current user: public

If you have questions about the server, please let us know.

Query: [W] KOG3658 Tumor necrosis factor-alpha-converting enzyme (TACE/ADAM17) and related metalloproteases, from VFDB

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650    .  660    .  670    .  680    .  690    .  700    .  710    .  720    .  730    .  740    .  750    .  760    .  770    .  780    .  790    .  800    .  810    .  820    .  830    .  840    .  850    .  860    .  870    .  880    .  890    .  900    .  910    .  920
# E-value Template Links and tools%idFirst MSSPIRNRLQLVVTLIFCLFFENVNGLNNFIDNFETLNYRATHVANQVTRRKRSIDSAASHYQEPIGFRFNAYNRTFHVQLHPIDDSLFHEDHMSDVDGGYADIKPSHFLYEGYLKDDPNSHVHGSVFDGVFEGHIQTGEGRRYSIDKAAKYFERDDRPTQYHSIIYRDDEINHRKWRVKRDAENLSEQMQGCGFSSRVRREMTDVQNSGESTDFFTNYMTMGGRSKRANTLRDHDGLYFVRTCSLYMQADHKLYEHIRMKEGNNDPIRTREEIVSLFYNHIKAVNEIYEGTNFNGIKGLHFVIQRTSIYTPDSCDRGRAKTDSDNPFCEENVDVSNFLNLNSQRNHSAFCLAYALTFRDFVGGTLGLAWVASPQFNTAGGICQVHQRYNEGSRGWVYRSLNTGIVTLVNYGNRVPARVSQLTLAHEIGHNFGSPHDFPAECQPGLPDGNFIMFASATSGDKPNNGKFSPCSVKNISAVLAVVLKSMPVDPTRNASPVGIGKRNCFQERTSAFCGNQIYEPGEECDCGFSQADCDQMGDKCCVPHEARGNGGPGPCKRKPGAQCSPSQGYCCNPDTCSLHGKNEEKICRQESECSNLQTCDGRNAQCPVSPPKHDGIPCQDSTKVCSSGQCNGSVCAMFGLEDCFLTEGKADELCFLACIKDGKCTSSVHLPEFSANRTNFLQNMRKDKPGLILHPGSPCNNYKGYCDIFRKCRSVDANGPLARLKNLLFNKRTIETLTQWAQDNWWVVGVGGLVFLVIMALFVKCCAVHTPSTNPNKPPALNIYQTLTRPGTLIRQHRQRHRAAAGSVPPGPGAQPRSGAASAPSRTTPSARPSAPPLVAPQVAVAVPPGVVGPPIPLIATHPGSSSSTPAVIVLEPPPPYTAADPGSAMGGPRRGHRKNKRQTSSDAAGSSGNGGKKKGKLast
1 0.000e+00UniRef50_A0A2A3EUT1 Disintegrin and metalloproteinase domain-containing protein n=2 Tax=Apis cerana TaxID=7461 RepID=A0A2A3EUT1_APICC  ali  45  53......................................................................................................................................................................................................................................................................................................GRPDNISFMIKRVKVHSEDAL------RDPNYRF-PGNYGVEKYLELFSEEDYDAFCLAYMFTYRDFEMGTLGLAWTGDL--KNAGGVCEKNGHYR-----GSMKSLNTGIVTLLNYGKHVPPAVSHVTLAHEIGHNFGSPHD-PEQCTPGGEDGNFIMFARATSGDKRNNNRFSPCSLSAINPVLNSKARS---------------PKGCFTEPQVSLCGNGVIEEGEECDCGWEED----CRDSCCFPQRRYPPPGETPCTLTPGSICSPSQGPCCTAE-CNLRF---GDKCRDDNGCRDASFCDGRSAYCPPSINKPNKTIC-NREFVCFMGECTGSICLAYGLESCQCIPGPNDKACELCCRVPGENQPCLSSFDWNSP--------PYDIPDMFSKPGTPCNDYNGYCDVFQKCREVDPSGPLATLRKLLLSDESLATFR....................................................................................................................................................................................... 453
2 0.000e+00UniRef50_A0A182RL45 Uncharacterized protein n=4 Tax=Diptera TaxID=7147 RepID=A0A182RL45_ANOFN  ali  16  130.....................................FPQRGYDGSYSGSGGGRGRSRTGKHFHRTSLLIKAFNHKFRLDLELNTQLLAPNIVQKHYLPSGSHREIEHCYYHGTVKDYPGASAAFHTCNGV-SGVIHVGN-ETFVIHP----FYGGDLSQKHPHVIFEARTKS---------------------NKGCANSGNLEWRTRSIRRGSSHHAGLVELIDRNGAGRYRRDVRETTKYIETALIIDKAMFQKNGSTRTEVVHDAIQVANIADLVRYGGVCQGIIKHTNLTSALHLNTRVSVVYIETWQGQNQAQIDGGKDISKAISNFNDYTSRNLYK----IDKDTTQLLTGETFAGGEVGMSVPETVCTPKAVGISVDMNPYE--------------------------PHLLAGTMAHMIGHNIGMGHDDNRDECICRDWHGCIMSQSIVGLENVQPYKFSECSRLDYIDALRIGHGLCLLNKPNEVEL-------------RKNCGNGIVEDDEECDCGSALDCD--KTDPCC---------DGITCKLKKESQCA--TGPCC--DKCILKPPGVICRDAH-NECDLPEYCNGESGQCPPDVHKKNGNPCGMNTGYCFNGVCPT------QAAQCERIWGYSGTGADRVCYEQFNSKGSINGHCGKDSNGNYIKCEPENIQCGSLQCGTPCGDN--LICVNQTCVSIFPYCPTNHNNLECSGNGDCTNNNKCFCKFGWTGPDC.......................................................................................................................................................................... 831
3 0.000e+00UniRef50_L5M1K5 Disintegrin and metalloproteinase domain-containing protein 20 n=58 Tax=Eutheria TaxID=9347 RepID=L5M1K5_MYODS  ali  18  14.......LLLLWFGVSLSNCGHSQAKPSQRFSR-EVVIPLKVTSRDQ-----------DAKAPGWLSYSLRFGGQRHIVRMRVKKFLVSRHLPVFTYTDEDQPFVPDDCYYHGYVQGVPGSLVALSTCSGGFQGMLQINDLAYEIEPIRHS--------------------TTFEHLVCKIDSDGTQFPPMRCGLTEEKIARQLELQELPKSTLMQSSY---------------VNWWTHLRFLELAIVVDYFRYLYSGR---------NVSAVQRELLNVVSMINLLYRPFK------LNVILTGVEVWNQRNLVPTD-----DMDQLLDDFGLWKFVNLDGRLHHDVVHLFI----KKFFGIKLGIAYTSGVCRKP--------------------------FNTGVDVFLDHNVNSFALTVIHELGHNMGMQHDTA---WCVCGFKWCVMAAMKQLTI-----KFSNCSYAQYWDTTIRT-GSCIYTPPSPGNIFRL-----------RYCGNLVVEGGEECDCGSVK---QCEQDPCCLLN----------CTLSPGSACAF--GLCCK--DCKLMPPGTLCR-QQISECDLPEWCNGTSHQCPEDGYVQDGIPCGDN-AYCYEKSCNSHD------KQCRAIFGEDARSASQECYKEINSQGSRFGHCGLIDKG-YRKCDTADIFCGRVQCGAVCGPGK--ICVHQKCVDMTLVS-QDCQSENCHMRGVCNNKQHCHCSQGWAPPNCTLKGDGGSIDSGP............................................................................................................................................................. 674
4 0.000e+00UniRef50_A0A1S4G1N7 Uncharacterized protein n=6 Tax=Stegomyia TaxID=53541 RepID=A0A1S4G1N7_AEDAE  ali  15  70......................................................VEHTRFGSDAILTYNLTTMDSTSTVRVDLRRSLPSRTFVERHRNESIVEYFNDECFYQGWVHGRAGSLVALSTCEGKVRGTVYDIDETY-------YIDYDEVSGEHYMERIYDSPD-----------------------------------------------SNRVKRSHHRPRMTGPYNANRYSRYVELVLVVDNSLYRYFNSDIW---------TVHRYCTDVVNHVNMLFNQL------NIFIALTGVVVWDQ----HDHIHVSDRADDTLNNFLQYRRKELLLSHPNDHAQ---LLTAVNFQDHVIGKAKLGGMCTSNNSG--------------------------AVIVIHTDNIGIQAGTLAHEMGHSFNMEHDVDGECEC--GDRKCIMSATVTGRSL---KHWSSCSVEQLTLAFNRGLSHCLKDRPEVVYSMS--------------CGNGFVDEGEECDCGLEEV----CDNQCC---------DAKICRLKEGAACA--TGECCNLETCQLKEAASVCRMAH-GECDLPEYCTGKSEHCPRDVHKRNTEICAGGQAYCSDGECKARD------DQCRLLWGPSGKAADVNCYSRNVNGTKYANCGYDRDSHSWRKCAEEDVQCGLLFCGAPCGENK--MCYQQQCWDIDSLGVGQPCPHNCHNRGVCNSQGNCHCHSGYAPPFCEFSGIDGSIDSGPAXXXXXXXXXXXXXXXXXXXXXXXXXXRTFCRPDRCRTPLQINSFPSSSRSKHKLIATPSSNSAVVREISAPKLCSSTRDMDGPQYTPIARLKHHQHDGNREPPTKNSTVSVRSIAQPSPPPASPRRLPQRLPSSVHR--SSYERRRHGSGESSSNR 858
5 0.000e+00UniRef50_A0A091NGQ1 Disintegrin and metalloproteinase domain-containing protein 9 (Fragment) n=6 Tax=Neognathae TaxID=8825 RepID=A0A091NGQ1_9PASS  ali  18  50.........................................................................................................................................................................................................................HAEENLHPSMTQLLRRKRAVLHQTRYVELFIVVDKEKFEEFGK---------SETEVREHMVQLANFLDSMY------IMLNIRIVLVGLEIWKYENI----ISTDGGAGDVLANFVQWREKNLVLRRRHDSAQFVLKKGF----GGTAGMAYVGTVCSKSHAGGI--------------------------NVFGRISIQMFASIMAHELGHNLGMNHDDERDCHCGASS--CIMS-----SGASGSRNFSSCSAEDFEKLTLNKGGSCLLNVPRPDETY-----------SVPYCGNRLVDAGEECDCGSPKE---CESDPCCEPG---------TCKLRSGAECAY--GDCCK--NCQLLPGGTECR-ASNNECDLPEYCNGTSQFCQPDFTVQNGHPCHNQEAYCYNGVCQYYD------AQCQDIFGSKAKAAPKICFDEVNSKGDRFGNCGFHGHD-YKKCSSWNAMCGKLQCGTKCGNGK--ICRHFQCVSASVLNYDCDVEKQCHGHGVCNNNRNCHCEAGWAPPYCNTRGYGGSVDSGPPDKDTSLR..................................................................................................................................................... 558
6 0.000e+00UniRef50_UPI000906FEE5 disintegrin and metalloproteinase domain-containing protein 26A-like isoform X1 n=5 Tax=Crocodylia TaxID=1294634 RepID=UPI0009  ali  17  61...........................................................EGWQDEVSYQVSVAGQRRVLHLLRKRTFIARPFPVFTYGARGYPFTRDDCYYHGYVEDVAESLVALSTCAG-LRGLLR--------IEGRSYGIEPVEGSPAFQHIVFRLAEGRAATRHCGVAG--------------------------------EAWRLSPAAGRASGAQRRPSPIWLQARYIEVFVVVDREQYVFLGRNET---------SVKRKVFDALNAVDTVYR------ALNLRVVLMGVEIWTDNNRVQ----VVGDMSEVLADFSTWRGTHLRPRVAHDVAHLFVYQSY----GEVLGLAYVGSACD-------------------------SMGRPTGVETMANLPASYFAPLVAHEMGHNLGMRHDVAG---CVCNHMYCIMNPTIQET-----PLFSNCSRMHYAELLLDRKGDCLLNLPAED-----------LLFTGKDCGNKVVDKGEPCDCGLPEE---CRSDPCCK----------AGCKLKPGAACAG--GLCC--RGCQLLRQGTVCRESS-NKCDVAEYCEGNSTRCPEDVHLPDGAPCGKGSR-CYRGSCFDKDML------CVRIFGRGARAAPPACFHAVNVHGDRFGNCGNARGPRYRRCAPEDVMCGRLQCGTPCGDKK--VCMNRTCVGLLADQGACHPQRDCNGNGVCNSKGNCHCHVGWAPPDCLQPGSGGSVDSGPVRRERRPCSAHETGPPSLVPETLSDGWPKRPLLTRDPGREACFFVNWPCLQLLPLLAATPSVAKLSLRHKAARQSRSGRRQKVNAVMDGAVGRQCCAIHGPGLSKXXXXXXXXXXXXXXXXXXXXXXQAYRGAAGRHHSHKPGRVARQPPAASAQG. 840
7 0.000e+00UniRef50_UPI0003F0C5A9 disintegrin and metalloproteinase domain-containing protein 10-like n=1 Tax=Saccoglossus kowalevskii TaxID=10224 RepID=UPI0003  ali  33  1....MARLVLLVVSIISATVVTETRRLSNSISHYEPLDYNQRDLHEKHDRARRSADG-------ELELQFNALERDFHLRLRRATSIFAEDFTIETSEDGVSDFDTSHI-YTGFLQGEPSSHCHGSIHNGTFEGSIRSGSDEYFIEPAHRYYKEH---HPDFHSVIYMGKDVQLT-----------------------SEHRDPSGCSMSAELFTKMQKIQNDFQDKKKYIKDRTRRNSDQTTCPLFIQTDHTFYEKYGSY----------KEVVSAIASALDAVNYIYGNTVFGSYTNIGFLVKRIRVYTTSDIAL------PQYNFANEYIGVEKYLDLASSDNFDEYCLSYAFCARDFTNGILGLAWIGYASDLQGGGICDQYREY----INQGWRSLNTGVVTTVNYGFPVPPLLFHLTFAHELGHSFGSPHDYPSECRPGGVAGNYIMYSKSSDGLHVNNNEFSECSIGNMTLVLDAKKNRC------------------FTSPDFAICGNGIVEGTEECDCGYEYE----CEDKCCEPRK-AAVSDSNACKLSPGVECSLSDGPCCDPDTCRPMAIGEVCR............................................................................................................................................................................................................................................................................................................................................... 509
8 0.000e+00UniRef50_H9JMS7 Uncharacterized protein n=1 Tax=Bombyx mori TaxID=7091 RepID=H9JMS7_BOMMO  ali  17  21.......................................................................................ITDDHVLRYQKDGPTIEDIDLCQYSGTVRGKPDSRVAVSTCHGV-RGIIYDGDRLRYIEPAEGGDIQSQHYMYDHTDLHTNYNCGYHGGVTNNSNYDPELYHKYQKG-----------------EELSRTRVARYKRSTDDNQVREPFNANTLSRYVELVLVVDNKEFK---------ANHGNLRAVYQQIKDVANIINSVYAPL------NIFIALVGVEVWTERD----EIQLEEDGDETLKHFLHYRRTTLLREVPNDNA---HLLTRQAFKDGVVGKALKGPICTYEFSGGVAT--------------------------NHSEVLGLVATTIAHEMGHNFGIEHDT--EEHCECPDEKCIMSPSSTS---VIPVRWSSCSLKSLALSFERGMDYCLRNKPR-------------RLFQSPTCGNGFIEPGEQCDCGMTPDRSG--------RSDCHRCCHPTTCMLRANATC--GAGTCCDLQTCRPKSAGTVCR-RSEKECDLPEYCTGQSEFCPDDVYKMDTIPCNHGQAYCVKGSCRSH------TDQCRLLWGVTGESSHDKCYMSANVTRMNGNCGYIRPAQRYVPCAYEDARCGLLQC--RHLNEKLFINNNGTCRTADVDPGLVPDGAACGEHKVTG-----HCEAGFAPPLCALPGPGGSVDSGPA............................................................................................................................................................ 635
