM  ali  34  5.....................SWDEKTCQHAGNCVKGLPSVFRIENGQVIDESAASLEEIKKIVDSCPSGALKLQD. 60
681 7.000e-12UniRef50_A0A1H7AU33 Ferredoxin n=2 Tax=Xiangella phaseoli TaxID=1144548 RepID=A0A1H7AU33_9ACTN  ali  21  3..................IRLTVEPDRCLGAGHCVRLVPEVFDEDDHGTVEPDSDRLPAVREAAQLCPNRAISI... 63
682 7.000e-12UniRef50_A0A1L5YBA2 3Fe-4S ferredoxin n=56 Tax=cellular organisms TaxID=131567 RepID=A0A1L5YBA2_9EUKA  ali  23  42....................VWVDEATCIGCRYCSHVAVNTFNLGRSRAIRQDGDSTECIQEAIDTCPVDCIHWVD. 101
683 7.000e-12UniRef50_UPI0009FFFD3E ferredoxin n=1 Tax=Nocardiopsis trehalosi TaxID=109329 RepID=UPI0009FFFD3E  ali  27  56..................VRVHADRTRCAGSGMCALTAPEVFDQDDTDGAAPPPALHGAVRRAVDMCPAHALT.... 116
684 8.000e-12UniRef50_C7M3C5 Ferredoxin (3Fe-4S) n=51 Tax=root TaxID=1 RepID=C7M3C5_ACIFD  ali  13  1..................MRIEVDFDKCQSNAVCQAVAPAIFEVRDDGYLTPSEDLRALVDQAARACPTQAITIVD. 63
685 8.000e-12UniRef50_A0A1M7KN59 Ferredoxin n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A1M7KN59_9ACTN  ali  21  1..................MKVRVDPQICQGHTLCAMTAPDLFELSDIDGHDVPADQETLAKEAARTCPEQAIIL... 62
686 8.000e-12UniRef50_A0A1W9Z0Y8 Uncharacterized protein n=1 Tax=Mycolicibacterium bacteremicum TaxID=564198 RepID=A0A1W9Z0Y8_9MYCO  ali  19  7....................VAVDPKLCEGHALCLDTAPEVFDVGDDDVAQPGPDMWPAVRAAIDACPRGAISVCEE 67
687 8.000e-12UniRef50_D7B190 Uncharacterized protein n=2 Tax=Nocardiopsis dassonvillei TaxID=2014 RepID=D7B190_NOCDD  ali  29  1..................MRLHADTGVCAGAGQCVRAAPDLFDQDDDGLVDVPERDRERALTAADWCPSGAVSVHE. 63
688 8.000e-12UniRef50_A0A2M8C5F5 Ferredoxin n=2 Tax=Candidatus Berkelbacteria TaxID=1618330 RepID=A0A2M8C5F5_9BACT  ali  23  1..................MKIVILRDKCVGAGSCVLFAPKTFKLDKEGKVILLDENAEEILQGAQSCPVNAIEI... 59
689 8.000e-12UniRef50_A0A0F7JPT6 Uncharacterized protein n=14 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0F7JPT6_9DEIO  ali  32  13...........KAYTAPGITVYYDARRCLHVASCVRGLPGVFDPQARPWIRPAHAGAEAVAAVVRTCPTGALHYV.. 76
690 8.000e-12UniRef50_A0A100J6Y1 Ferredoxin-2 n=34 Tax=Actinobacteria TaxID=201174 RepID=A0A100J6Y1_9ACTN  ali  23  1..................MQVELEADKCVASGQCVLAAMDVFDQDDDGIAEPAADQLDDVREAVAVCPAGAIRLVEK 64
691 8.000e-12UniRef50_A0A265UVN9 (4Fe-4S)-binding protein n=2 Tax=Flavobacteriales TaxID=200644 RepID=A0A265UVN9_9FLAO  ali  25  1......MDQNANVFSNGALTVTYEPKCCANAGLCAKQLSNVFRHSVIPWINLEGAETQEIVKQVQKCPSGALKF... 68
692 8.000e-12UniRef50_D3D721 Uncharacterized protein n=11 Tax=Actinobacteria TaxID=201174 RepID=D3D721_9ACTN  ali  19  6..................MRVTVDHDLCVGAGQCVRAAPEVFEQRDPDGKVPDAQYQAAVREAARMCPARAINIE.. 69
693 8.000e-12UniRef50_K8ES42 Uncharacterized protein n=1 Tax=Bathycoccus prasinos TaxID=41875 RepID=K8ES42_9CHLO  ali  20  225..............EGETRAVFVDESECIGCGNCAQYAAKTFSMDVDRVINQWADDSETIEIAIDMCPVDCIWFVKR 293
694 8.000e-12UniRef50_A0A1G7RHJ8 Ferredoxin n=4 Tax=Bacteria TaxID=2 RepID=A0A1G7RHJ8_9PSEU  ali  13  1..................MKVTVDFDLCESNALCMAAAPEVFEVREDDFLNPPESLRAKVEEAVRACPKAAITLGD. 63