9 0.000e+00UniRef50_H9GUF9 Uncharacterized protein n=18 Tax=Toxicofera TaxID=1329911 RepID=H9GUF9_ANOCA  ali  17  3........LLLILWNVLNEMESQTPPQGFRYASYEVTIPRKVMPRY------------GQQEALEVTYHLQIEGRGHMVHLRQKKSFAPKNIPVLTYSKQGEPFIRNNCFYQGYIKGKLSSLAAISTCSGGLRGLFQLENNTYEIEP--------VQASPNFQHVVYRLEEKEGD-------------VKMKCGVTEEEQNHQESMMPNTENELTKSNSR--------------SDWWAHTRYVKVAIVIEHERYLKFDKNET---------VIGIQVLDIVHIADAFYEPLS------VKVSVAGLEIWTEKNLIYIADSI----MKTFNSFAIWRRNSLSKRLENDAA---HLFVYKYF-GRTLGLAPIGTICDKTGASAVASYVDY--------------------------TLLYFSVTFAHELGHILGMRHDGIY---CRCNRRSCIMDEF-----HSNSDMFSNCS---YSDYFKLRNTDCLLIPPDHDKIY-----------KVKYCGNRIVENGEQCDCGS---KADCETDRCCQSN----------CRLRSGAICAF--GLCC--AKCQYAPAQSICRDNT-SICDLPEYCNGTSEWCPKDVYVQDGAPCDEN-AYCYNGNCTTHV------RQCKMIFGKKATVASESCFRNLNAEGDRFGNCG-LNQGTYTRCHSDNILCGRIQCGTPCGMDR--MCIDRQCLDVSLLKYDCNVTE-CHNRGICNTQKHCHCDYGWDPPNCENKGYGGSIDSGP............................................................................................................................................................. 661
10 0.000e+00UniRef50_UPI000767C485 LOW QUALITY PROTEIN: disintegrin and metalloproteinase domain-containing protein 11 n=1 Tax=Dufourea novaeangliae TaxID=178035  ali  17  70.................................YQIIFPVQLRHHEKMGISTRDVGENTGRHYHRTSLLIKAFNHRFRLDLELNTQLLAPNLKQKDFLASGSKQEIEHCYYHGTVKDYPGASAAFHTCNGV-SGVIHLGN-ETFVIHPFYGGDLSKHPHIIFE------------------ARTKANKGCANTGNLDHGERRQKNRRQ-----------KHVLGLSETTSDRYKRDVRDTTKYIETAIIIDKAMFERRN--------GSTRAEVVHDAIQVANIADLYFRMLN--------TRVSVIYIETWQGRNQADI-FKEDIGRALTNLNAYTMRSMF----HVTHDTIQLLTGETFKGGESGMAVPSTVCKQNAVGISVDLDPYE--------------------------PHLLAGTMAHMIGHNIGMSHDDGRSECVCRDWHGCIMAQSIVGLDNIQPYKFSECSKTDYIASLQAWSGMCLLNKPNE-------------VEVRRTCGNKILDDGEQCDCGSHEEC--YELDPCC---------DPITCKLKSEAECA--TGPCC--SDCKLLSRGVTCREAT-NECDLPEVCTGESGHCPVDMYKKNGNSCSKTDGYCFNGVCSALD------LQCDQIWGFGAMGADVHCFXRFNSKGTFSGHCGMDVSGHYIKCEPENVRCGSLQCGTSCGDN--LVCINQTCTSLFPQCPSNHNNNECSSNGVCTNTNKCYCNPGWTGPDC.......................................................................................................................................................................... 753
11 0.000e+00UniRef50_F1NZB2 Uncharacterized protein n=41 Tax=Aves TaxID=8782 RepID=F1NZB2_CHICK  ali  18  38....................................................RQLSPRADTNPLTVSYWLQVEGRPQVLRLRPRKGLASRPFTLVTYDEDGQVYVQDNCFYQGEVQGSPGSLVALGTCGRGLRGVLWM-EGSTYEIEP-------IPDDPAFQHMLYRMEADSDP-------------MGPTCGLTPEELQYQKTVLPWLQAPRTEDKYM-------------LKDWWTHTRY---------VKLVVVVDNVRFVRSDRNESKVLRQVLEVVNIGDSLYDQLS------VQLFLVGLEIWTNSN----PINITKSASKTLADFNRWRKSDLYPRMQHDTAHLFAFQGF----GKSLGLAYLGSICDRQWSAAVDSYT--------------------------NRRLSSFIVTFVHELGHNLGMRHD---ERHCKCRRKRCIMYESESDTDA-----FSDCSYKDYFDLLGRG-GSCLYQAPALGSYYTL---------KHEYCGNKIVESGEQCDCGS---KSDCRRDPCCHPN----------CTLTAGSVCA--SGKCCKG--CQILPAGTLCRART-GDCDLPEYCNGTSPWCQEDLYVQDGTPCEDG-AYCYKGKCSSHS------KQCKHLFGRQARPAPLECFKEVNTRGDRFGNCGSRNNIRFTKCSVENALCGRLQCGTTCGSNK--ICIERTCTNISVLNYDCNI-TKCHNRGVCNNLKNCHCKYGWAPPYCEQEGFGGSVDSGP............................................................................................................................................................. 670
12 0.000e+00UniRef50_U3IEL0 Uncharacterized protein n=2 Tax=Archosauria TaxID=8492 RepID=U3IEL0_ANAPL  ali  16  1.................................................................LSYVLAIEGRPYTIHLQQ-QFFLPDDFRIYTYNEKGSLYYDSNCFYRGYIEGVPGSAVTLSTCSG-LRGLLQFENASYGIEPLVN--------SPAFEHFIYHMSNVRHILNYQQLRLF------------------------------LRSGDESGMWKASLYFLKGKEAVHRSPRYLEMHVVLDKALYDYMGADK---------DAVTAKIVQLFSYVNSMFSRL------NLTIALSSLELWTEKNKIPT----MGDAEELLQRFLQWKNIHRVLRLQ----DITFLFVYRE-QSPSVGASSAKKLCLKNHAGGVALYRSA-------------------------MTLEAFSVVVAQLLGLSLGMVYDDPRSCHCAGAA--CIMQPSAVHS--AGTKAFSSCSIRDFQRFLATGEGQCLLNRPTMDVSY-----------KAPVCGNKVVEPGEACDCGSAEE---CRRDLCCT----------VGCKRRKGVQC--LSGPCCW--KCKFAKSSTLCRTSSEDECELKEYCNGTSGECTANQWVMDGHPCSRNTAFCYRGACQTAD------KQCQDIFGKGAKNGPLACYEEINGQRDRMGHCG-SNHSGYQSCAWKDLQCGKLICGTVCGDHK--ICMNQKCVSAAVLNYDCDIKKKCNNHGVCNNKGTCHCHAGWKPPNC.......................................................................................................................................................................... 606
13 0.000e+00UniRef50_A0A2C9JQ25 Uncharacterized protein n=1 Tax=Biomphalaria glabrata TaxID=6526 RepID=A0A2C9JQ25_BIOGL  ali  14  54.....................................HHDCLVTLFHNGHIINTTLVDGVQHLENVTVQFVAFGHHFVVDLNQNKQLFTETYVEKLVHSNGQTSESENCYYHGKLRFHSTSEAALSTCHG-LTGYITNKYETYHIEPLNGRIHR----------------------------------------VYRNQDQKKLSLRCGTEGHDSRLHSHQTVVKRHKRSIELPYDSNINTRYVELYLVNDYRTFERHGK---------KTDIIIKRSQDIANIVSSLYRQLNIYVVLV----------GVEVWVGGDQVSVTVSADNTMENFLRYRKERINPYHHNDNAQLI---TGIFFEHGVVGKAIKGPICTHQYSGG--------------------------VNMDYGGVVTLVATTVAHEMGHNFGMEHDNDTMCECRDD--KCIMAATS---GQISPKRWSSCSQNALAEAFDLGMDYCLRNLPTS-------------VYGGPICGNGLKEDGEDCDCGLKQDCANRCCN-------------ATSCKMFSAAQCA--SGMCCDFDSCKVKEASTMCR-APTGECDLGEFCDGVSENCPADVFVQNGVSCKHGQSYCYNGQCNTH------TEQCKLLWGDSGRVSDPICFQQLNMNGNNDGNCGFNWTTKYKRCDKENVMCGLLHCGAKCEQDK--ICINQQCVPLAKLN-IEQCADNCHGHGLCNSKGNCHCHSGYGPPFCDRPGYGGSIDSGPASNEYQTSKKXXXXXXXXXXXXXXXXXXXXXXXXXXRKQLEKWWQQIPSLKYRVGNKKPKCKSSSDSSSSIRKEFSTASRDRENLIFNPQGAHTTESKTKVWNSHTSHSPAALPPERPKQPPSVLKPS............................. 840
14 0.000e+00UniRef50_K7G246 Uncharacterized protein n=5 Tax=Cryptodira TaxID=8464 RepID=K7G246_PELSI  ali  20  10...................................................................FQLQLGGRRLVAQLWRKDLLLASHLPVFTYERGGQPFIPAHCYYEGYVEGAPESLVVLSTCSGGLRGLLRI-EGTSYGIEPVK-------ASSTFQHLLYQMREV--------------EGRPASCGVTAEELQHLETKTQDMAP-----------------TRVAGRRKWTHATYIEFCVVVEKEQFILHRRNESY---------LTSQVLEVINMVDSFYR------AMGAHVVLVGLEIWTENNLITLPN----DIGNALTEFNQWRTDVLYRRLQHDAGQLFMAKTYR----GRAGRAYVGGICLVTDAA--------------------------SVVTWRFASVPFFSVTVAHELGHNLGMYHDYAK--CHCKRTVGCIMAAVHVTTD-----EFSDCSHEVYYNLLRDGAGFCLYNIPAPS-----------KTFMMQHCGNKVVERKEECDCGSELE---CKKDPCCQS----------TCKLKPHAVCAF--GKCCK--KCQILAKGKLCRAAVD-ECDLPEYCNGTSELCQDDVHVQDGTPCR-DMGYCYHGRCRNH------NKQCADIFGRGAQKAPLSCFSNLNTRGDRFGNCGGETGANYKRCKTNDVLCGRIQCGTFCGNGK--ICLNRTCASVSNLNFDCDAKKKCNSRGVCTSTKNCHCKYGWAPPDCKLPGYGGSIDSGPA............................................................................................................................................................ 623
15 0.000e+00UniRef50_UPI0007AD810F disintegrin and metalloproteinase domain-containing protein 15 n=18 Tax=Archelosauria TaxID=1329799 RepID=UPI0007AD810F  ali  15  26..................CAGDSSPQHSEELGHSWSVTPWVLRD----NRTLSLAEATQGGFPARLAVLLELEGTRLLLDLEQNWELVQGTGVLLYYLPDGTRVIQEHCCYQGTVQGFPGSWANLCACTG-LSGCLWLSDTRSYTLEPDTSSPPGPHVASHLRVRLEPRSCGQGPH--------------------------------------------PGAEATEPLWPQRGKRAAAEQRFVELVMVVDHAAFQNY----------PSLQRVRTRSLEIASQVDVFLRPL------GVRVALLAVEVWSEGDK----IAVGSSARAVLERFLRWRREELLPQLPHDNAQ---LLTGAHFDDVSVGMATQGSVCSPTRSGGVS--------------------------MDHSVSVLVVASTVAHQLGHNLGMRHDGTGRVCDCGDDRSCIMAP---PTGLTPGLSFSNCSQQDLEHSLQQGQGWCLSNIPEPQLLTG-----------SPTCGNHLVELGEECDCGLSVE----CTDPCCNSSS---------CQLMPGAACA-TQDTCCQ--DCQLRRAGHVCR-ELLGECDLPEFCDGVSRHCPPDTFLQDGQPCAGGRARCYGGACATYE------EQCQQLLGPGASPVSSSCMAALNARGDERGHCGQLPNGSYVTCAQQDISCGMLQCGTTCGPGK--MCLQHRCQDISILG-DQECQSKCHGHGVCNNHGHCHCERGWAPPTCDSPGVGGSQDSGPAGLERGGSALPTAVAHTPLHACAVTHSAETRARFLGPGAADGWSGISQPEPRSGSNQGPPARPRPPQWRQA...................................................................................... 742
16 0.000e+00UniRef50_UPI000B3D190E uncharacterized protein LOC101738149 n=1 Tax=Bombyx mori TaxID=7091 RepID=UPI000B3D190E  ali  16  15......VVLCMVLLFTFAVIQDVGAQQLKTPAS-DFRRHRIVLPTVHHPRTKRELTTTRDTHHRELRMSLPVDEEEYLLELNLNEDLITDDHVLRYQKDGPTIEDIDLCQYSGTVRGKPDSRVAVSTCHGV-RGIIYDGDRLRYIEPAEGGDIQSQHYMYDHTDLHTNYNCGYHGGVTNNSNYDPELYHKYQKG-----------------EELSRTRVARYKRSTDDNQVREPFNANTLSRYVELVLVVDNKEFK---------ANHGNLRAVYQQIKDVANIINSVYAPL------NIFIALVGVEVWTERD----EIQLEEDGDETLKHFLHYRRTTLLREVPNDNA---HLLTRQAFKDGVVGKALKGPICTYEFSGGVAT--------------------------NHSEVLGLVATTIAHEMGHNFGIEHDT--EEHCECPDEKCIMSPSSTS---VIPVRWSSCSLKSLALSFERGMDYCLRNKPR-------------RLFQSPTCGNGFIEPGEQCDCGMTPDRSG--------RSDCHRCCHPTTCMLRANATC--GAGTCCDLQTCRPKSAGTVCR-RSEKECDLPEYCTGQSEFCPDDVYKMDTIPCNHGQAYCVKGSCRSH------TDQCRLLWGVTGESSHDKCYMSANVTRMNGNCGYIRPAQRYVPCAYEDARCGLLQCGAACGEHK--MCLKQRCVSVEVNKHSSICPSNCSGHGVCNSEVQ...................................................................................................................................................................................... 724
17 0.000e+00UniRef50_A0A1S3H064 disintegrin and metalloproteinase domain-containing protein 10 n=1 Tax=Lingula unguis TaxID=7574 RepID=A0A1S3H064_LINUN  ali  29  32.......................................................ENKRLNEFQVIRLEVKVFEKTYFLRLVINHRIFSGLTVVKIADKQDIRQLKLNKFYHGFVEGDATSWAYGRLHDGMFDGSFIYKGEQVYIEKASKYILNVSKEHSK-DYIVYKASDISYDNSHVRLHGVHVPRTRFSF--------------------------------STYTKIQKSKRSTGTENTCSLHLVADHTFFQNIGKGD--------ATTTINEMVYHVTEVDKLFRGSDFNGDGNIGIAIGEITIYGDKDAVAYKLADTSTDVFT--------YLYSFSEYNFDNFCGGVVFTHRDFADGVLGLAWIASSKYGSAGGICQQ---SMFMGPDNKMYNFNTAMVSFLNFGQVSPRKVSVLTLAHELGHNFGSEHDNDSLCSPGDPGGNYLMYPTANDGQKPNHWLFSQCSKDYINPVLQNKAS-------------------CFIANPGPVCGNGIVEDGEECDCGSA--SYCAETDPCCTPPGGLGYDTGCTIRKSAGYSCSPLVSECCTTS-CVVVPLENHQLCQQATDCTESSYCDGVGANCPEPQHEADGTLCNQAEKTCVSGQCIGTICSGLGLEECQCV-GSDSLLCRLCCYNSSEPQSC---HPAENYHTPSTKIRYRD-------PGKGCNNYTGYCDRKHKCIEVDFNAALKRLSE-VFSPKTSEIVKEWFTN.................................................................................................................................................................................. 643
18 0.000e+00UniRef50_V3ZLC7 Uncharacterized protein n=1 Tax=Lottia gigantea TaxID=225164 RepID=V3ZLC7_LOTGI  ali  32  28.............ICIVVLHLKQGRGLNDDISYYEPLSYYTDDVLHDHNRAKRDL-------FHTVRLNINAFGRSFNIRLKPNKGVLSDD--IEVSTSNEDYHYDGSGIYKGYIANEDHSIVHGIINSGHFDGKIWTPFDQFIIGPSLKYYENEQ----PFHSIIYRLSDITFNQTNIDNKSIRDLLKFK---------ARLNVQDMSVVSDNHNTRHINHNIQYFHQHTRRRRAVLQPKTTCELYVKADNYFYNAHGN---------SPDLVINEIVQFVQTINTIFSPIDFDRDGNIKFTIKKIKLYT--------NASDPDYARYVGNMDVVKFLESHSEENYDDYCLSYILTHRDFGEGVLGLAWTASQDENQVGGVCEKYK-----VVNGKSQSLNTGIVTTLNYGQTVPSLVSHLTLAHEIGHNMGSDHDPDNTCTPSGTGGNYIMYPKATSGKQTNNQFFSTCSINYMSPIITSRG---------------TGLNGCFTADSGSICGNKVIDEGEECDCGWEDECQEYCCNARG--------GSGTPCTLKSNATCSTSAN---------------------------------YNAECPEPQSLPNKTVC-DGSRVCMNGECTGSICLAYDYEPCQCSPTKDEVLCAVCCIVNEKCTSSF---------------EVSFMPNLTMVPGSPCYDNEGYCDVFSRCREVDPSGFYNDLSKWL................................................................................................................................................................................................. 637
19 0.000e+00UniRef50_A0A151MW51 Disintegrin and metalloproteinase domain-containing protein 26A-like n=6 Tax=Alligator mississippiensis TaxID=8496 RepID=A0A151MW  ali  18  145........................................................NTAAGASDEVSYQVSVAGQRRVLHLLRKRTFIARPFPVFTYGARGYPFTRDDCYYHGYVEDVAESLVALSTCAG-LRGLLR--------IEGRSYGIEPVEGSPAFQHIVFRLAEGRAATRHCGVAG--------------------------------EAWRLSPAAGRASGAQRRPSPIWLQARYIEVFVVVDREQYVFLGRNET---------SVKRKVFDALNAVDTVYR------ALNLRVVLMGVEIWTDNNRVQ----VVGDMSEVLADFSTWRGTHLRPRVAHDVAHLFVYQSY----GEVLGLAYVGSACD-------------------------SMGRPTGVETMANLPASYFAPLVAHEMGHNLGMRHDVAG---CVCNHMYCIMNPTIQET-----PLFSNCSRMHYAELLLDRKGDCLLNLPAED-----------LLFTGKDCGNKVVDKGEPCDCGLPEE---CRSDPCCK----------AGCKLKPGAACAG--GLCC--RGCQLLRQGTVCRESS-NKCDVAEYCEGNSTRCPEDVHLPDGAPCGKGSR-CYRGSCFDKDML------CVRIFGRGARAAPPACFHAVNVHGDRFGNCGNARGPRYRRCAPEDVMCGRLQCGTPCGDKK--VCMNRTCVGLLADQGACHPQRDCNGNGVCNSKGNCHCHVGWAPPDCLQPGSGGSVDSGPVRRALTP...................................................................................................................................................... 775
20 0.000e+00UniRef50_UPI00094E7D9F zinc metalloproteinase-disintegrin-like EoMP06 n=2 Tax=Holometabola TaxID=33392 RepID=UPI00094E7D9F  ali  16  41.....................................RHSVIRPRMYHGRYGRHLPDTRGRHQQHIVVAMELGGAEAWLDLTLNQRLLAKGFFHRRQVNGSRVVEINHCHYVGKVRGRPESWAALSTCHG-LQGVVFDGRELHYVE------------KGGPHHLLYAHSDLREHNKTCGYRGAAAGPAHAHSSTDNRIL-------------------RYKRSSDSATVIRGPYNANRDSKYLELVLVVDNREFKELGENQRRVVDHCKTIANXXXXXXXXXXXXXXXXXXXXXS-------------------EHDEIIFSLNGDTTLANFLHYRKNKLLLEHPNDNAQLLTKF---NFEQGVVGKALKGPMCTFEYSGG--------------------------VNNDHSPVVGLVATTIAHEMGHNFGMEHDTVD---CQCPEERCIMAPSSST---VAPTHWSSCSLNYLLLAFTHGMDYCLKNKPE-------------FLFDSPVCGNGFVEPGEQCDCGMSQ----HCENPCCDS---------ATCMLHANASCA--TGECCDLSTCKPKGAGTECRSAQY-ECDLPEYCTGQSEFCPPDIFKMDTERCDEGRAFCYHGFCRTR------TDQCKLLWGDTGKSSDDQCYDMNTKGSRHGNCGYNKFNESFAKCDRESVLCGMLHCGAKCGDGK--MCVNQRCRDVLSLRKQSHCDKDCHGNGWCNSLGHCHCKDGFAPPLCEYPGPGGSEDSGPA............................................................................................................................................................ 706
21 0.000e+00UniRef50_L5KDA6 A disintegrin and metalloproteinase with thrombospondin motif 20 n=5 Tax=Laurasiatheria TaxID=314145 RepID=L5KDA6_PTEAL  ali  14  10....LLYQLSLFITRSWVQFHPRQEALVRTLVSYEVVTPARVNPQSHHFSRRKRSSETLEPTPFRTHYRISAYGQLFQLNLTADAAFLAAGYTEVHLGGSAAPPDLRHCFYRGQVNAREDHTAVFSLC-GGLMGTFKAHDGEYFLEPIMKADGSEHEDDHNKPHLIYRQELKRNYFLHSHKLCDLSESQIKKTPLPFHNYSNMNEDLNIKTAIVLGYPSKNASENERSQLHSRKKRFLSYPRYVEVMVTADAKMVHHHG------------QNLQHYVLTLMSIVAAIYKDSSIGNLINIVI-VKLIVIHNEQEGPVISF----NAATTLRNFCLWQQTQNVLDDAHSHHDTAVLITREDICGDTLGLAELGTLCDPLRSCSISE-----------------------------ENGLSAAFTIAHELGHVFNVPHDDSFKCKETGIKHQYVMAPTLN--YHTSPWTWSKCSQKYITEFLDTGHGECLLDKPHGRIYDLSSQLPGLMYDVNKQCELMFGPGSQVC-PYLKQCRRLWCTSAEGVHKGCRTQHMPLADGTNCGPGMHCHHGLCVNKEMETRPVDGEWGPWGPYSSCSRTCGGGIKSTTRLCNRPEP-----RNGGKYCVGRRMKFRSCNTDS-----CPKGKQDFREKQCSDFDGKHFNINGLSPNVRWLPKYSGIAIKDRCKLYCRDGTPCGTETNDICVQGLCRQAGCDHVLNSKRDKC---GVC........................................................................................................................................................................................... 717
22 0.000e+00UniRef50_UPI000B93910C disintegrin and metalloproteinase domain-containing protein 9 n=2 Tax=Macrosiphini TaxID=33386 RepID=UPI000B93910C  ali  14  16....VLVFILLTLVHIQCVCCGMTDQIDNQFNNYAFIEPKLFNARHKREIQSTKINPNGLEHAHGITLIFVDKQQEYIIDLSLNRGLIPVHYFEKHQKNGAHVNELEFCNYNGKIRDLPNSWAAISTCDG-IRGMFFDGISYHYIE-------NVELKSGDKYHILYKHENLRTNYTCGFPSTTE------------------------FTSNEIKYKKRNTRSLKSLKPLKGPYNQNDKSRFIELVIVVDQEEYKSFNSELPKVYQHTKDIANXXXXXXXXXXXXXXXXXXXXXTEYN-------------------EITLVSNGDTTLTNFLSYRREHLVKDHPNDNAQ---LLTKVQFENGIVGKALKGPICTYEFSGG--------------------------VNSDHSFVQGLVATTIAHEIGHNLGMEHDTPE---CDCPNERCVMAPSSGSLS---PTHWSSCSMEYLALAFEHGMDYCLRNKP-------------ARLFESPECGNNFVEDGEQCDCG----VKDMCTNPCCNPD---------TCMFYENATCA--TGQCCDLNTCHFKFAGVECR-SASHECDLPEYCTGDSEYCPDNVFKFDGSTCEKNQAFCFNGSCRTH------ADQCRLLWGPTGESSAKECYQMNNRGSPQGNCGYNRLNKSYVKCAQDNVQCGMLQCGAKCGENK--MCVKQKCMAVDFRAINNNCGNDCNGNGVCNSKGNCHCKTGYAPPYCDHPGPGGSDDSGPASSPNTFKGXXXXXXXXXXXXXXXXXXXXXXXXCSKNHRSPSDWNKANRKKLSNDSEVGNKPNGTVSPSSTLLIDNQKPPTLHPLVPNEHPVVSRTPIRPAPSAPASVAVTRLQISQPVLDATTSSAVHKLVSVPSKPAPPVPTAARPASMMAVDNK 885
23 0.000e+00UniRef50_UPI000975119F disintegrin and metalloproteinase domain-containing protein 10-like n=1 Tax=Crassostrea gigas TaxID=29159 RepID=UPI000975119F  ali  30  1MKSTLTGSCYHVILIITVIYDVIGSPIKHILHDYQPVYYDHNILKQQHERMRRSL-------INTMDFEFGTHNRQFKVRLKRDNHVFHPD--VIIESSHGPLEMDTSFLYTGVLQGE-RSRVFGIVNEGHFQGQIQTEGVTYFVEPSSLYFKQPQE----FHSIIYTNDDVNFNTSSFCNADGIRQ-------------SVMNKIPLDDRHKESDQWKHRYSFDANLPAHRQKRAIVPAKTVCTLYMQADHTFYQKYGS---------NVDTVVAQLGAYVQAANDIFRPIDFDSDDNIAFLVKRLKVYTDPNAAGYKFNGH---------YSVEKFLDLHSTNNYDDYCLSYMFADRDFDGGVLGLAWVASL--SKAGGVCEIYRSYS-----GESKSLNTGIVTVKNYGAEVASVVTQVTFAHEIGHNFGSEHDTDGTCAPGGSDGNYIMYAHATSGNLPNNNKFSSCSINQMAPIIENK---------------CRTSTGCFIEPVGYVCGNKIVEPDEDCDCGWDEECTETCCNKAGTSNECKYTGSTSGF-------CSPSEGPCCGAD-CQKKTSGV---CRGNTSCLATAEC--EYPFCGERERENDGTLVFYDNKFVPLQECSASVCLAKGYLSCQCP-GSGWKDANLC-----------RLCCLVNDTCSFAGDIP-DLTEAKAFTGAPCNNFKGYCDVFHVCREVDPTGPLSNIRKLLLSGDIINTVKKF..................................................................................................................................................................................... 656
24 0.000e+00UniRef50_M7BQI2 Putative ATP-dependent RNA helicase DHX36 n=1 Tax=Chelonia mydas TaxID=8469 RepID=M7BQI2_CHEMY  ali  18  809............................................................................YHLKMRTSSQFLAGHLPVFTYERGEQPFIPSHCYYEGYVEGAPESLVVLSTCSGGLRGLLHI-EGTSYGIEPIK-------ASSTCQHLLYRMGDVKGTPASCGVTTEELQHQGTKIQVTG-------------------------------PAVAGGRHRWTHATYIEFCVVVEKEQFILFRR---------NESLLTSQVLEVINMVDSFYR------ALGAHVILVGLEIWTENNLITLPDT----IGNALPEFNRWRNDVLYRRLQHDAGQLFMAKIYR----GRAGRAYVGGICLVTDAASIVTWRF--------------------------ASVPFFSVTVAHELGHNLGMYHDYDK--CLCNRTVGCIMAAVHVTTDQ-----FSDCSREVYFNLLREGAGFCLYNIPAPS-----------KIFRMKRCGNKVVEGEEECDCGSELE---CKKDLCCQSM----------CKLKPGMACAF--GKCCK--KCQILAEGKLCRAAVD-ECDLPEYCNGTSKWCQDNVYVQDGTPCS-DMGYCYRGSCHNH------KKQCADIFGRGAQKAPLSCFSNLNTRGDRFGNCGGGETGNYKKCKISDVLCGRIQCGTFCGNGK--ICLNRTCASVPNLNFDCDAKKKCNSRGVCTNTKNCHCNYGWAPPDCKFPGYGGSIDSGP............................................................................................................................................................. 1416
25 0.000e+00UniRef50_Q9BZ11-2 Isoform 2 of Disintegrin and metalloproteinase domain-containing protein 33 n=36 Tax=Boreoeutheria TaxID=1437010 RepID=Q9BZ11-2  ali  18  83..................................................................................KNHRLLAPGYIETHYGPDGQPVHTDHCHYQGRVRGFPDSWVVLCTCSGM-SGLITLSRNASYYLRP---WPPRGSKDFSTHEIFRMEQLLTWKGTCGHRDPGNKAGMTSLPG---------------------------------GPQSRGRREARRTRKYLELYIVADHTLF---------LTRHRNLNHTKQRLLEVANYVDQLLRTLD------IQVALTGLEVWTERDRSR----VTQDANATLWAFLQWRRGLWAQR----PHDSAQLLTGRAFQGATVGLAPVEGMCRAESSGGVST--------------------------DHSELPIGAAATMAHEIGHSLGLSHDPDGCCVEAAESGGCVMAAAT---GHPFPRVFSACSRRQLRAFFRKGGGACLSNAPDPGLPVPP-----------ALCGNGFVEAGEECDCGPGQECRDLCC-------------FAHNCSLRPGAQCA--HGDCCV--RCLLKPAGALCR-QAMGDCDLPEFCTGTSSHCPPDVYLLDGSPCARGSGYCWDGACPTLE------QQCQQLWGPGSHPAPEACFQVVNSAGDAHGNCGQDSEGHFLPCAGRDALCGKLQCGKPSLLAPHMVPVDST-VHLDGQEVTCRPGTQCGPRMVCNSNHNCHCAPGWAPPFCDKPGFGGSMDSGPVQAEN----------HDXXXXXXXXXXXXXXXXXXXXXXCCYRLPGAHLQRCSWGCRRDPACSGPKDGPHR----DHPLGGVHPMELGPTATGQPWPLDPENSHEPSSHPEKPLPAVSPDPQADQVQMPRS.......................... 784
26 0.000e+00UniRef50_F5HJ69 A disintegrin and metallopeptidase domain 9 (meltrin gamma) n=16 Tax=Anopheles TaxID=44484 RepID=F5HJ69_ANOGA  ali  16  95..................................................SRHTGNPRRGPHRERLTIQYGMQGETMTLDLTLNENIIPEEYTFVHQSPEGQRQSVELCHYEGTVRERPGSRVAISTCSGSIDGVIYERNETYLIE--------------------YHNNTHLLYRRRYKRDVQDNELANEEAGGSRPRNNQQPAFSTGYREDADSL-------------------------FVELVLVVDRTLFLKF---------SSNVQRVHQHCLSVVNVLNELYRPL------NIYILLVGVVLWNTRD----NIVISTDSKQTLTSFLAYRRERLLRQIPNDNA---HLLTAVRFPDGVIGKAELGSMCSAAGSGGIA--------------------------VVENFVVTPLATTVAHELGHNFNVDHDTEECSGSRCPGGPCIMEAKLSDSTDIPN-RWSDCSVEDFRLSLKRGLAACLKNKPS-------------RLLVRAVCGNGLLEPGEQCDCG----RRDRCDNGCC---------DARTCQLRANATCA--TGSCCDLATCQPKRAGSVCREAG-GECDLPEYCDGASELCPKDVFVRDTSPCGSGDAYCYRGECNTRD------RQCRRLWGPTARSGLEVCYEANVNGTVFGNCGNDAQGDGYEPCAVHDMHCGLLHCTTICNCGAGRMCFGQQCVAISEQDIGDECPADCNGRGVCNSEGHCHCEPGFAPPFCDGPGDGGSIDSGPA............................................................................................................................................................ 747