695 8.000e-12UniRef50_V6KY29 Uncharacterized protein n=14 Tax=Actinobacteria TaxID=201174 RepID=V6KY29_STRRC  ali  19  11..................MRVTTERDRCVGSGQCALLSPEVFDQDDHGLVEPADDLRAGVLQAADLCPSRSIRV... 71
696 8.000e-12UniRef50_UPI000A06B256 hypothetical protein n=1 Tax=Sphingomonas asaccharolytica TaxID=40681 RepID=UPI000A06B256  ali  34  438.......SDGLETIVGHDVTVLFNEKRCIHARFCVTQAPATFLANAGAWVQPDATETELLCGTIRQCPSGALSYQRK 508
697 9.000e-12UniRef50_H0JKE5 Ferredoxin (Fragment) n=2 Tax=Rhodococcus TaxID=1661425 RepID=H0JKE5_9NOCA  ali  24  1..................MKARVDPAKCQGYGICVELAPRHFEFDDWGFVDADGEHAQSVSRAIEQCPIRAIRWIE. 63
698 9.000e-12UniRef50_A0A2R4T9S6 Ferredoxin n=7 Tax=Streptomyces TaxID=1883 RepID=A0A2R4T9S6_9ACTN  ali  17  1..................MRLVVDLNRCQGYAQCAFLAPDVFAMHGDEALQADAEQSEPLARAVAACPVQAILVE.. 61
699 9.000e-12UniRef50_A0A2E8GGS5 Ferredoxin n=7 Tax=Actinobacteria TaxID=201174 RepID=A0A2E8GGS5_9ACTN  ali  19  1..................MQVKLDIDKCIGSGSCEMLAPEVFEVGQDGLVKPGSAMESKCRAAEESCPTQAIQIE.. 62
700 9.000e-12UniRef50_A0A258RGM2 Uncharacterized protein n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A258RGM2_9SPHN  ali  34  467...PEIAADGREIILGQAIDLIFSAERCIHARHCVLGQPQVFKANEGPWIDPDATSTEGLVTVAHMCPSGAIQYRR. 540
701 9.000e-12UniRef50_A0A117E9F6 NADH-quinone oxidoreductase chain 1 n=583 Tax=Actinobacteria TaxID=201174 RepID=A0A117E9F6_9ACTN  ali  24  445..............SGSRQKIFVDWTLCRGHGLCADILPEVFQLGADGFPTVAQAAEAKALRAVRRCPALALRIEE. 511
702 9.000e-12UniRef50_K9W8M7 Ferredoxin n=249 Tax=Cyanobacteria TaxID=1117 RepID=K9W8M7_9CYAN  ali  19  43....................VYVDEITCIGCKHCAHVARNTFYIEEDRVIRQDGDSEEVIQEAIETCPVDCIHWVD. 102
703 9.000e-12UniRef50_A0A2N9BKG9 Ferredoxin-1 n=60 Tax=Bacteria TaxID=2 RepID=A0A2N9BKG9_STRCX  ali  21  1..................MKISVDHPRCEGHGLCADQAPDIFSLDDDEGTDVPDEHQPAARAAVNACPVAALRV... 63
704 9.000e-12UniRef50_M8A6N0 Protein tumorous imaginal discs, mitochondrial n=1 Tax=Triticum urartu TaxID=4572 RepID=M8A6N0_TRIUA  ali  12  150...................RVFVDEFTCIGCRICANVCPSVFEIEDEGRARVQRGNPELIQDAIDSCPVDCIHWT.. 208
705 9.000e-12UniRef50_V4RRI3 Uncharacterized protein n=2 Tax=Proteobacteria TaxID=1224 RepID=V4RRI3_9CAUL  ali  32  461.......TPPIERAEGKDVIIEFEAKRCIHARFCVLQQPGVFKANVVGWIMPDDADADNLVATAQNCPSGAIQYTRK 532
706 9.000e-12UniRef50_A0A1Y2MN60 Ferredoxin-1 n=16 Tax=Actinobacteria TaxID=201174 RepID=A0A1Y2MN60_PSEAH  ali  30  1..................MKIVADTDRCVGAGQCVLTAPALFDQDDDGVAAPEAGSVESARAAVHLCPAQALS.... 60
707 9.000e-12UniRef50_A0A1Z2L7Y2 Ferredoxin n=281 Tax=Bacteria TaxID=2 RepID=A0A1Z2L7Y2_9ACTN  ali  22  3................ERWRVTVDRRVCVGSGLCAGLAPEAFRLDPARRSHPVPGARERVREAAEMCPVEAIAI... 63
708 9.000e-12UniRef50_A0A0D0NAT7 Uncharacterized protein n=3 Tax=Kitasatospora TaxID=2063 RepID=A0A0D0NAT7_KITGR  ali  28  3.................DLEVRVDRDLCVGSGQCLISAADYFGQDIEGYVEADLATNEEVQEAVEKCPSGALSWHR. 68
709 1.000e-11UniRef50_I0GMQ3 Putative ferredoxin n=18 Tax=Terrabacteria group TaxID=1783272 RepID=I0GMQ3_SELRL  ali  25  1..................MKGYVDKALCVACGMCVGSCPEGFRLGGDGLAELPAESVEDAQQAAGDCPVGAITI... 60
710 1.000e-11UniRef50_UPI00040F6D0A ferredoxin n=1 Tax=Streptomyces sp. CNH287 TaxID=1288082 RepID=UPI00040F6D0A  ali  18  1..................MKISVDEEKCCGSGMCALSAPGLFDQGPDGRVVPSPAAEDLIQVAVCNCPCEAIRLED. 63
711 1.000e-11UniRef50_I0WIX1 Ferredoxin n=22 Tax=Actinobacteria TaxID=201174 RepID=I0WIX1_9NOCA  ali  19  2..................VKLSVDLHRCQGYANCVVASPDVFDLSDEGKAHIPDDDVPVVEEAVRSCPASALSME.. 63
712 1.000e-11UniRef50_A0A0G1PCT3 4Fe-4S ferredoxin, iron-sulfur binding protein n=4 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1PCT3_9BACT  ali  18  1..................MKIKIDQENCIGCGSCVAMANQTFKMNDAGVVNQAGNSDEEILLAAKSCPVRVIQVSD. 61
713 1.000e-11UniRef50_A0A1M7LFT5 Uncharacterized Fe-S cluster protein YjdI n=3 Tax=Burkholderiales Genera incertae sedis TaxID=224471 RepID=A0A1M7LFT5_9BURK  ali  34  463....RPTPKPPDEARGRDVLLRFDTQRCIHSRHCVLGEPAVFLANPGDWLYPDQATPERIAIVAHSCPSGAITYQR. 535
714 1.000e-11UniRef50_A0A0Q7PR56 Ferredoxin n=11 Tax=Actinobacteria TaxID=201174 RepID=A0A0Q7PR56_9ACTN  ali  24  1..................MKISIDREKCASLGVCESISPDHFEINDDGRADVAGDEAALIQRAVTSCPSGALSLVE. 63
715 1.000e-11UniRef50_UPI0008377CE7 ferredoxin n=1 Tax=Nocardia miyunensis TaxID=282684 RepID=UPI0008377CE7  ali  20  1..................MKVTVDSGLCAAHGDCVIAAPDIFDLGDEDEVVPEEKYRAQIEEAVRLCPVAALKIED. 64
716 1.000e-11UniRef50_UPI00082E8AF9 ferredoxin n=1 Tax=Nocardia miyunensis TaxID=282684 RepID=UPI00082E8AF9  ali  14  1..................MEIHIDRHRCEGHALCASIAPTVFEVGDDDLATPAEDIEPKVHMAVDACPTLAISL... 61
717 1.000e-11UniRef50_UPI0009FD36B1 ferredoxin n=4 Tax=Actinobacteria TaxID=201174 RepID=UPI0009FD36B1  ali  21  2..................MHIDVDMGLCQNLAQCVFAAPEVFDLDDAGRASAPASQRDEVEAAVLACPVQAITLR.. 62
718 1.000e-11UniRef50_A0A2E0TCY3 Cytochrome P450 n=2 Tax=Myxococcales TaxID=29 RepID=A0A2E0TCY3_9DELT  ali  18  477...ETPTRPTLQLDPAQPVRVRIDRQLCVGHAVCVSEAPKIFRLAESGEAHPPAEQYALLARAAEHCPNQAIVVE.. 553
719 1.000e-11UniRef50_A0A1V4SYJ0 Ferredoxin n=3 Tax=Clostridiaceae TaxID=31979 RepID=A0A1V4SYJ0_9CLOT  ali  19  1..................MKARVDKDTCIGCGLCTAVCPSIFSMEDDGKVELDNDTLIDAREAESQCPVGAISVE.. 62
720 1.000e-11UniRef50_X0PWA0 Putative 3Fe-4S ferredoxin n=3 Tax=Rhodococcus TaxID=1661425 RepID=X0PWA0_9NOCA  ali  17  4...................RVSVDPQVCEGHGQCFIEAPNIFEMDDDGYAQVDDELAPKVEQAVRACPAGAVVITR. 65
721 1.000e-11UniRef50_U5WN09 Ferredoxin n=54 Tax=Actinobacteria TaxID=201174 RepID=U5WN09_MYCKA  ali  20  1..................MRVWVDDQCCRGHGMCLTLCPEVFRLTDDGYADVPTELEAAAREAIECCPEQAIR.... 60
722 1.000e-11UniRef50_A0A1Q5CRC4 Uncharacterized protein n=4 Tax=Actinobacteria TaxID=201174 RepID=A0A1Q5CRC4_9ACTN  ali  19  7..............RGNHVEVEVDRTRCAGLAICELQAPEHFEVQDDGVVEVPPDRLAAVRSAVASCPNQALRFVDR 74