27 0.000e+00UniRef50_UPI00093F48D4 disintegrin and metalloproteinase domain-containing protein 20-like n=3 Tax=Sauria TaxID=32561 RepID=UPI00093F48D4  ali  18  72....................................................RQLAPRRGKKLREISYLLQLQGRGRVLRLQQKDAFVPQHFTLFTYGAGGQPFLQNDCFYQGYVQGSPTSMVVLSTCSGGLRGLLQLL--------GSTYGLEPVPGSTTFQHLLYWLEEGMSVP-------------GMRCGLTKEELQHQEALIPGFNV-------------SSTVRQAAREDWWTHTRYAKVAIVVDHERFVHSNHNET---------KVIREVLDIVNMADSLYAPL------GVRVQPLGLEIWTQNNL----ITISDYMNATLDNFNKWRRRVLRQRLPHDAG---HLFVHKNF-GFTLGLAYLSQVCVNY--------------------------WASGVESFTTSNLFSFTLTFAHELGHNLGMPHD---KQYCTCNRSGCIMYE-----YHVITNAFSNCSYNAYYN-LMMTRAYCLQEAAAPEAVYTLN-----------YCGNRVVETGEECDCGSD---LACGRDPCCEPN----------CTLSASAACAF--GGCCQ--DCQILLAGTLCRERTD-ECDLPEYCNGTSQWCPKNVYVQDGAPCQHG-AYCYHGNCSTHD------KLCKSIFGSEASVAEQGCFNELNARGDRFGNCGMIGANTYMKCRVEDTLCGRIQCGTPCDKDK--ICFNRRCIRVSVLHYDCNLTR-CHNRGICNSERHCHCEYGWAPPYCQNKGLGGSIDSGP............................................................................................................................................................. 702
28 0.000e+00UniRef50_M7BEC5 Zinc metalloproteinase-disintegrin VLAIP-A n=1 Tax=Chelonia mydas TaxID=8469 RepID=M7BEC5_CHEMY  ali  19  22..................HRSGTARRQLPGVKDYEVVYPQKLHRLHKRDVAGNQNPNHGAKYDDRMQYEIKVNGEKVILHLEKNKDLFAKDYSETHYSDEGSPQIKDHCFYDGHIQDDNDSEASISACSG-LKGYFK-SQGQRYLIQPLKLTDSEEHAVFKYESL-------------------EDAEGPKTCGVTNTTWESEDPIK----------------KSSRSSTSLEKQEYLKAKKYVEVYIVVDNAAYRKYNR---------NMTSIRTRVFEIINYINMVYK------AINIYVALIGLEIWS----AGDPFTVDSSAGTTLDKFSAWRQSDLLKRKNNDNAQLLTALLNIDFDGPTVGLAFVGTMCSSTHS--------------------------SGIVQDHNSNPISIGATMAHEMGHNFGMNHDTS---FCKCNSGSCIMAAQL---SYNIPKDFTACSLQDFQKYLLNRTPMCITNMPALKDIV-----------ATPVCGNNFVEKGEECDCGTPEE----CTNICCE---------AATCKLKPNAKC--GFGECC--ENCQIKKAGTLCRP-IKHDCDLPELCTGQSHQCPVDRFRVNGYPCRDGQGYCYMGKCPT------LQSQCIALWGSGATVAVDSCYKTNQNGVYYGHC--KKANGTFIPCAKKCV......................................................................................................................................................................................................................................... 615
29 0.000e+00UniRef50_A0A226P5U7 Uncharacterized protein n=11 Tax=Neognathae TaxID=8825 RepID=A0A226P5U7_COLVI  ali  18  24......................................PRPLRVTGTWVTVPRQLGLRTDTNPLTVSYWLEVEGQPQVLRLRPRKGLVSQPFTLVTYGEDGHVYVQDNCFYQGEVQGSPGSLVALGTCGRGLRGVLWM-EGSTYEIEP-------IPDDPAFQHTLYRMEADSDP-------------VGPTCGLTPEELQYQKSVLPWLQAPQTEEKYM-------------LKDWWTHTRY---------VKLVVVVDNVRFVRSGRNEAEVLRQVLEVVNIGDSLYDQLS------VQLFLVGLEIWTKSNL----INITSSINKALGDFNKWRRSDLYPRMRHDVAHLFAFQSF----GKSLGLAFLGSICDRQWSA--------------------------AVDSFTNRRLSSFIVTFVHELGHNLGMRHD---ELHCKCRRKRCIMFESEADTDA-----FSDCSYKDYFDLLGVG-GSCLRQSPALGSYYTL---------KREYCGNKIVESGEQCDCGS---KSDCRHDPCCNPN----------CMLTAGSVCA--SGKCCKG--CQILPAGTLCRART-GDCDLPEYCNGTSPWCKPDLYVQDGTPCEDG-AYCYKGKCSSH------HKQCKRIFGKQARPAPADCFKEVNTRGDRFGNCGVRNNIHFTKCSDEDALCGRLQCGTMCGSDK--ICIKRTCTNISVLNYDCNV-TKCHNRGVCNNLKNCHCEYGWAPPYCEGEGFGGSIDSGP............................................................................................................................................................. 670
30 0.000e+00UniRef50_A0A2B4RN56 Disintegrin and metalloproteinase domain-containing protein 10 n=1 Tax=Stylophora pistillata TaxID=50429 RepID=A0A2B4RN56_STYPI :  ali  31  1MSPHFPLILFLLIPFGNECESKKGRRLNKFIKHYEPLYYDTIHLHNIHRRVERSTHGK---------FSFSAFGKFHRLNLQPDREIFTADAKILSGDGKPIPFERDS-VVRGKVEGRPYSDVYGVISDDGFHGKILSGSENYYVDPSSWYFDEKQD----FPSVMYKEEDVEYEHDFA-------------------------DIKHRAPTVEVPERTRRSLEEQDRSRSRRQSESELEKSACTLSLYADNFFTKLYGGKTKAIFQLVKQVQAAQIIYMNFNGTDYFYQK-------GITFRVRTIVAFNDSEKAPNNLP----SQVKDSNVGIDTLLDLFSSIDHSGVCEAFLFTDRDFEGGILGLAWMGDPKGNAAGGICDYFVDY----GVGKKRSYNTGVVTFKLYGRFTPPRVSEITFAHELGHGFGSQHDPDTECAPGKPEGNFIMFDKATSGIEPNNDRFSPCSKNSIKE---------------NVNLKRARKETCFIKPTEAICGNKIVEGTEECDCGDK----NTCTEDCCTPASADSKEQPDQCKLRRDSNCSPSQGPCCSKD-CKY--EGPSVVCSVTNGCTKNTLCSGFSFSCDPPEPLTNGTLCDNGRRLCYSGQCSTSVCHRYNLV--ECSCEVEEELCDLCCKE----------VGGACTSAKRLTQMATELQSLKLVPGTPCDNLNGYCDVYAICRRIDMEGPLLRLKQKF................................................................................................................................................................................................. 650
31 0.000e+00UniRef50_UPI000B9074C4 disintegrin and metalloproteinase domain-containing protein 12-like n=1 Tax=Folsomia candida TaxID=158441 RepID=UPI000B9074C4  ali  16  275....................................VFPQVHRTWRHVPVENSAHPNWRDGHLEKLRLELPLNEHHTVLHLTLNRGLLSSGYFEKFQKSGNYVVEAELCHYQGVVEGRPTSQVAISTCHGGIRGVIFDEDELHHLEPVVADNKLQPGSSHSWDMIHY-------------------------KGIDFRGRLSPVYATLNPSTSPKNVSTSPSRIKRLASASSKSNFPPGNPRYVELVMVVDFATHRHLGGDEK---------ASVQRCKDVVNIVNALYKPF------NIYVALVGVVVWNEKD----EIPISPDGDETLSQFLLYRREHLVKDHPNDNVQ---LLTGVELQDGQIGKAMLSTMCTYKYSGGVSSDRGIN-------------------------LVGTVATRVAHMIGHNFGLSHD-QKDCDCPAEDEKCIMDPSASPISTS---HWSSCSIMEMANAFEHGIDHCLRNKPTS-------------LYNGPTCGNGVTEPGEECDCGLPE----YCDNPCCE---------ASTCLFAENATCA--SGSCCDTLTCSVKTGGTPCR-KTNGRCDLPEFCTGTSEFCPEDVKILDGLECENGKAFCYSGECRTH------TDQCKLLWGPSGNKSSDLCYQRNSNGSRLAHCGYDQVTKTYAKCATENSKCGILHCGASCGPGK--MCVSQKCVESKVMGVLGDLGGDCSGHGVCDSNGLCHCDDGY............................................................................................................................................................................... 937
32 0.000e+00UniRef50_A0A091D1R2 Disintegrin and metalloproteinase domain-containing protein 15 n=1 Tax=Fukomys damarensis TaxID=885580 RepID=A0A091D1R2_FUKDA  ali  17  562.........................................................APTSLPEALRVTLELDGENHILELLRDRALVPGYTTAVWYQPSGTRVVSDNCCYQGRVHGYVGSWVSLCACSG-IRGLVVLAPERSYALEL-------GPGDPQGPSLVFRIQDFLRPDHTCALSWIV----------------------------PLPTQAPPELPRGQQHSHRRKRDVITETKVIELVIVADHS----------EVRRFPSFQHLINRTLEAAYLLDSFFQPL------NVRVALVGLEAWTQRDLVDI----SPDPAVTLDNFLRWRRADLLPRLPHDSAQLV---TDTSFSGPTVGMAVQNSICSPDFSGG--------------------------VNMDHSTSILGVASSIAHELGHSLGLGHRPAGSSCPCAPAKSCIMEAST---DFLPGLNFSNCSRQALEKALLEGMGSCLF------------ERLPGLPSMDSSCGNMFVDPGEQCDCGFSDD----CTDPCCDHD---------TCQLRPGAQCA-SDGPCC--ENCQLRPAGWRCRP-TRGDCDLPEFCLGNSSQCPPDISLGDGEPCAGGQAVCMHGRCAS------YAQQCQSLWGPGAQPATPLCLHTANTRGNAYGSCGRGPDGSYVPCAPSDAICGQLQCGSVQNGTQFNCSWAHLDLGSDVAQPLLALSTTCGPGLVCDSNQHCHCEEGWAPPDCVTPL--------RATXXXXXXXXXXXXXXXXXXXXXXXXXXRASLHQRFCQLKGSSCQYSAAQSSPPEQPGPPQRAQLMPGTKQALSFPAPPSRPLPPDPVPKRLQAELADRPNPPTRPLPADPAVRRPKLPGPGAAAMPL............................. 1293
33 0.000e+00UniRef50_A0A068XGF7 Disintegrin and metalloproteinase n=1 Tax=Hymenolepis microstoma TaxID=85433 RepID=A0A068XGF7_HYMMI  ali  35  6......TLCLLLITLSPLSFSERHHIFP--IGEYEALNYPTLEP-PLLSRSKRSLDQRPT------SFSFTAFGQNFSLALFRDEGVISPTATISVGGQTFPLSTDDNQAYRGYIKSHPKSLVYGSVLNGIFRGTIAFNADVYFVEPAGNYLSNPKFHSVIYREIIEPIFCGHSNPEISQRLKEMSQPALARKPRSVDGIRSQRNHPSHPYSHDVHGQPGQQQGNQMRPQSARPNNSGLTLRVCNLYLQSDTFLWDHIKLPHIRFNRDLAIKEITSIFTQHVQGAQAIYQYTNFKDASGVGFRVDRVLINTEEDCHPLPHNYTHENPFCSENVDVTNFLNLNSYANHDDFCLAYVFTYRDFAGGTLGLAWVAEL--GGSGGVCEKHRLMREGSH-TVKKSLNTGVVTLLNYGSRVSMKISQLTFAHEMGHNLGAKHDDDFKCLPSDPKGNYIMFASATGGDKENNNKFSMCSVNSIARLLHQ---------------VLKGESNCFFSSNGSFCGNRLTEEGEQCDCGFTRED---CDDVCCYPKDSKEPCKLKKFANTGNASCSPTAGECCT-SSCQYRDSKHLCR--SAGECHKASYCSGGSAQCPSPENIPDGTPCMNHTRICKGGECLGSVCERIGWTECSLSRGEPEMMCYVACRNIRNCISTIQLETDEDLRKAYLAAELLQQPGGRLQPGTPCDNYRGYCDVFFVCRSVEVEGPLARLHKLLFSPQMLSKVKTWITDE................................................................................................................................................................................. 848
34 0.000e+00UniRef50_Q400M8 Meltrin, isoform D n=9 Tax=Acalyptratae TaxID=43741 RepID=Q400M8_DROME  ali  15  47..................................EFSTYTVIRPQVEHGRTKRSLDATDGLHTPQISLSYTHEGKRVVVDLQRNDLLLPNSHFLRYQNASRTKTEVDLCHYQGHIRGKPESVVALSTCDGALDG-IVIDGRQTYFIHPHIDGRGRLQDDHYLLKQADMHPTNATCGYDNHRDDHSHDYEKADGDNGLGGGIPSLPLRLDGGEFSRTLLRKRRQADDSSQLIRGPYNANKYSSYVELVIVVDNKVYKNFQENTKKVHQYCKGIANXXXXXXXXXXXXXXXXXXXXXNESN-------------------EIEFSSDGDLTLRNFLNYRSTKLVLDHPNDNAQ---LLTKENFAGGVVGKALKGPICTYEYSGGVS--------------------------MQHSPNPAMVATTMAHEMGHNFGMEHDTSD---CHCRDEKCVMAASSTSFIPVN---WSSCSIDQLTIAFSRGMNYCLRNKPE-------------RLFESPTCGNGFVEPGEQCDCGLPEHCENACCN-------------AQTCMLHSNATCA--TGECCDLTTCRPKLAGSACR-EAENECDLPEYCTGESEYCPADVFRRDTEPCDGGQAYCFHGTCRSHS------NQCRTLWGPTGDNSE-HCYNKNTEGTRLGNCGYNRLNKTFLRCEEQHVNCGMLHCGAKCGVDK--MCVDQRCLPVDAVGMGKPCPEDCNGNGICNSRGHCHCDVGFGGESCSKAGSGGS-----------PDSGPATDPNGSVGFKXXXXXXXXXXXXXXXXXXXXXXCYKNGMLTRGKLADNMYVSTSSFSIGSKEDTSPDSSISTTLAHKQTPARTAPPPLPLHTNRQLSGIVTNTAPATITNIHAILPRHKSNPDVVHQLNIPPPSVPKSH....... 892
35 0.000e+00UniRef50_A0A139WB52 Disintegrin and metalloproteinase domain-containing protein 12-like Protein n=7 Tax=Pancrustacea TaxID=197562 RepID=A0A139WB52_TR  ali  16  37..................................DFSRHTLVKPRIYHGREKRQISTSKDEHLDHLTISLPIDGEDFLLDLTLNRQLIPKGFFRKVQQNGTHPEEVDLCHYGGKVRNKPGSWVALSTCDG-LSGVVFDGEEMHYVE----------NKDGDLHYLYKHADLVEGNKTCGYAGDAVDPQK----------------------SHNHNRILRYKRAAEQNSAVRGPYNANKKSKYVELVLVVDNREYKELGESTSKVEHHCKTIANXXXXXXXXXXXXXX-------------------XXXXXXXTEHDEISFSPNGDTTLTSFLHYRRNKLVKEHPNDNAQ---LLTKYNFDNGVVGKALKGPICTYEYSGG--------------------------VNTDHSPVVGLVATTVAHEMGHNFGMEHDTNE---CTCPDDRCIMAPSSST---VAPTHWSSCSLNYLLLAFTHGMDYCLKNKPTA-------------LFDSPVCGNGFVEPGEQCDCGLPE----HCDNTCCN---------ATTCMLHTNASCA--TGECCDLTTCKPKSAGTLCR-SADYECDLPEYCTGHSEYCPADIYKMDAEMCDGGKAFCYHGFCRTR------TDQCKLLWGETGKSSDDQCYKMNIKGNRHGNCGYDKFNKSFFKCNDENVLCGMLHCGAKCGEGK--MCVNQKCMSVSLQLAGKTCPHNCNNNGWCNNLGHCHCKDGYAPPFCEDPGPGGSEDSGPA............................................................................................................................................................ 705
36 0.000e+00UniRef50_A0A1W2WEG3 disintegrin and metalloproteinase domain-containing protein 12 isoform X1 n=5 Tax=Ciona TaxID=7718 RepID=A0A1W2WEG3_CIOIN  ali  16  1MELLKLVFICFVLVFFVGSSSSFASTLLTRLKQYTIVIPHQAEDKHARL-KKRDLSTEPGIHSKQTYFSFKFENQTYILELKLNEELLPKDFSTSIHTDDGQVQERNHCYYQGHVVNMEGSHVIMSTCDG-LRGCIALSDDFLLIEPLS--------PHSTQHVVYRPKDQTLNEVGTCGNQDMGHAVVNVDSFAGMLRQNEQ---------------------------HRQKREATTEKKFLELLIVADKAQAAKY-----------SRVDLDNRIKELVNYINGFYKKLK------IHVVLSHIEVWKTQDKIPLK----TNAQEVLNEFLSYRQRKISSEPPNSYWDNAQLLYGGSFEGSTIGMASVKTMCTSRSGG---------------------------VNQDHQTNVFYTATTLAHEMGHNFGMHHDSASCVCPPGA--QCLMASSS---GSSFKKDWSSCSKEYLAQSITEGLGNCLLNVPDPSRLYG-----------GPKCGNDIIEMGEDCDCGGVDECLSQCCN-------------ATTCKLISGASCD--TGPCC--FGCQYSPAGQICRDTNNNICDLAEYCTGTSANCPGNVYRQNGSPCNGNQAACAQGVCLTHD------LQCQGIWGEGAVSGNDICYERVNKLGNWNGNCG-RGTSGFIICTKENSKCGKLQCGTRCGDGK--ICNDGKC----DDLPPMACDATCNGHGVCNNLGNCHCNRGWAPPFCSSEGNGGSVNSGP............................................................................................................................................................. 700