723 1.000e-11UniRef50_UPI0009E411D7 hypothetical protein n=1 Tax=Williamsia herbipolensis TaxID=1603258 RepID=UPI0009E411D7  ali  33  23..............RGTVVHVTVDRDICCASGNCEMAAPAVFELADSGEVQVDDAAVEAVRRAISECPTQALTLIE. 88
724 1.000e-11UniRef50_A0A2N2P700 Ferredoxin n=2 Tax=Chloroflexi TaxID=200795 RepID=A0A2N2P700_9CHLR  ali  18  1..................MKVVVDPDICLGCGVCESIAPNIFILGDEVYAKVPEQLRDVVEEAVSECPEEAISIIE. 63
725 1.000e-11UniRef50_A0A1A2T976 Ferredoxin n=12 Tax=Mycobacterium TaxID=1763 RepID=A0A1A2T976_MYCIT  ali  22  5...................RIEADLDLCQGHAMCELEAPDYFQVPKRGKVEPPEDARDEVERAVEMCPTQALLIKEK 67
726 1.000e-11UniRef50_A0A0K1EMI6 Ferredoxin n=89 Tax=Bacteria TaxID=2 RepID=A0A0K1EMI6_CHOCO  ali  18  1..................MRVIVDLPKCCGAGQCVLIAPQVFDQQDDGIVAPPKEFHAATREAASVCPGAAIQLEE. 63
727 1.000e-11UniRef50_A0A0K8PQX3 Ferredoxin n=6 Tax=Streptomyces TaxID=1883 RepID=A0A0K8PQX3_STRAJ  ali  17  8...................KVSVDRELCYGSAECVHRAPAVFEFVDGFGAVRPGGDAPEILETAEKCPSQAISIT.. 67
728 1.000e-11UniRef50_M9RVU8 CDGSH-type domain-containing protein n=77 Tax=root TaxID=1 RepID=M9RVU8_9RHOB  ali  33  4...........EVVKGLDVTIRFDASRCIHSRGCVLGHPEIYVPNVQGWIHPDAASADTVMLTALNCPSGAIRV... 67
729 1.000e-11UniRef50_UPI0004866C79 ferredoxin n=3 Tax=Actinobacteria TaxID=201174 RepID=UPI0004866C79  ali  20  1..................MRVRIAPERCCASGMCVLTAPGVFDQSEEDGAVPRAEEEQAVRDAVRLCPTGAI..... 60
730 1.000e-11UniRef50_A0A0G1FK97 Uncharacterized protein n=37 Tax=root TaxID=1 RepID=A0A0G1FK97_9BACT  ali  20  5...................KVTVDRNLCIGAGSCVAVAPLAFALDNEAKATVDQTDDNTLLESAKACPVAAIIVTDE 66
731 1.000e-11UniRef50_UPI0003A20B91 ferredoxin n=1 Tax=Actinoplanes globisporus TaxID=113565 RepID=UPI0003A20B91  ali  21  1..................MKIAVDTSLCIGSGTCALTAPAVFGQDEEQAVDPPEAQREAVELAVASCPAAVIR.... 61
732 1.000e-11UniRef50_A0A1X0GGZ2 Cytochrome n=8 Tax=Actinobacteria TaxID=201174 RepID=A0A1X0GGZ2_9MYCO  ali  17  3...................RVCVDADLCTGHGRCYTLAPDVFDADEYGVADVSGPLEEQAVNAEQNCPEQAITLSR. 64
733 1.000e-11UniRef50_UPI0009DDEAE6 ferredoxin n=1 Tax=Blastococcus sp. URHD0036 TaxID=1380356 RepID=UPI0009DDEAE6  ali  22  41......................VDSEFCQAHGVCAAMAPGLIELDDDGYARVSDDQLETARAAARSCPEGAITVE.. 98
734 1.000e-11UniRef50_A0A1B9F2I2 Ferredoxin-2 n=19 Tax=Bacteria TaxID=2 RepID=A0A1B9F2I2_9ACTN  ali  27  1..................MRIQVNQDVCVGAGQCVIAARTVFDQDEHDGAEPPHTELESVREAVHRCPAGAIELFE. 64
735 1.000e-11UniRef50_UPI00082C683A DnaJ and Fer domain-containing protein n=1 Tax=Nitrosopumilus sp. Nsub TaxID=1776294 RepID=UPI00082C683A  ali  16  146................PDLQVSIDKSLCIGCCSCEIIAPEVFEINKSKVINQKGAGVNKIMNAAETCPTKAIKVE.. 211
736 1.000e-11UniRef50_A0A1L6L1B7 Cytochrome P450 51 n=3 Tax=Sorangiineae TaxID=80812 RepID=A0A1L6L1B7_9DELT  ali  17  485...................RVSVDLDLCQGHAACVGEAPEVFRVDGLGKVRPDASLSAKVEKAAQFCPTKTIKIE.. 545