37 0.000e+00UniRef50_A0A1L8H2C8 Uncharacterized protein n=1 Tax=Xenopus laevis TaxID=8355 RepID=A0A1L8H2C8_XENLA  ali  15  19...........ICLISAICTLIQGIEQTSFLSSYNIIIPQKVA------RARRDTSGSSGE--NSLSYAIEVEGKKHVLHLEKNRDFIARDFAVYTYAENGSIQDKEHCHYQGYAEGVPESVVAISTCSG-LRGMLHLQN--------SSYGIEPLDNSDRFQHLVYRMEDVKSEPM------------------------------VCGVKAADKEPETELNPPSMTQLLRRKRAILPQTRYVELFIVVDKERFDML---------SRNESAVRAEMVQLSNYLDSMY------TMLNIRIVLVGLMIWTDSNK----ITIDGTAGDVLGRFVQWRETNLVSLRRHDSAQLVLKKGF----GGTAGMAFVGTVCSRSHAGGI--------------------------NVFSHYNVQSFASIVAHELGHNLGMNHDDGRNCFCSVD--NCIMN-----SGATGSKNFSSCSEEDFEKLTLNKGGTCLLNVPKPDEAY-----------SAPFCGNKLVDVGEECDCGNPKE---------------------------------CEKDPCCEPGTCKLR----------------------SGAQC------AYGTCCQNCGSY---------------DAQCQAIFGSKAKSAPPICYQEVNSKGDRFGNCGFQGND-YRKCDTRNARCGKLQCGTKCDESK--VCSKFQCVDASVLQYDCDVQKKCGGNGVCNSNKNCHCNEGWAFPNCQTEGYGGSIDSGPTYNDKCRKKRSQAHEVDNKNDTGGERLASGTPRNAPSTAPGRGVPAGPPRNALNVPPNRGTPVTGPPRNMPNPAQSQRPSALGPPRNVPPAGPYRSMPATSPPHNTASPIDTWPKVGQMAIGHDKNPVGSRAHLSDRWAHDRSARYRPPQ....... 817
38 0.000e+00UniRef50_B0WZX0 Adam n=6 Tax=Culicinae TaxID=43817 RepID=B0WZX0_CULQU  ali  17  111........................................................SKPRGREQRLTISYRLDGENVTLDLWRNDEIVAPEGHFETRRKQLAEHELERCQYHGTVRGSISSSVALSTCDG-ISGIVYDTHDTYLIE------------------------------------------------FDSSEQSHYVQRNPDLLKKDRTKRALETFHEPHPEAFSTAFRSNRESNYVELVLVIDRALYL----------GNMNVQKVYNYCLDLVNIMNIIYRPL------NIYIVLVGVVIWTEQD----EIEMSSDSKKTLDNFLRYRRDTLLQSIPHDNAHLLVHFGDSSGDGVVVGKAELGSMCTFAGSGGVEVVDTKHVALQ--------------------------ASTVAHEMGHNFNMDHDGPE---CRCPGGNCVMAAKTVR-SQKAPSRWSSCSVEHLETGLQHGLGACLKNKP-------------AKMLVKSTCGNGLLEPGEECDCGLSEMCDTKCCD-------------ATTCRLTVNATCA--AGECCDLDSCQLKSAGSSCR-SAVGECDLPEHCNGQSPICPKDVYLRDTEPCAGGQAYCFKGRCRTRD------SQCKLLWGSTGRSFNDHCYQTNRNGTIFGNCGNNLLTGEYTKCNQEDIMCGLLHCDTVCNCGTGKMCWNQKCVHLKENDVGEECEGGCSDHGVCNSEGNCHCDEGFGGKFCKTAGLGGSVDSGP............................................................................................................................................................. 751
39 0.000e+00UniRef50_A0A2D0SNQ1 A disintegrin and metalloproteinase with thrombospondin motifs 6 n=19 Tax=Euteleostomi TaxID=117571 RepID=A0A2D0SNQ1_ICTPU  ali  15  1MEILWKTLTWILSLLLASLSYSSQEEFLSHLEDYQLTVPVRLNDQHRPGRRRRALDQTGPDAAERLFYRLSAYGKHFHLNLTLNPNLVSKHFTVEYWGRGGQHAVVDDCHYVGYLLDQYDTTVALSNCNG-LHGVITTEEEQYLIEPLSGNSSEFRLPGEGQPHVIYKKSSVPL---------RQEHSEELSCGVSDLTIKRTP----CWKSSHGPVAPPPSQNNHTSGSPQRQRRSISSERFVETLVVADKMMVGYHGR-----------KDIEHYILAVMNIVAKLYRDASLGNVVNIIVTRLIVLTEDQPNLEINHHADKSLDSFCKWQKSLLSHQGENGIAHHDNAVLITRCTYKNKPCGTLGLASVAGMCEPERSCSINEDI-----------------------------GLGSAFTIAHEIGHNFGMNHDGIGNCGTKGHETAKLMAAHITA--NTNPFSWSTCSKDYITSFLDSGRGTCLDNEPLKRDFLYPTVAPGQVYDADEQCRFQYGASSRQCKYG-EVCRELWCSNRCVTNSIPAAEGTLCQTGSIEKGWC--FQGECVAFGTWPHSVDGGWGPWTQWGECSRTCGGGVSSSMRHCDSPAPSG-----GGKYCLGERKRYRSCNTDA-----CPAASQDFREKQCADFDSMPFRGKYYSWKPYTGGGVKPCALNCLAEGYVIDGTRCQADSLDICINGECKHVGCDNILEDICRVCGGDGTCETIK....................................................................................................................................................................................... 722
40 0.000e+00UniRef50_A0A210Q909 Disintegrin and metalloproteinase domain-containing protein 10 n=1 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=A0A210Q909_MIZYE  ali  32  239.............MVFITESEQTALSLNDVIRYYEPVHFDSHTLLSDHHRVRRGTDEG-------LRLTFRAFNRDFRLKLRPNNHLFTSD--VVFESSTGSITYDTSGAYTGSDEDDTGSRIYGVITSGHFEGHLLYPN-ETYNIEAARRHFKK---DTNFSSVIYRSSDMSVNTRDMMCK-------------SDELHRKIMKHQILDEIDGQRHRPTEKWSDRYKSSNRQRRAIDPTKTVCELYLKADHTFFNK----------FVTHDAVLDQMTNHVQASNDIFSLIDFDGDGSITFQIKRVTIYNDPTATGYPFP---------LQYSVDSMLDLHSRENYTDYCLAILFTNRDFSNGVLGLAWTAQ--TGYAGGVCEGYRTYH-----GESKSLNTALVTMLNYGRDVSSAVSHATLAHEIGHNFGSQHDPETAGTCSGNGGNFIMFPMATSGYEVNNQKFSTCSVAYMAPILESRARD--------------ATNGCFKASGAPICGNNVIEAGEECDCGWEDT----CTETCCNPQAASPTATPCTKVNVSSSSCSPSEGPCCSPS-CTLYTSGENHICRANSSCLAEALCDGSSTSCPASTSAANGTQCAEG-QVCYLGECSGSVCIAHSLEACQCSPTKDEKLCQVCCTYNSVCTPTTNIPTIPTTNA---------------LAGSACNNYRGYCDVFYVCREVDPTGPLLALKKLLLDGEVFQTLK....................................................................................................................................................................................... 889
41 0.000e+00UniRef50_A0A158NRA3 Uncharacterized protein n=47 Tax=Pancrustacea TaxID=197562 RepID=A0A158NRA3_ATTCE  ali  25  6..........VLFIYCAFLTLQSICGLHKSLKYYETIH----STHFQHRILKRGIHHSYHPYNKISELEFYSHGRHFRLILTPRREVIHSNFKAYEVNADGTIHLDHDNFYHGRVFGEIESHAQMHIDDGIMTGSITILDETFHIEPSWRHLSHL----DNQTMIIYKSSDVKLSWEHYQDGEGHTHGTPKTCGYVKEDIN------YTLNDNSEEDDTETDNISNRVKRQTETYEYTPTKTRCPLLLVADYRFYQEMGASSTKT--------TINYLISLIDRVHKIYNDTLWDGFKGMGFVIKKIVVHSEPTRVRG---GETHYNMVREKWDVRTLLEVFSRESHKDFCLAHLFTDLKFEGGILGLAYVGSPRRNSVGGIC-----TPEYFKNGYTLYLNSGLSSSRNYGQRVITREADLVTAHEFGHNWGSEHDPDSECSPSASQGGYLMYTYSVSGYDVNNKRFSPCSLRSIRKVLQAKSGRC------------------FSEPEESFCGNLRVEGDEECDAGLLGTEDN---DSCCD----------KNCKLRSGAVCSDKNSPCCQG--CAYMPAGVKCRDAQYATCEQESRCTGASSECPRSPPMKDGTDCLERGQ-CRLGKCV-PYCETQNLQSCMC--DTIADACKRCCRMNLNET-----------------CFPIDQQDI-LPDGTPC--IQGFCNK-GVCEKT-IQDVVERFWDII-EDININKVMRFLKD.................................................................................................................................................................................. 664
42 0.000e+00UniRef50_A0A182YRH8 Uncharacterized protein n=2 Tax=Cellia TaxID=44534 RepID=A0A182YRH8_ANOST  ali  15  19......................................HDRIFPTFHCPRTKRALRSSSRPHRERLTIQYGMRGETMTLDLTLNENIIPDDYTFVHQSPEGRDIVVELCHYEGTVRERPGSRVAISTCNGAIDGVIYERNETYLIE---------------------------------------------YHNNTHLLYRRRFKRDILDNELQVEDTASGAAANNKTAFSTGYRE-NADSLFVELVLVVDRTLFLKF---------SSNVQRVHQHCLSVVNVLNELYRPL------NVYILLVGVVLWNTRDNIII----STDSKQTLTSFLAYRKDQLLRQIPNDNA---HLLTAVRFPDGVIGKAELGSMCSMAGSGGIA--------------------------VVENFVVTPLATTIAHELGHNFNIDHDTEECGGSRCPGGPCIMEAKLRDSADIPN-RWSTCSVDDLHESLKRGLGACLKNKPT-------------RLLVRAVCGNGLLEPGEQCDCG----RRDSCDNSCC---------DARTCQLRANATCA--TGACCDLATCQPKQAGSVCR-QARGECDLPEYCDGRGELCPADVYLRDTSPCRKGEAYCYRGECHTRD------SQCRRLWGPSARSGLEVCYEANVNGTIFGNCGNDLTTDRYEPCSTHDLHCGLLHCTTICNCGAGRMCFQQQCVAISDQDIGDDCPANCNGNGVCNSQGHCHCHPGFAPPFCDEPGDGGSIDSGPA............................................................................................................................................................ 702
43 0.000e+00UniRef50_G3NDP9 ADAM metallopeptidase domain 12 n=7 Tax=Euteleostomi TaxID=117571 RepID=G3NDP9_GASAC  ali  17  1...................................................................................SRGLFASNYTETHYLQDGSHNFTANCYYHGEVEGRVDSDVSLSTCAGVK--GFITLEGKSYVLEPSADHSDETHW-------IYTAEHLNFASGTCGHDFNISYPTDAAA-----------------------------SSPFRAFSTRHKRHVQTTTKYVELIIVADNREFQKQGKD---------MEKVKQRLAEIANYVDKFYR------ALNIRVALVGLEVWSDVDKCPI----TQDPFTTLHEFLDWRKVKLLPTKPHDNAQLI---SGVYFQGTTIGMAPIMSMCTAEQSGGIV--------------------------MDHSDNPIGAAVTLAHELGHNFGMNHDTPERGCGCRDRGGCIMTPST---GYPFPTVFSSCSKKDLTASFEKGVGMCLFNMPEVKVLYGGQK-----------CGNGYVEEG----EECDCGELEECMNPCC---------NASTCTLKGDAVCA--HGQCCQ--DCQLKPAGTPCRESSNS-CDLPEFCTGSSPHCPSNVYLHDGHACHNVDGYCYNGVCQTHE------QQCITLWGQGAKPAPGVCFQRVNSAGDPYGNCGKDSRGSFAKCEARDAKCGKIQCGTKCGD--GLMCLNRQCQNVSVFGVHACA-AKCSSRGVCNNNKNCHCEAHWAPPFCDKAGLGGSVDSGP............................................................................................................................................................. 612
44 0.000e+00UniRef50_A0A2I0LX56 ADAM metallopeptidase domain 8 n=11 Tax=Neognathae TaxID=8825 RepID=A0A2I0LX56_COLLI  ali  18  11.................................................RGKRDLSAAPSIYPDRVLYSVRAEGRDYLLRLEKNKELLGQHYTQTHYSADGTPDVQDHCFYQGHVRGYADSAASISTC-GGLSGFFRV-NETTFLLEPLEGHVAGQH---------------------AVYRAAHLRGKRGTCREAGAALEYDHEPKIPAAMKLYRWKSAPLHKG---------------PRYVELVLVVDNEEFRKHKDLRT----------VQNRMKEIVNHVDKLYQPL------HLRVALIGLEVWSHKDK----IVVSPNPEVTLDNFLHWRETELLRRKPHDNAQLI---TGIDFHGTTVGLAKKLVMCTRDSGG---------------------------VNQDHSANPIGAASTMAHEMGHNLGMSHDEDCRCPVPKADGGCVMAASV---GLVYPKLFSRCSEQDMW---------------------------------GPVCGNQFVERGEQCDCGTLEE----CSDRCC---------NATTCQLREGAECA--RGDCCQ--DCKVKAAGALCR-ASKNDCDLPEHCTGLSAECPEDVFQENGIPCQNGNGYCYNGACPSH------GEQCRALWGTEAQVAPDICFKHN---SEQHLHLHCLTEYGKRPCSPKDVKCGTLLCGAKCGEE--MVCYAGRCQNLLVYG-NKNCSAKCNNHGVCNHKRECHCEPGWAAPYCQQRISGMAAGMAAPC........................................................................................................................................................... 626
45 0.000e+00UniRef50_V9KDR3 Disintegrin and metalloproteinase domain-containing protein 12-like protein n=2 Tax=Callorhinchus milii TaxID=7868 RepID=V9KDR3_CALMI  ali  17  61..........................LRELHRYHGVIFPSIITRKQKWSMH----LLQQNGSAGELLVSVETEEKQLILELRRNEILISKGFQVSYYDSNGQSSDLSNCYYEGTVRGILGSRVAASTCVGLSALILLT--NQSYVIEHLEEDEQGRHLMYKPEQL-----------------------------------------KSKERRCSLRHSFPEVAKNSIEHSHRLKRSLSTEVKHIELVLVADNAE---------YRSAFHSKRKVINRLVNAANYVDLFYRPLS------IRIALIGVEVWT-----VDQIPVDTNALGILKRFLQWRKFNLLPRLYNDNAQLVMGNTYGNVTEQ---PAQFSSMCSSDYSGGIALDNTADS--------------------------LGIASNLAHEIGHNLGMGHDSPAPCVCADRKAGCIM---AEIQGLQPPQVFSSCSRDSLQRSLARGVGMCLFNLPDPELLVRGK------------CGNLYVDPGEECDCGKPEE----CTDPCCV---------AAICQLWPGAKCA-SNDVCCK--NCKFVKARRVCR-EPISECDFPEYCTGTSAHCPTNQYKKNFYPCDNGNAYCYNGACRT------LQSQCRDIWGPNATPSPLICYWYMNKLGNKFGNCGRKDDGSFVSCPIKDVKCGKLQCGTPCGSAK--VCFKGMCRNVRVFSV-NKCHAYCSGHGVCNNNDRCHCDPGWALPNCTLEGSG.................................................................................................................................................................... 707
46 0.000e+00UniRef50_A0A146NII2 Disintegrin and metalloproteinase domain-containing protein 28 n=2 Tax=Ovalentaria TaxID=1489908 RepID=A0A146NII2_FUNHE  ali  22  4.....TLLLWVLFLNASLKPSESHNPTFEVGKDYEVVRPVRL-----HALRKRSAEHLR---PESVKYAMTVGGKPLHLQLEKNNELLTQDYTETYYQEDGTPRDVDHCYYHGTIVNDSESSVSISTCDG-LRGYFRTS-AQRYLIEPLSGGDEGDHAVTP---------------------VNDKNFTPAVCGVTNTSWSDDMEPP-----------------TGRSRSRAGGISILQQEKYIELVLVADNRAFVKMNRDLT---------KTRRRIFEIVNFVNMAYKPLKTF------IALVGLEVWSNNDL----ISVTNPAGANLDAFMKWRNSDLVKRTKHDNA---HLISGIDFEGATVGLAFIGTLCSDHSVGVVQ---------------------------DHNDRAIAVGATLAHEMGHNLGMNHDDSSACACSGDS--CIMAAAL---SWNIPRTFSSCSTINYERYLTNRNPSCMFDKPDNKMIVAP-----------AVCGNGFLEEGEQCDCGSVQE----CTNPCCN---------ATTCTLSAGSQCA--EGECC--DNCKIQPRSKECRRKQD-DCDLAEYCDGKSATCPEDVFTVNGLPCNKGLGYCYNGQCPQRS------DQCIKLYGTTAVEAPQSC....................................................................................................................................................................................................................................................................... 525
47 0.000e+00UniRef50_UPI0007774645 disintegrin and metalloproteinase domain-containing protein 9-like n=2 Tax=Galliformes TaxID=8976 RepID=UPI0007774645  ali  17  29MALLFRLGVWVVLGALLLPEAGSHHPPPGYAVH-EIIRPRTL------------VTVAGKSALGEVSYIIRVEGKDRIVRLMQTQGLVVSNLPLITYSPSGQPHVPEGCYHLGYVEGSPGSMAALNTCAG-LRGQLKIGN--------LSYGIQPVPGSLTFQHLLYRREKNWNRFSTCGLTDIVMRKQPNWRGA------------------------------KKPLGKKRLDQRLQHTRYVEIYIVVDQQLFSF---------QERNETTVMFLVIDTINLAEIHYYSLK------VRICLIGLEIWTRGNL----IRDSPDIEEVLNNFNDWGNKHLSPRIKYD---IAHLFTYTDF-GLTVGLAYIGSICHP--------------------------GYRSALVSYIREDLATFAIIFTHVLGHNLGMEHD---RRECSCGNAKCYM----TGGSVDGATAFSNCSIQSYLDLLSSGDGNCLNNIPEPN-----------KFFTFKTCGNKVIDEGEQCDCGGIHD---CRGNPCCYHD----------CKLKPGAVCSV--GQCCQ--KCRFQPPGYMCRSEAE-ECDLPEYCNGTSEWCPSDLYLQDGTPCSDDG-YCYRGRCASLD------KQCRKVFGAEARVAPEGCFKQQNMKGDRFGNCGGDGNEVFVECRPQNALCGRLQCGTKCGPKH--ICINKICTNSTIL-AKCDANVLCNENGVCNNLGQCHCYPGWAPPGCEYHGLGGSLDSGP............................................................................................................................................................. 696
48 0.000e+00UniRef50_A0A1S3NPI1 zinc metalloproteinase-disintegrin-like brevilysin H2a n=30 Tax=Osteoglossocephalai TaxID=1489341 RepID=A0A1S3NPI1_SALSA  ali  18  6........ILWIFTLTASLNLSVSHGPLEGVSDYEVVRPIRL-----HSLQKRETQSSR---LETMKYAMRVGGKDIEMHLEKNGELLTNDYSETYYTEDGTPQDVDHCYYHGTIVNDSESTVSMSTCDG-LRGYFRTA-AQRYLIEPLSGGDDGDHAVLKYED---------------------QSSKPVVCGVTNTSWNAD-----------------YPPITSKSRSRASGPSLLQQQKYVELV---------XXXXXXXXXXXXXXXXXXXXXMFEVVNFVNMVYKPLNTF------IALVGLEVWSDNDK----ISVTAPAGATLDAFTKWRNSNLVNTKHHDNA---HLISGIDFEGSTVGLAFIGTLCSDHSVGIVQ---------------------------DHNPRAIAVGATLAHEMGHNLGMNHDDSSACACSGNS--CIM---AGALSWDIPKSFSSCSSVNYERFLNNRNPECLLDKPDYRN-----------VESTPVCGNGFLEIGEQCDCGSLEE----CTNPCCN---------ATSCILTKGSECA--AGACC--DNCKILSSSRECRMKHD-DCDLAEYCTGKSADCPEDVFTVNGIPCDGGRGYCNNGQCPQH------HDQCVKMYGPSAGNARTYCYEQNTRGLYYAYCR-RPSNDQYIPCQRQDVLCGKLFCGTKCNDGK--VCSQNECVDFEAYGPVTNCSALCKGHAVCNHKMECQCEPGWLLPGCDTKDESFTGLS----RXXXXXXXXXXXXXXXXXXXXXXXXXXKKRQQSSTLPSYHTQQKTYNNNRNNKLPIPSQNNAMPHQPKRPKGAPPPPPPAANQSQAPAHDFRAVRQALRPPPP.................................................... 765
49 0.000e+00UniRef50_A0A1W4YMH2 A disintegrin and metalloproteinase with thrombospondin motifs 9 n=2 Tax=Scleropages formosus TaxID=113540 RepID=A0A1W4YMH2_9TELE  ali  14  13...LLSCCLSAGAITRGAAMTEGQEKLFEQLGAYEIASPVRVNDSAHFKRRRRSLEAAADTESEHVHYKLSAFGQDFHLDLRPETAFIAPLYTVSVLGDLEEDTEFQHCFYKGHVNAKEEHTAVISLCSGLL-GTFRAPDGEFFVEPLHSYGGRHYEEEHNKPHLVYRKEAPSGDPPHKQSHRRHRNKARRRPGNMLADLDRLSASFSARPFDETENKQTAANGTGDSGPHRRSKRFVSYPRYVEVMVVADSKMVEHHGS------------NLQHYILTLMSIVSSIYKDPSIGNLINIVI-VKLVIINNELDGPIISF----NAQTTLKNFCIWQQTQNHPDNHHSHHDTAILITRQDICCDTLGLAELGTVCDPYRSCSISED-----------------------------NGLSTAFTIAHELGHVFNMPHDDSNKCKEDGKNQQHVMAPTLN--YYTNPWMWSKCSRKYITEFLDTGYGECLVDEPVSRPYSLPQQLPGRIYGVNKQCELIFG-PGMQVCPYMTQCRRLWCTSPDGAQKGCRTQHMPWADGTECFQGKHCKHGVCVLKEHDPTPVEGAWGVWSPFGMCSRTCGGGIKIAVRDCNRPVP-----RNGGKYCVGRRMRFRSCNSE-----PCSKQKKDFREEQCSAFDGRHFNINGLPPNVRWVPKYSGILMKDRCKLFCRDGTPCGPDTNDICVQGLCRQAGCDHVLNSKRDKC---GVC........................................................................................................................................................................................... 735
50 0.000e+00UniRef50_A0A0Q3M5U3 Disintegrin and metalloproteinase domain-containing protein 9-like protein n=110 Tax=Tetrapoda TaxID=32523 RepID=A0A0Q3M5U3_AMAAE  ali  16  4.HSLFLFIFGLTLTGKPCGIKGVFSEQTSRLSTLEIIIPRLT------GREKHHPFYHEEHSDDNLSYSVKTRNGTYLLKLKRNKKLVSEDFMLYTYGKNGQSKNETHCYYHGTVEGIADSVLALSTCDG-LRGILYIGG--------KWYGMEPLNTSSTFEHVFYQSEDMQDIPFQCG------------------VLNSSLXREEMLVKQAVKYTFVSNSTSSREXLLRMKRAVLPQKSYVELFVVVDNNRFLMKKSDP---------AAVQKETVELINYVDGMY------AALNIQIVLVGLEIWTDTNHISV---MEGSAGDVLSRFVSWRQKDLLKRSRNDVGHLII---GRSSYSGSIGMAFVGTVCSQVQGGSISTL--------------------------NHDNVLRHATVVAHELGHNLGMKHDDTRC------PASYIMHST-----DNGSRNFSTCSADDFENLILSGGGNCLRNPPKTXNVY-----------KEPVCGNNVVDSNEECDCGKPEE----CTNPCC---------DAATCKLTPGSQCA--QGLCCK--NCKFKVAGTECR-SKMDFCDLPEYCNGSDAYCPEDVYIMNGYPCSNMKAYCYYGVCQSFD------SQCESIYGKGARKAPDACFERANIKGDRFGNCGME-GGVYKKCPVQHSLCGKLQCGTACGEQKA--CLDFECVDASNLGYSCDVKQKCXDNGVCNNNGNCHCNSGWAPPFCNRSGYGGSIDSGPAHIDTSLRXXXXXXXXXXXXXXXXXRRKFCRKSRRQHRDNNVEQPKQNNTPSHNTRSNQPATSTP............................................................................................ 759
51 0.000e+00UniRef50_A0A267GP54 Uncharacterized protein n=4 Tax=Macrostomum lignano TaxID=282301 RepID=A0A267GP54_9PLAT  ali  35  40...........................TETVTDHDRLRYPPLDPPGRLHRARRSL----GHSADPVWLEFSAHGRHFVLKFSHNDGLVEPGATFQLGASGSPEPLDFPEAVVGELADDPGSHAFGSIIDGVFSGAVYTSDGSGWFVEPAGRYFLGRL---DFHSIIYNDSHVMWPKRH-------------------------RRSVIRHPPAVHPPLPPPFTADKSLLPDSGEVGQLGDTKVCSLYLQSDAALWEALRLPSVNGNHQRARTEIKALFQHHVSAATHIYTSTRFITRDGVQFRVNRIRVNTTADCGPGK-----NNPFCAEGIDVTSFLNLHAYSNHSEHCLAYLFTYRDFSGGTLGLAWVGTKDQN--GGICEKYREYDDQIPGRRSKSLNTGIVTLINYGRRIVEKVSYLTFAHEMGHNFGANHDDGPDCQPTGDQGNYIMFSSATTGDLPNNNRFSPCSRDSMASLLDQ----------VLNARSGKANCLRRSTEAAAFCGNSLLEPGEQCDCGYADE----CTDACCHPRG--GPSGQPACRVRPHARCSPSGNLCCTAG-CDFTPAGTVCQ--AETDCALPAVCTGFASSCQEARHKPDNSTCRAGTRLCRQGSCGPSVCALIGWLDCQSPP------CYLGCRPSNTSRCISGLRDYNSPVYKLLQRVNATAFGLKLQVGSPCENYKGYCNADHECRLIDTKGPLGRLQDLLFSPESLEQVR....................................................................................................................................................................................... 706
52 0.000e+00UniRef50_A0A131YXE7 Disintegrin and metalloproteinase domain-containing protein 12 n=8 Tax=Arachnida TaxID=6854 RepID=A0A131YXE7_RHIAP  ali  16  13...FVLLLAVLDFALCAVLAEYTEGVRQDFLR-YERVHPKVIS----HGRRRRDLSLRNDTHQDVLQVMFKAFGQPFTLDLRMKKGLLPLNYFEKHHGNNNSHIIDHHCYYHGTVRGRNNSWAAVSTCNG-LSGVVFDGKEIHYI--------------------------HPDPPEHLFLKASDMKEKSWRCGFND----------------SLNLWGDARSRAKRSVVIQPPFKSNARSRYVELLIVNDNKEFIKMKRNKEAVFERSKQIANXXXXXXXXXXXXXXXXXXXXXT-------------------EHDEIVMSSDGDATLTKFLQYRRERLAREHPNDNAQLI---TDIVLDSSVVGKALKGPICTYEYSGG--------------------------VNKDHHEVVGVVATTVAHELGHNFGMEHDD-KDTKCQCPEKRCIMA--SATSNPPSPSQWSSCSKQYLQSSFEQGMDFCLWNLPED--------------IMGPVCGNGFLEEGEQCDCGPAE----FCKNPCCE---------ASTCKFKGNAACAI--GACCDISTCQVVKAATLCRDAI-TECDLPEYCDGVSEFCPVDVFVQDGTECGGGKAYCFGKQCRSHD------DQCQLLWGSSGRMADQRCFERNDDGEVNANCGYNRLNKTYKKCNKEDVMCGTLHCGAKCGTNKA--CMNQKCVPIEKLYGIKCPYD-CYNNGVCNSRGNCHCMVGYAPPYCNYPGPGGSSDSGPA............................................................................................................................................................ 695
53 0.000e+00UniRef50_UPI0007E7EB95 zinc metalloproteinase-disintegrin-like MTP8 isoform X3 n=1 Tax=Drosophila takahashii TaxID=29030 RepID=UPI0007E7EB95  ali  16  43..................................EFSTHTVIRPQVEHGRTKRSLDATDGLHTPHISLSYTHEGKRITIDLQRNDRLLPESHFLRYQNASGTKTEVDLCHYQGHIRGQPDSVVALSTCDGALDGIVFDGS-QTYFIHPHVDSTGRLQDDHYLLRQADMHPTNATCGYDSHRDDHSHDHERAGQDNELGGEIPALPLRLDGGEFQRTLLRKRRQADDSSQLIRGPYNANKYSSYVELVIVVDNKVYKSYQESAKKVHQHCKNLANXXXXXXXXXXXXXXXXXXXXXNEAN-------------------EIEFSNDGDVTLRNFLNYRSNKLVLEHPNDNAQ---LLTKETFAGGVVGKALKGPICTYEYSGGVS--------------------------MQHSPNTAMVATTMAHEMGHNFGMEHDTPD---CHCRDEKCVMAASSTSFIPVN---WSSCSIDQLTIAFSRGMNYCLRNKPE-------------RLFESPTCGNGFVEPGEQCDCGLPEHCENACCN-------------AQTCMLHANASCA--TGECCDLTTCRPKMAGSACR-EAENECDLPEYCTGESEYCPADVFRRDTEPCDDGQAYCFHGTCRSHS------NQCRILWGPTGDNSE-HCYSKNVEGSRYGNCGYNRLNKTFLPCEEQHVKCGMLYCGAKCGEN--MMCVDQRCLPVAAVGMGAPCPDDCNGNGICNSRGHCHCDVGFGGESCSKAGSGGSPDSGPA............................................................................................................................................................ 749
54 0.000e+00UniRef50_F7DI19 Uncharacterized protein n=10 Tax=Theria TaxID=722675 RepID=F7DI19_MONDO  ali  16  24.SSTIGLGFFFLCLGMLLPGIPYAQG---YYSYYEIVIPRKLT-----------------ESLEKISYALLMKGKRQVIQLNLKRGLFVKDFPVYTYTKETMPFIQDDCYYDGYVEGQLGSLVSLSTCSG-LKGVITIDKSVYRIEP--------IGTSKEFEHVLYHMDGHVKGSCKVSGDHSKLTSNP-------------------------QLRRDEDNLNEESQPVQFLNYVWSHTKYLEMFVVVDNKRFQMWNSNVTKTAQM-----VMDALAHVNTYVWRI----------KLKVVLIGLEIWTEKDQVKI----SEDLQEVLYNFNHWREQVLFIRAKHDVAHLIV---GHD-PGEYIGEAFFSGACVSKFAAGVET--------------------------FYHEDVSHFALLMVHELGHNLGMEHDHESCIC--FDHPSCIMLRTITFENN-----FSNCSLDYFYEFLRQHKGSCLYDKPVPRGLL-----------RKPFCGNHVVDKGEECDCGS---HGDCRKDQCCLPS----------CQMRMNSDCAF--GPCCK--KCKFLKAATPCRPSVD-ECDLPEYCNGTSMWCQPDTYKQDGTPCR-GPGYCYQGRCRS------VENQCVQIFGEGSRAARKSCYHLLNTQGDRFGNCGSNQKGVFVKCNPEDVMCGRLLCGTSCGPQK--ICINRTCSDLQVLQSDCKSEVTCRGRGVCNNLKHCHCDYGYAPPTCDSKGFGGSVDSGP............................................................................................................................................................. 691