737 1.000e-11UniRef50_A0A128ATP3 Ferredoxin n=6 Tax=Streptomyces TaxID=1883 RepID=A0A128ATP3_9ACTN  ali  17  1..................MKVAVDQGRCVGAGMCAMTAGEVFGQQEADGLEPPEHLVDQVEEAEQLCPSQAITV... 62
738 1.000e-11UniRef50_A0A2N3ZMU6 Ferredoxin n=2 Tax=Streptomyces sp. OK885 TaxID=1882770 RepID=A0A2N3ZMU6_9ACTN  ali  23  34..................MRIELDEPKCVASGQCVMASPEVFDQREDDGVAPGAELLDGVREAVAICPAAAIRLVEK 98
739 1.000e-11UniRef50_A0A0M7BFW0 Ferredoxin n=4 Tax=Bacteria TaxID=2 RepID=A0A0M7BFW0_9ACTN  ali  21  1..................MKLSVDTDKCCGAGQCVLVAPEIFDQDDDGIVAPSDGLRDAVEDAIAICPADVIHVE.. 62
740 1.000e-11UniRef50_A0A0B2Y8P4 Uncharacterized protein n=1 Tax=Mycolicibacterium setense TaxID=431269 RepID=A0A0B2Y8P4_9MYCO  ali  28  3.................GVRITVDRLLCMGSGTCLAVTPALFDMGDDGAAYPSKEPGPKLAEAISRCPTGAIQV... 62
741 1.000e-11UniRef50_UPI000BE3E6D9 ferredoxin n=1 Tax=Streptomyces zhaozhouensis TaxID=1300267 RepID=UPI000BE3E6D9  ali  24  20..................VRVEVRPETCVGAGQCVLAAPRLFDQGEDDGARPGLEETAEVLRAVDDCPAGAITLHD. 83
742 1.000e-11UniRef50_A0A1M4YQP2 Ferredoxin n=6 Tax=root TaxID=1 RepID=A0A1M4YQP2_9THEO  ali  18  1..................MKVTVDQDLCIGCGACIDTCPEVFDWNDDGMAEVPEDVEELARQALDDCPVEAIK.... 60
743 1.000e-11UniRef50_A0A0J6XIX2 Uncharacterized protein n=5 Tax=Actinobacteria TaxID=201174 RepID=A0A0J6XIX2_9ACTN  ali  20  1..................MQVIIDKDVCVACGACVLSGPDVFDQNEDGQAEPGESLRDQILESIEACPVQALSLVE. 63
744 1.000e-11UniRef50_A0A0U5LVC2 Ferredoxin-2 n=128 Tax=Bacteria TaxID=2 RepID=A0A0U5LVC2_STRRE  ali  24  1..................MQITIDEAKCCGAGQCVLVAPEVFDQRDEDGIVPGADQHAAVREAATICPAAAIQVRE. 64
745 1.000e-11UniRef50_A0A1G9QX11 Ferredoxin n=2 Tax=Bacillus TaxID=55087 RepID=A0A1G9QX11_9BACI  ali  22  1..................MKVTVNKNACIGNGMCIGIVSEAFKFGEDGKSQADPKLLDLIREAEENCPVGAIIIEE. 61
746 1.000e-11UniRef50_A0A0H5CG70 Uncharacterized protein n=2 Tax=Alloactinosynnema sp. L-07 TaxID=1653480 RepID=A0A0H5CG70_9PSEU  ali  18  83...................RIVIDQDRCIGTGHCAFTAPVVFSQDDDGLSTVLPGTPAAVKQAVLGCPVRAISI... 142
747 1.000e-11UniRef50_A0A0U9HFG9 Ferredoxin n=1 Tax=Tepidanaerobacter syntrophicus TaxID=224999 RepID=A0A0U9HFG9_9THEO  ali  12  62..................LKLTVDQDLCIGCGLCIDTCPSVFDWNDDGKAEVPEDVEDDAREAMENCAAEAIK.... 121
748 1.000e-11UniRef50_A0A1E4NVQ4 Ferredoxin n=23 Tax=Actinobacteria TaxID=201174 RepID=A0A1E4NVQ4_9PSEU  ali  15  1..................MKVVVDFDLCESNAVCMGVAPEVFEVREDDFLNPSEELRPKIEEAVRSCPKAAISIKE. 63
749 1.000e-11UniRef50_UPI0003998AF2 ferredoxin n=1 Tax=Amycolatopsis nigrescens TaxID=381445 RepID=UPI0003998AF2  ali  25  1..................MNIVVDTQRCAGTGMCAFAAPEIFDVDDEEGTVPDAGQEDAVHEAVQLCPTVAIRLVE. 64
750 1.000e-11UniRef50_A0A2T5X8I1 Ferredoxin n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A2T5X8I1_9MICO  ali  17  1..................MKIHVDRTLCDNHGQCTITAPSVFRIDDQGILNVDDSLRADIEDSMDVCPVQAIFIV.. 61
751 1.000e-11UniRef50_UPI000932F0BE ferredoxin n=1 Tax=Rhodococcus jostii TaxID=132919 RepID=UPI000932F0BE  ali  17  1..................MRISVDRSLCEIHGECTFIAPQVFALNDSGDLEYAEDDSEMVRDAAMACPAQAIRLE.. 61
752 1.000e-11UniRef50_UPI000A372EBA ferredoxin n=1 Tax=Streptomyces angustmyceticus TaxID=285578 RepID=UPI000A372EBA  ali  23  1..................MRITVDRDRCVGAGMCAMTAGEVFEQHEEDGTEPPEQWADEVEEAEHLCPSRAITV... 62
753 2.000e-11UniRef50_A0A1Q4E6C0 Ferredoxin n=6 Tax=Actinobacteria TaxID=201174 RepID=A0A1Q4E6C0_9PSEU  ali  26  2..............RGDAVRVRIDQAACAGHGQCAATAPDVYQLDDDGFVLPVTSAREHAVDGANACPENAITIIEE 70
754 2.000e-11UniRef50_F0YPJ9 Methionine aminopeptidase (Fragment) n=1 Tax=Aureococcus anophagefferens TaxID=44056 RepID=F0YPJ9_AURAN  ali  18  569....................VYVDEATCVGCTMCATIAPQTFLMTDDHGFNQEGDDEETIREAISTCPVSCIHYV.. 627
755 2.000e-11UniRef50_UPI000BE75D7A iron-binding protein n=1 Tax=Porphyromonas gingivalis TaxID=837 RepID=UPI000BE75D7A  ali  44  2...........................CIHSRNCVLGHPEVFVPNPGQWIHPEAGSVEAVVGVAHSCPSGAITYRRK 52
756 2.000e-11UniRef50_UPI0009E7F4DD hypothetical protein n=4 Tax=Proteobacteria TaxID=1224 RepID=UPI0009E7F4DD  ali  38  451..............RGRDVLLRFDTQRCIHARMCVLGEPEVFLANPGDWLFPDKATPERIAIVAANCPSGAITYDR. 513
757 2.000e-11UniRef50_UPI00037F6C45 hypothetical protein n=1 Tax=Woodsholea maritima TaxID=240237 RepID=UPI00037F6C45  ali  28  1......MKQRITLYKGKSVEVTYDSAICLHASECTNGSSRAFNPKRNPWVDPNGEDPASVLSIVARCPTSALR.... 67
758 3.000e-11UniRef50_G2GNB1 Ferredoxin n=8 Tax=Streptomyces TaxID=1883 RepID=G2GNB1_9ACTN  ali  15  1..................MKVSIDPGLCYGSAECAHRVPGVFDFVDEYGVREDSGDDPLVREAAERCPSQAITLT.. 61
759 3.000e-11UniRef50_A0A2R8A9U1 Uncharacterized protein n=2 Tax=Pontivivens insulae TaxID=1639689 RepID=A0A2R8A9U1_9RHOB  ali  27  64.NDGPPKRNKALTYTGTSVTISYTPVLCTHAAECVTRAGGAFDPEKKPWCQPENETFDKMMDAVAACPSGALR.... 139
760 3.000e-11UniRef50_UPI0009DB073F hypothetical protein n=1 Tax=Leptospira meyeri TaxID=29508 RepID=UPI0009DB073F  ali  32  1.....MDNEIIKKYSNEDITVVWKPNVCIHSTICFKGLPGVFDRKRKP............................. 43
761 4.000e-11UniRef50_G4I2S2 Uncharacterized protein n=2 Tax=Mycobacterium rhodesiae TaxID=36814 RepID=G4I2S2_MYCRH  ali  22  1MSQEPKLEVAVVSQEAG-LEVVADRGRCLGSGNCFYSDPEVFDQSEQDGINPSAEHRDAVILAASLCPGQAISVRE. 81
762 5.000e-11UniRef50_A0A0F6W0J5 Uncharacterized protein n=1 Tax=Sandaracinus amylolyticus TaxID=927083 RepID=A0A0F6W0J5_9DELT  ali  34  446..........VEEARTDDVALRFEGRRCIHARHCVLGAPTVFLANQGPWLHPETIPVEALVRVAQACPSGAITYER. 512
763 6.000e-11UniRef50_UPI0009F741E0 hypothetical protein n=1 Tax=Haladaptatus sp. W1 TaxID=1897478 RepID=UPI0009F741E0  ali  40  52.................................CVEELPGEFDPSQRPWIDVDNADADEVALVIERCPTGALHYE.. 93
764 7.000e-11UniRef50_F3ZPU0 Uncharacterized protein n=1 Tax=Bacteroides coprosuis DSM 18011 TaxID=679937 RepID=F3ZPU0_9BACE  ali  31  1......MSDKKYRYNNGELTIVWQPSLCSHSGKCVKTLPQVYNPDAKPWITTGG....................... 48