55 0.000e+00UniRef50_U3I0H9 Uncharacterized protein n=21 Tax=Aves TaxID=8782 RepID=U3I0H9_ANAPL  ali  17  38.ALLLRLGVWAVLAAPLLPRAGS-HRLPPGYAVHEIIRPKKLSPVV------------GRAALGEVSYVIRVEGENRIVHLTQTRGLVVKNLPVITYSPRGQPHVPEECYYLGYVEGSPSSLVALSTCSG-LRGRLKIGN--------LSYGIEPVPGSLTFQHLLYRRKMTQDKPSTCGLTDEAIQKQPGLTGIKIPSAKQDLSQR------------------------------LTRTRYVEIFIVVDHQLFSYQGSNET---------SVMALVTDTINLSETYYYPLK------IRICLIGLEMWTRGNI----IKHSLDIQEVLTNFNSWVNTDLSSRMKYD---IAHLFTYTDF-GFTVGLAYVGSICYPGY----------------------QSGIVSHIRRDF----ITFSIIFTHELGHNLGMEHD--KKECVCGKATKCYM----TGESLNGASAFSNCSLQSFVDLLSRGDGECLNNIPEPNRFFY-----------FKHCGNKVIDEGEQCDCGGPQ---HCQGNPCCYQD----------CRLKPGAVCSV--GQCCQ--KCRFRAAGYKCRPEVD-ECDLPEYCNGTSEWCPEDLYIHDGTQCSDDG-YCYRGKCATYD------KQCRKVFGNEARGAPESCFKEQNTKGDRFGNCGGDGTEVFVACEPQNALCGRLQCGTKCG--QGKICINKTCTDA-VVRTKCNANILCQGKGVCNNLEHCHCKAGWAPPYCQFRGVGGSVDSGP............................................................................................................................................................. 705
56 0.000e+00UniRef50_UPI000935E3D0 disintegrin and metalloproteinase domain-containing protein 12-like n=2 Tax=Aedes albopictus TaxID=7160 RepID=UPI000935E3D0 :_  ali  16  61.....................................................SHRRGPSPVVEQLSVSYLLDGENVTLDLWLNDGLLPAEHFLAVQERGEQHHEVEMCHYHGIIRNRAESQVAVSICDG-LRGVVYDHNETYLLE-----------VDREEHYVYRQAGFVSHPNRVKR--------------------------------------ALEASHVTTVDSIRAAYKSNSESNFVELVLVIDNMLHRSIR----------NEQQIHRYCLDLVNVMNAIYRPL------NIYIALVGVVIWSDKD----QIEISLDSKKTLEAFLSYRRNTLLKMIPHDNA---HLLTGVHFTDSVVGKAEMGSMCTYAGSGGVEVVDTKFVALQ--------------------------ASTIAHEMGHNFNIDHDGPE---CHCPNGNCVM-ASKTVRSQAAPNQWSSCSVRDLETAFNHGLGSCLKNKPS-------------KMFVKSTCGNGLLEPGEECDCGLPHVCDTKCCD-------------AMTCRLTVNATCA--TGECCDLDSCQVKTAGIKCRPEA-GECDLAEHCDGQSAVCPRDVYLRDTEPCAGGKAYCYKGQCRTRD------SQCKVLWGSTGKSIDEYCYQTNRNGSIFGNCGNNLLTGEYTKCNQEDMMCGLLHCGTKCGAGK--MCWNQKCVHLQENDVGEDCADGCNGHGVCNSEGNCHCDVGFGGQFCEKSGHGGSIDSG-----------PIVDPEDSLDXXXXXXXXXXXXXXXXXXXXXXXRGMITEVLRKVLLKFRMRKYGHMVPPASPTSTVPPKPPRLEISTPQLSTTTAKAVGVPRKPDALPTRAAPAPPVASVEPAQ................................. 810
57 0.000e+00UniRef50_A0A091E4K2 Disintegrin and metalloproteinase domain-containing protein 12 n=2 Tax=Euarchontoglires TaxID=314146 RepID=A0A091E4K2_FUKDA  ali  15  9...................................................................................................................................................................................................................................SHVDSHKRETLPMTKYVELVIVADNREFQRQGKD---------LEKVKQRLIEIANHVDKFYRPL------NIRIVLVGVEVW--NDIDKCSISQDPFSS--LHEFLDWRKMKLLPRKSHDNAQLI---SGIYFQGTTIGMAPIMSMCTAEQSGG--------------------------VVMDHSDSPLGAAVTLAHELGHNFGMNHDTPERGCSCKDKGGCIMNPSTGQSWYPFPMVFSSCSRKDLETSLEKGMGMCLFNLPEVKQAFG-----------GPKCGNGYVEEG----EECDCGEQEECTNRCC---------NATTCTLKSDAVCA--HGLCC--EDCQLKPAGTACRGSSNS-CDLPEFCTGAGPHCPANVYLHDGHPCQGVDGYCYNGICQTHE------QQCITLWGPGAKPAPGICFERVNSAGDPYGNCGKDSKSSFAKCETRDAKCGKIQCGTKCADGK--ICLNRRCQNVSVFGVHECAM-QCHGRGVCNNRKHCHCEAHWAPPFCDKFGFGGSTDSGPIRAGCMVYLKRKTWIRLLFTNKKTTIEKLRCVRSSRPTSGSHPGQTHLIRHGKGLTSRPPHSNTAKDR---RPPQCLNVDISRPLGTLAMPQPQSPQRVLPPLHQTPQVPSGPARPLP-TNPALRQAQGIYKPNPPQKPLPANPLSRTTRLSNASVK 735
58 0.000e+00UniRef50_UPI000B459494 disintegrin and metalloproteinase domain-containing protein 10-like n=1 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=UPI000B45  ali  32  11......VVTSVWLLAVFCTYGNVAASLNDVIRYYEPVHFDSHTLLSDHHRVRRGTDEG-------LRLTFRAFNRDFRLKLRPNNHLFTSD--VVFESSTGSITYDTSGAYTGSDEDDTGSRIYGVITSGHFEGHLLYPN-ETYNIEAARRHFKK---DTNFSSVIYRSSDMSVNTRDMMCK-------------SDELHRKIMKHQILDEIDGQRHRPTEKWSDRYKSSNRQRRAIDPTKTVCELYLKADHTFFNK----------FVTHDAVLDQMTNHVQASNDIFSLIDFDGDGSITFQIKRVTIYNDPTATGYPFP---------LQYSVDSMLDLHSRENYTDYCLAILFTNRDFSNGVLGLAWTAQ--TGYAGGVCEGYRTYH-----GESKSLNTALVTMLNYGRDVSSAVSHATLAHEIGHNFGSQHDPETAGTCSGNGGNFIMFPMATSGYEVNNQKFSTCSVAYMAPILESRARD--------------ATNGCFKASGAPICGNNVIEAGEECDCGWEDT----CTETCCNPQAASPTATPCTKVNVSSSSCSPSEGPCCSPS-CTLYTSGENHICRANSSCLAEALCDGSSTSCPASTSAANGTQCAEG-QVCYLGECSGSVCIAHSLEACQCSPTKDEKLCQVCCTYNSVCTPTTNIPTIPTTNA---------------LAGSACNNYRGYCDVFYVCREVDPTGPLLALKKLLLDGEVFQTLK....................................................................................................................................................................................... 669
59 0.000e+00UniRef50_UPI00051C1A72 LOW QUALITY PROTEIN: disintegrin and metalloproteinase domain-containing protein 33-like n=2 Tax=Neognathae TaxID=8825 RepID=U  ali  17  3...............................SHGERVTPHWL----LKGRTRRAISEEKVPAPARAKVAVMAEGRELILVLERN-QLLAPGYTETHYAADGKPVHTDHCYYHGHXEHHRSHRGLLSI----ARGLIVLSSNASYYLKPL------GTPEPGHHVIHRAEHLPIRGGTCGHGDDFGSTIA-------------------------------DIAQLFQPVHHRAKRDAWRTMKYMELFIVADHTL---------YRNQNLNLGHTKQRIVEIANYVDKFYRSL------NIKVALIGLEVWTERDQC----AVTSDANATLWSFLQWKKA-LRSRKKHDNAQ---LLTGKTFRGTTIGMAPLEGMCSADNSGGVS--------------------------VDHSEQPIGAAATMAHEIGHNFGMSHDSAGCCVEATPEGGCVMAAAT---GHPFPRVFSSCSKRQLENYFQKGGGMCLFNLPDTKDLV-----------VGRKCGNGFLEEGEDCDCGEVEE----CTNPCCNAHN---------CTLKVGAQCA--HGDCCQ--NCKLKVAGTICREAA-GSCDLPEYCTGASPYCPANVYLLDGSSCAYGEAYCNNGMCMTH------HQQCVQLWGPGAWPAPDACFQDVNMAGNTYGNCGKDSQGRYVKCDKRDAMCGKIQCGTKCGD--GMVCKDRRCQNASLFE-LEKCVSRCNGHG............................................................................................................................................................................................. 626
60 0.000e+00UniRef50_A0A0K2T7F7 Putative LOC100883390 [Megachile rotundata] n=1 Tax=Lepeophtheirus salmonis TaxID=72036 RepID=A0A0K2T7F7_LEPSM  ali  18  3......................................................................................................VPESENCHYTGKVRGQKESRVALSNCDGSLNGIIFDGSNIYHVQDDSIYDDRHRLEKDH----------------------------------RCGFPESDIPNRFKRHINTKKHGYNSSTIHKKGDMVRKPWKANKNSRYVELILVVDNKEYNDHGR---------NLMKVHRLCKDIANVMNALYSPL------NIYIALVGVIVWTEYD----EITLDRKGDQTLTHFLHYRRERLVKEHPNDNAQ---LLTGIEFEGGVVGKALKGPICTYEFSGG--------------------------VNMWHSNIISLVATTVAHELGHNFGMEHDDED---CSCPDERCIMAPASST---MKPSFWSSCSLNHLALAFEQGMDYCLRNKP-------------VKLFGAPVCGNGFVEEGEDCDCGLKH----HCDTTCCDPDS---------CTLTPGSLCA--TGECCDFDTCKPKAGGVKCRDQ-DQECDLSEYCTGDSEFCPTDVNKADGTSCKGGSAFCYSGSCRTH------TDQCKLLWGPSGRKSDNQCYELNAEGSRKGNCGYHRVNDSYAQCKKNDVRCGMLHCGSRCDD--GSLCVNRKCMPVASLGPDSCY---CNGRGVCNSMGHCHCVDGFAPPDCFNPGLGGSIDSGPA............................................................................................................................................................ 590
61 0.000e+00UniRef50_UPI0003F0729C disintegrin and metalloproteinase domain-containing protein 12-like n=1 Tax=Saccoglossus kowalevskii TaxID=10224 RepID=UPI0003  ali  16  42....................................VSPVYIDLGEQTCLLTSNIKPLEDGHLRDTSFTFQAFGKDFILDVHLNDVLFPENFVERYYLEDGTLVTHHHCYYHGEVRGSNSSKVAISTCRG-LSGVVFDEDTTFYIEPLEGNSLK---------HLIYKSEDVKRPHRANCG------------------------------------YSNLAVIDDLPTLKRVERDVNTETKYVELYIVNDHREFEYLERDITR---------VMERTKEIANMMDSYYQDL------NIRIALIGMEVWNQGDM----IDVVSNPMRTMENFQKWRKDTLLPVSYNDNAQ---LLTGRTFDGSTVGMASLGGMCSSERSAG--------------------------VNEDHGIHAADVASTMTHELGHNIGLLHDTTDCDCPAPEREGCVMEP---ASGSIPPTKWSNCNFEDLEAALRKGLGSCLFNYPR-------------TIYGGPICGNGFQEDLEECDCGKPED----CDNPCC---------NAYNCTLHANATCAI--GECC--EDCQLKPPGTLCRD-VVNKCDLPEYCRGHSPACPSNVYRQNGQPCASDDAYCYYGACVTHD------RQCLELWGGTASNSPELCYTETNRKGDELGNCGQNEDGTFVACQAKDAPCGRLQPGTKCADQ--MMCYENKCTSIAELGLTQCPYN-CSFNGVCNSQNHCHCNKNWAPPYCNVAGFGGSLDSGP............................................................................................................................................................. 688
62 0.000e+00UniRef50_A0A026W8S0 ADAM 17-like protease n=1 Tax=Ooceraea biroi TaxID=2015173 RepID=A0A026W8S0_OOCBI  ali  24  6..........VLFLYSVIIILQNIYGLHRNLRYYETIHNTDL----QHRIVKRGVHHSYHPYNKISELEFYSHRRHFRLILTPRREVIHSNFKAYEVNADGTIHLDHDNFYHGRVFGEIDSHAQMHIDDGVITGSITILDETFHIEPSWRHL----PHLDNQTMIIYKSSDVKLSWEHYENGEGHTHGAPKTCGYVKEDLNYTLNDGEGPND---NNIKINDKSNSRMKRQTETYEYTPTKTRCPLLLVADYRFYQEMGGSSTKT--------TINYLISLIDRVHKIYNDTMWDGFKGMGFVIKKIVVHTEPTRVRG---GETHYNMVREKWDVRTLLEVFSRESHKDFCLAHLFTDLKFEGGILGLAYVGSPRRNSVGGIC-----TPEYFKNGYTLYLNSGLSSSRNYGQRVITREADLVTAHEFGHNWGSEHDPDITECSPSASGSYLMYTYSVSGYDVNNKRFSPCSLRSIRKVLQAKSGRC------------------FSEPEESFCGNLRVEGDEECDAGLLGTED---SDQCCD----------KNCKLRSKAVCSDKNSPCCQF--CIYMPAGVKCRDAQYATCEQESRCTGASSECPRSPSMKDGTGCLERGQ-CRGGKCV-PYCETQNLQSCMC--DTIGDACKRCCRMSLNET-----------------CFPIDPQDI-LPDGTPC--IQGFCNK-GVCEKT-IQDVVERFWDII-EDININKVMRFLKD.................................................................................................................................................................................. 665
63 0.000e+00UniRef50_G3U7S3 ADAM metallopeptidase domain 29 n=51 Tax=Eutheria TaxID=9347 RepID=G3U7S3_LOXAF  ali  18  11.....LLHLKITVLLPWLGVLLSFSGKTQAEHSPEVVIPLKLTG-----------TSRGMNAPGWLSYGLYFGGQSHIVHMKVKKFLLSRHMSVFTYTDQGQPFIQKDCYYHGYVEGDLDSLVALSTCFGGFRGMLQINDN--------SYEIKPITFSATSEHLVYKM------------DNDETQFPSMRFGFMQDEIAHQLEFQDISNLTLKQSAY---------------EDWWTHVWFVTYTVVVDHTLYLHY---------ERNTSKLQEDLYNVVNVVDSIY------DALGVNLLLFGIEIWTEKNFIVVNDVKNS-----LRDFCQWTVKNLSPRLPYNVAHLYMNQALR----GLPGLSFLGGIC----------------------KMGYNCGVVSFLN----LTLKDFASYVAHELGHSMGMNHD---KDTCTCGQKSCLMNPR-----KIPSTRFSNCSYAYWWKTIID-NGKCMRDNPQTGNILI-----------RKRCGNGVVEEGEQCDCGS---FKYCAKDPCCLAN----------CVLSPGARCAF--GLCCK--DCKFLPSGELCR-QQINECDLPEWCTGTSHQCPQDLYVQDGSPC-LEEGYCYEKRCNNR------NEQCKEIFGKGAKSANQRCYKEMNTQGDRFGHCGI-NRSVYVKCATSDILCGRIQCGTECGP--GNICIHRKCVQMSLLK-SHCSAQTCNMRGVCNNKHQCHCKYGWAPPNCLSKGAGGSIDSG.............................................................................................................................................................. 673