765 8.000e-11UniRef50_A0A1Z8AEE0 Iron-binding protein n=1 Tax=Rhodobacterales bacterium 52_120_T64 TaxID=1856301 RepID=A0A1Z8AEE0_9RHOB  ali  37  1..................MVLSFDTKRCVHARLCVLGAPNVFLSGEGQWIFPDKMETEALRTVAHSCPSGAVSYVPK 60
766 8.000e-11UniRef50_A0A1M7RG46 Ferredoxin n=1 Tax=Cryptosporangium aurantiacum TaxID=134849 RepID=A0A1M7RG46_9ACTN  ali  29  3...................TIDIDRDVCIGSGMCVVAAPGAFGQDDSVVVDPDGEPAGVIAGAVEACPTGALTLRE. 62
767 9.000e-11UniRef50_UPI000BAAA06C hypothetical protein n=1 Tax=Actibacterium pelagium TaxID=2029103 RepID=UPI000BAAA06C  ali  35  454...............GKDMLLTFDTRRCIHARRCVLGAPKVFLSGVGDWLFPDEMDTGALRGVCHSCPSGAITYDPK 516
768 9.000e-11UniRef50_A0A1C4BJS8 Divergent 4Fe-4S mono-cluster n=2 Tax=Chitinophaga costaii TaxID=1335309 RepID=A0A1C4BJS8_9BACT  ali  34  2...........................CIHSSKCFQDLSAVFDPREGPWIWPEGAITEGIVSLVVKCLSGALSY... 48
769 1.000e-10UniRef50_X7YPR9 Uncharacterized protein n=8 Tax=Mycobacterium TaxID=1763 RepID=X7YPR9_MYCKA  ali  20  1..................MRIVVDLVRCQGYAQCCFLAPRAFKLAGEYHPNPDDTQRQQILRAAAACPVQAIR.... 59
770 1.000e-10UniRef50_V8CYH0 Ferredoxin n=12 Tax=Actinobacteria TaxID=201174 RepID=V8CYH0_9ACTN  ali  32  3..................VRIDIDTAACNGYGNCLVAAPEVFELDNNNIARPTDADLDEVREAVADCPAGALRIHE. 65
771 1.000e-10UniRef50_D6AUC9 Uncharacterized protein (Fragment) n=1 Tax=Streptomyces roseosporus NRRL 15998 TaxID=457431 RepID=D6AUC9_STRFL  ali  31  15VTSQPPPRPAAKSYDGEGIVVGFDSHRCLHAAECVRGLPTVFDVDRRPWIQPDNAPA.................... 71
772 2.000e-10UniRef50_A0A1S2QAM8 Ferredoxin n=6 Tax=Actinobacteria TaxID=201174 RepID=A0A1S2QAM8_9ACTN  ali  24  1..................MKIVADTGKCVGAGQCVRTAPELFDQAEGDGLEPEDALLPAVGEAVDLCPGRALSLLR. 64
773 2.000e-10UniRef50_A0A060HHP6 Putative chaperone DnaJ n=3 Tax=TACK group TaxID=1783275 RepID=A0A060HHP6_9ARCH  ali  18  120.KKAEAKKDTADHYYGPRFHIIVEPSLCMAFGSCETLAPKVFVVEKNKRVNPTGADYETIHAAAQTCPTKAIRIIDR 210
774 2.000e-10UniRef50_A0A2N5JVW6 Uncharacterized protein n=1 Tax=Actinobacteria bacterium TaxID=1883427 RepID=A0A2N5JVW6_9ACTN  ali  20  33.........RRRRFAPVSVEVTVQRARCIGSKVCLSAAPGVFHIDYDNVIDAEAASEQELIDAARTCPTRAISVIK. 102
775 2.000e-10UniRef50_A0A2D6R6P9 Uncharacterized protein n=2 Tax=archaeon TaxID=1906665 RepID=A0A2D6R6P9_9ARCH  ali  36  70............EFKGKEVTVVDNIGICAHAGECTKGVPNVFWEGENRISNPDKGDKEKIIATIRKCPSGSLAYK.. 134
776 2.000e-10UniRef50_A0A2E0RAQ1 Uncharacterized protein n=1 Tax=Actinobacteria bacterium TaxID=1883427 RepID=A0A2E0RAQ1_9ACTN  ali  21  11......................VDVEICQGTAYCVRVAPKLFKVGQNSTAEVTKADPELIIEAATLCPTRAITY... 67
777 2.000e-10UniRef50_A0A0C2M7T7 Uncharacterized protein n=6 Tax=cellular organisms TaxID=131567 RepID=A0A0C2M7T7_THEKT  ali  57  2..DKELLDAGYRAYTGEKIDVYFNTDICQHSGNCVRGSAKLFNLKRKPWIVPDEVDVATVV................ 60
778 2.000e-10UniRef50_A0A1Q7PNT2 Uncharacterized protein (Fragment) n=1 Tax=Thaumarchaeota archaeon 13_1_40CM_2_39_4 TaxID=1805387 RepID=A0A1Q7PNT2_9ARCH  ali  24  159....................ITVEPSLCLAFGSCETLAPKVFVLEKNKRINPTGANFESILAAAQTCPTKAIKIIDR 222
779 2.000e-10UniRef50_V4XZ38 Uncharacterized protein n=1 Tax=uncultured archaeon A07HB70 TaxID=1412872 RepID=V4XZ38_9ARCH  ali  38  18...........HEYRGAAVDVTFDGARCLGVRACVEGLPDAFDPDRRPWVDPDAADADAVRDVVERCPTGALTH... 80
780 3.000e-10UniRef50_A0A0T1WAU1 Ferredoxin n=10 Tax=Actinobacteria TaxID=201174 RepID=A0A0T1WAU1_9MYCO  ali  24  1..................MRIVVDLNRCLGYAQCVPLAPEVLQLNGEEVLNPDDSQRQRVARAVASCPVQAI..... 58
781 3.000e-10UniRef50_A0A2G7DBE9 Ferredoxin n=1 Tax=Verrucosispora sp. CNZ293 TaxID=2035249 RepID=A0A2G7DBE9_9ACTN  ali  18  4.................GWRVEVDARRCIGSGGCVGMAPGHFRMESGLAIPIGAEPTDAVIDAAESCPVEAITVR.. 63
782 3.000e-10UniRef50_A0A2P2E2X8 Uncharacterized protein n=1 Tax=Leptospira sp. YH101 TaxID=1917863 RepID=A0A2P2E2X8_9LEPT  ali  23  459LSTPVSESSGIEISETESIRLEFEGKKCIHSRHCVTELPLVFKANPGKWIFAENADPNVLAMVARECPSGAIRFTRK 536
783 3.000e-10UniRef50_Q9KXY1 Putative ferredoxin n=12 Tax=Streptomyces TaxID=1883 RepID=Q9KXY1_STRCO  ali  20  1..................MRISVDPEQCYGSGDCVHRAPSVFTQVGGLGAVIPGVDAPRVREAAEGCPSAAITIAR. 62
784 4.000e-10UniRef50_A0A2E9MKM2 Uncharacterized protein n=4 Tax=Gemmatimonadetes TaxID=219685 RepID=A0A2E9MKM2_9BACT  ali  27  65.DNEGGKGHELRESEGEEVTVVDDRNLCCFASACSAGAPSVFREDGQRFAKPDASSAQEVIDTIRKCPSGSLLYKLK 142
785 4.000e-10UniRef50_UPI000A03EB89 ferredoxin n=2 Tax=Actinobacteria TaxID=201174 RepID=UPI000A03EB89  ali  21  53..................VRLVVDLNRCQGYAQCAFLAPEVFTLRGEEALTPAEADHERVRQATAACPVRAIT.... 111
786 4.000e-10UniRef50_C1B258 3Fe-4S ferredoxin n=16 Tax=Terrabacteria group TaxID=1783272 RepID=C1B258_RHOOB  ali  18  1..................MKLVVDLNRCQGYAQCVFLAPDVFTLHGEEALLPADGERDHVSQAAAACPVHAIT.... 59
787 4.000e-10UniRef50_G0G609 Ferredoxin n=11 Tax=Amycolatopsis TaxID=1813 RepID=G0G609_AMYMS  ali  17  206..................VRVDVDSQRCHAYGVCQSEAPQVFQLGLDGQLRPGAQLVPNVQAAARACPMRAIHL... 265
788 4.000e-10UniRef50_A0A0N9YXW7 Chaperone protein DnaJ n=1 Tax=Candidatus Nitrocosmicus oleophilus TaxID=1353260 RepID=A0A0N9YXW7_9ARCH  ali  24  143...................RIIVEPSLCLAFGSCETLAPKVFVVEKNRRINPTAEDFETILDAAKTCPTKAIFIIDK 207
789 4.000e-10UniRef50_A0A1Y2MW51 Ferredoxin-2 n=1 Tax=Pseudonocardia autotrophica TaxID=2074 RepID=A0A1Y2MW51_PSEAH  ali  22  4...................RVHIDETLCFGYGNCMVTAPEVFDLDADTSIRPVDEDGPALREAVADCPARAIALHR. 66
790 4.000e-10UniRef50_A0A1C6U0S6 Ferredoxin n=15 Tax=Actinobacteria TaxID=201174 RepID=A0A1C6U0S6_9ACTN  ali  16  7.................GWRIEVDALRCIGAGICAGVAPGHFALTDGLSQPLTDEPDDAVRDAADSCPMEAITVSD. 67
791 4.000e-10UniRef50_UPI0009EA66D5 ferredoxin n=2 Tax=Rhodococcus sp. SC4 TaxID=1793160 RepID=UPI0009EA66D5  ali  29  47....................VEINEETCNGYGNCVVAAPEVFDLDPDTNIHPADNDDEALEEAEADCPVRAIALHRK 109
792 4.000e-10UniRef50_A0A239C5J6 Ferredoxin n=1 Tax=Desulfovibrio mexicanus TaxID=147047 RepID=A0A239C5J6_9DELT  ali  21  4...................TVTINEDECIGCETCCELAPAVFQFDADKVVNPTGAPADEIQAAIDACPAGCIAWE.. 63