64 0.000e+00UniRef50_UPI000846362D disintegrin and metalloproteinase domain-containing protein 32-like n=8 Tax=Neognathae TaxID=8825 RepID=UPI000846362D  ali  17  42....................................LSPLGWQVPSQITIPQRNVTGVTRLQQDTVSYVLRIEGRPYTIHLQQ-HAFLSDDFQIYVSDEEGSLPPDSACHYWGYIDGFPSSAVTLSTCSG-LRGLLQFEN--------VSYGIEPLDDSPEFEHLVYRVGEEDTAGSLLPHSPPGRELGGLVAEETSAKAHRLSSTAKGSGEGPENTGICPLEYIGAHFLFQLLWAAARSPKYLTVYVVLDSALYNYMGSDP---------NAVTQKIIQAFNLVNNMFSPL------NVTIVLSSLELWAEGDKIPTA----GDTDDLLQRFLQWKQLTLALQ----AHDIAFLLGYRD-QGAPVGTAALGKACQRDAAAAVALYHG-------------------------KATLESFSVLLAQVLGRSLGVSPDSPRAC--GCAGHGCIMSPAALHFS--GAKAFSNCSVRDFETFLKQGRGVCLFSRPRLRPLSP---------RSGAFCGNGVVEPGEQCDCGAPQ---QCLHDKCCT----------WRCQLMPKAKCA--SGLCCK--NCQFRKKNSLCRPTSDSQCDLPEFCSGSSGSCPPDVYVQDGHGCARGTGYCYQGRCQSLD------LQCQRLYGKDSKSAPVACYEEINSQRDRFGHCGFKTGRGYQGCSWRNLRCGKLVCGTKCGSER--VCINNTCHPRSVLGFRCDSQVMCHGHGVCNNKGNCHCYPGWRPPSCQRRGSGGSVDSG.............................................................................................................................................................. 729
65 0.000e+00UniRef50_E4XQ50 Uncharacterized protein n=2 Tax=Oikopleura dioica TaxID=34765 RepID=E4XQ50_OIKDI  ali  33  3............FAILFGLANVSSERLNKFIKSFEPLQYDTVKVEESHGRYRRSIVDSDGSP--IVSLNFTAKGYHFSLLLHSDSSVFAEGYEVEDNKGHSLLHKIDHLV-SGKLADQPGSHAEGQLRKGVFSGTIFSPLWGTFYVERRGEAGAT-------HSVIYHENEIELPENFGSCKEM----------------------KHTPADFSAAMEAYHYNEPERVRRESDEVHEEDQRNTCIMRIQVDHMFSSEYRR----------CPEILAFISSHLKALNKIYIKHQFIVEGGKGFQVKRIKIDDTTG---------PEDRFRSRNIGVEKFLELASLDDYDDYCLSYVFTKRDFNSGVLGLAWVAQP-EGSSGGICEKNKRYND----GKTKSLNTGIITIENYGSIVPTKVSHITFAHEIGHNFGSPHDGGILCTPGDSSGNYIMFSRATSGDKENNDKFSECSVRNITRVLSKKRS-------------------CFVTSDAPICGNQIVDKEEECDCGFKEECERL-KDNCCYP--ADFEISSKRCKLKRGAQCSISQGPCCDGNTC--KHHDTNVRCAKEQDCTEPTMCSGKKAQCPTPKPKEDFKWCQKETMTCIGGFCSGSACDKFPLESCSCPEAETKKHCHVCCQQKDDPSTCKSTGELS---------LYFNNRTIFRKPGSACDDFKGYCDVFSKCRKVDADGPLARLRNIFFNMKLYNNIRDXXXXXXXXXXXXXXXXXXXXXXXXXCCSIHTPTNNPKMRRHRDFPGTMTLRRMSGRHQNRGRQYGQNPSSRSPDLPLNSYSQGQSRR............................................................................................... 761
66 0.000e+00UniRef50_A0A0C9QUZ7 Adam11_1 protein n=147 Tax=Neoptera TaxID=33340 RepID=A0A0C9QUZ7_9HYME  ali  18  68...............................HNYQIIYPVQLRHHEKMGISTREARSRAGKHFHRTSLLIKAFNHKFRLDLELNTQLLAPNLIQKDFLSRDVEQEIEHCYYHGTVRDYPGASAAFHTCNGV-SGVIHLGN-ETFVIQPFYGGDLSRHPHVIFEA---------------------RTKANKGCGIAGNLERRLAKNRRQ----------KHVLGLSESIGDRYKRDVREATKYIETAMVIDKAMFDKRN--------GSSRAEVVHDAIQVANIADLYFRTLN--------TRVSVVYIETWSGGNQASIETGMEINRAIHNFNDYTIRKLYQ----ITEDTIQMLTGETFQGGESGVAAHETVCSPKSVGISVDLNTYE--------------------------PHLLAGTMAHMIGHNIGMKHDDGRENCFCRDWHGCIMAQSIVGADNVQPYKFSECSKADYEEALRSGHGICLFNKPNELET--------------RLCGNRVIDDGEECDCGTLDDCPD--IDPCC---------DPITCKLKAEAECA--SGPCCN--ECKLLPRGSICRESS-NECDLPEVCSGETGQCPVDLYKKNGKPCANNQSFCFGGLCPD------LNVQCTQVWGENGKAADMQCFEEFNSKGSINGHCGTDPAGHFVKCESRNVRCGSLQCGTSCGEN--LVCVNQTCTNVFPKCPSNQHNLECSGNGVCTNINKCHCEIGWSGPDC.......................................................................................................................................................................... 750
67 0.000e+00UniRef50_UPI000265915F zinc metalloproteinase-disintegrin-like VLAIP-A n=1 Tax=Galendromus occidentalis TaxID=34638 RepID=UPI000265915F  ali  18  11...................................VLLPTLFSLSLTISAVSSSWTQIQPRWERDSVLSFTAFDRVFRLVLKETEHLIRNDFTTYHHHPETSEIVSEGCHWNGHLDGAPGSRVALSTCPPGIGGVIWNGDDVFYL--------------------------HSNGSQALISKNTDLQIPELKCGFDHGTDAILSRQRRGSAQLN--------------TVKHPPSTTNATSRFVEMVIVHDYRQFVKFGRDEKKLFERSK---------QVANIVNALYAPL------NIFVVLVGVRVWSQRD----EIEVDINAEKTLDNFLRYRMEVLAKSIPNDNAQLV---TDLTFEKDVVGKALKGPICTYQYSGG--------------------------VNKDHHESVAVVAATIAHELGHNFGMEHDDLGSCHC--PQSRCIMFPASNAM--VPPTAWSSCSMNAIHEAFSQHMDHCLLNVPTK--------------IVGASCGNGIVEDGEECDCGPE----NFCTTKCCNP---------KTCKLNEGATC--GHGECCDLATCLPRRAGVKCRDQ-DGECDLSEHCDGKSHFCPRNVFKANGEKCGDGDAYCYMGSCASH------NMQCKKLWGQTGHVGHRACFSVNVNGTQIGNCGYDKIRKGYAKCKQKDIMCGTLHCTYPTDPDPGQCGVNQACLSARCVELAQPCEYSCFGHGICNHLGHCHCDPGYAPPYCNFPGKGGSVDSGP............................................................................................................................................................. 667
68 0.000e+00UniRef50_F7DFR8 ADAM metallopeptidase with thrombospondin type 1 motif 9 n=6 Tax=Euteleostomi TaxID=117571 RepID=F7DFR8_XENTR  ali  13  2..............................................HFKRTRRSVPNSRDIDPSRTHYKLSAFGQHFFLNLTANSGFMAPVFTVSLHGGNQSSYYTDHCFFNGHVNHRAEHTAVISLCSGML-GTFKSQDGDYFVEPLLSDDSEYEEEHNKPHVVYRHNPPHRNISREEQTCHTAEPTHASDSHAKGGARLEQNDPHSDDQALNKNPLFNKADNATGTRTLRRKKRFLSYPRYVEVMVVADNKMVEYHG------------ANLQHYVLTLMSIVASIYKDPSIGNLINIAI-VKLAVVHDEQEGP----AISFNAQSTLKNFCIWQQSQNNPDDNHSHHDTAVLITRQDICCDTLGLAELGTVCDPYRSCSISED-----------------------------NGLSTAFTIAHELGHVFNMPHDDSNKCKESGKNQQHVMAPTLNF--YTNPWMWSKCSRKYVTQFLDTGYGECLLDEPISRTYTLPQQLPGALYNVNKQCELIFGPGSQVCPYMQMQCRRLWCISSDGQHKGCRTQHTPWADGTECEPGKHCRYGVCIPKERDVQIADGSWGSWSPFGACSRSCGGGIKTSIRECNRPEP-----KNGGKYCVGRRMKFKSCNTEL-----CAKHKRDFREEQCADFDGKHFNINGLPPNVRWVPKYSGILMKDRCKLFCRDGTSCGPDTNDICVQGLCRQAGCDHVLNSKRDKC---GVC........................................................................................................................................................................................... 669
69 0.000e+00UniRef50_Q7KUY7 Mind-meld, isoform B n=23 Tax=Schizophora TaxID=43738 RepID=Q7KUY7_DROME  ali  17  63...............................HYYQIIYPVQLRHHEKMGISTREVSGRTKKHFHRTSLLIKAFNHKFRLDLELNSQLLSPNIQQKHYHVDGNRHDIEHCYYHGTVKDYPGASAAFHTCNGV-SGVIHIGN-ETFVIHPFYGGDLSKHPHVIFEA---------------------RTKANKGCANSGNLDSWRLSRRTKHLSAGVAGVVEEILQAGVGRNKRDVREA---TKYIETAIIVDKAMFDKRN--------GSTRAEVIHDAIQVANIADLYFRTLN--------TRVSVVYIETW-GKNQAVIDGSKDISKAISNFNDYTSRNLFQIER----DTTQLLTGETFAGGEAGMAVPETVCTPRAVGISVDVNVYE--------------------------PHLLAGTMAHMIGHNIGMGHDDGREECFCRDWHGCIMAQSIVGQENVQPYKFSECSKKDYIDALRTGHGLCLLNKPNEIELRRN-------------CGNKVVEEDEECDCGTFEECAL---DQCC---------DGITCKLKSEAQCA--SGACC--DQCRLRPKDYICRDS-NNECDLPEYCDGEIGQCPSDVFKKNGSPCGLSSGYCFQGYCPTLS------LQCEAIWGYGGSAADRQCYEQFNSKGSINGHCGRDANEHYIKCEPENVQCGTLQCGTPCGDN--LICLNQTCVSLFPHVDQTKCPANCSEHGVCTNTNRCFCDMGWGGNDC.......................................................................................................................................................................... 754
70 0.000e+00UniRef50_UPI00077A7506 disintegrin and metalloproteinase domain-containing protein 12-like isoform X1 n=4 Tax=Acropora digitifera TaxID=70779 RepID=U  ali  19  1MNLSMISLLIMVAQLNLFGNTDSKNNFEQQIRNYEIVAPRL--QIQGLWRREISTRSSLGDHIDKAVFFFRGFGKNFVLVVAQNRVLLSANYVSRSFSADGAHEKTDNCFYQGTVQGLQHSIVAISTCHG-IEGMVYDGNETYFIQPLPGNTEQQ-------HILFRSKDMVQGEKRC---------------GVDHFKVALDMEKDIFNGQ------------------HRVRRNVKNEIKYVELIIVNDHSQYLKLR----------SIAEVEKRSKSIANVVDSLFRP--------INVRVALIMVETWNQRDRIEVVEDSN--KCLDNFMVYRNGDLWKKQKHDNA---MLITHRSFKGSTVGKAALTSMCGRKSGGVVQ---------------------------DHAKNAAATAATVAHEMGHNFGMLHDEDCKCNSPSDNQGCIMSAVAK---NTPSTEWSSCSRESYKKYLNRGMDSCLFNVPQS-------------LFGDAVCGNGFKEEGEECDCG-NVEDCKKYSDGCC---------NATTCKLHPDSECD--TGACC--SKCKLKPQGVVCR-EKLNECDLPEFCTGKSELCPSNKYVHNGRSCANNNGYCYNGECPTH------NKQCKDLWGHEAKSGPDVCY-SVNEHGTVRGNCHQPGNNVYIKCTQQNRLCGMLQCGTKCGENKL--CLDRKCMSISVTTTVKRCPNNCNDNGICNNEGDCFCLSCWQGADC.......................................................................................................................................................................... 679
71 0.000e+00UniRef50_I3JDD8 ADAM metallopeptidase domain 19a n=9 Tax=Euteleostomi TaxID=117571 RepID=I3JDD8_ORENI  ali  18  12.........................................................................................................QDHCFYHGHVRKHPDSWVALRTCSG-FRGLISLNSSDTYYLEPISSVDP-----------VYHSLLSTKELPIKGGNCYHTHHTTHPNLISNLL---------------------------TSFHSRVKRNTLGTTKYIELYIVADNTLFRRQNQDY---------EKTKARIMEIANYVDKFYR------ALNIRVPLIGLEVWTERDQCII----TEEPNATLWSFLQWRQK-LKSRKKHDNAQ---LLTGVIFKGTTIGMAPLEGMCSLENSGGI--------------------------NVDHSELSIGAAATMAHEIGHNFGMSHDHDSCCVETADQGGCVMAAAT---GHPFPRVFSYCSKRDLDRYFQKGGGMCLYNMPNMKDLVGGKK-----------CGNGFVEDGEECDCGEPDE----CENDCCNPNN---------CTLKEEVQCA--HGMCC--EGCKLKQAGTMCR-RPAGACDLPEYCTGASPYCPANVYLLDGSSCQYGMAYCYNGMCLTHE------QQCLQLWGYGAQPAHDVCFEDVNAAGNAFGNCGKDEHGNYVKCKKSDAKCGKIQCGTKCGEGK--VCRDRRCQNASFTE-LETCLARCHNNGVCNSNGNCHCNQGWAPPFCEKPGLGGSVDSGP............................................................................................................................................................. 594
72 0.000e+00UniRef50_UPI000C84A375 LOW QUALITY PROTEIN: disintegrin and metalloproteinase domain-containing protein 20-like n=2 Tax=Eutheria TaxID=9347 RepID=UPI  ali  17  5.........................EPSQHDSPPEVVIPLRV-----------SGTGKRETASGWLSYSLHFGGQRHIVHMKVKKSFLARNLPVFTYTEQGEPFIQNDCYYHGYVEGDPESLVVLSTCFGDFQGILKVKD--------STYEIKPKSLSSTFEHLVYKM------------DSEETQFPPLRCGLTEEEIERQLKFQGIGNY---------------TSRQSSYEGWWTHLWTVEIAMVVDKKQYQ---------TLQSNETLVHIEIFNVVNLMDSFYE------AMEVDIALCAIELWTRRNFLPIE-----NIEVLLQGFCDWKRVCLAPCIHHDVAHLIA---DKNFT-RYLGLAFVGAV----------------------XVQSLNCAVVSFMGY----SVGEFAVMTARELGHNLGMMHDDND---CICGAWPCIMYPAKTLSS-----KFSNCSYGNFWNT--NVRRSCLRNSPNSQLDTQLEK----------RCGNHVVEEGEQCDCGTLKSCND---DPCCLSN----------CTLRPGAVCAF--GLCCQ--NCRFTSAGKACR-AEVNECDLPEWCNGSSHHCPEDVYVQEGTPCAKGG-YCFENRCNNH------NEQCRNIFGKDARSANQSCYEEINTKGDCFGHCSIKNN-QYVKCNFSDILCGRVQCGTECGPDN--ICFNRKCVPMSMLQTGCTNKT-CNNNGVCNNKQHCHCNYGWAPPDCQQKGNGGSIDRGP............................................................................................................................................................. 648
73 0.000e+00UniRef50_A0A0P5LSA3 Disintegrin and metalloproteinase n=4 Tax=Daphnia magna TaxID=35525 RepID=A0A0P5LSA3_9CRUS  ali  41  2.....................................................................................................................................................................................................................................................LYLQADHLFYGKMG----------SEEACIETMTRHVQRVNSIYKNDGDGQGDDINFMIKRIKVHTEQALNEASYRFPGNYG-------VEKFLELFSEEDYNAFCLAYMFTYRDFEGGTLGLAWTGDL--KNAGGVCEKNGHYRNGHYRGSLKSLNTGIVTLLNYGKHVPPAVSHVTLAHEIGHNFGSPHDPENNCTPGGEDGNYIMFARATSGDKRNNNKFSPCSLKSINGVLSAKARN---------------EQGCFKEPQSAICGNGVVEAGEECDCGWEED----CQEKCCFPMRSIAQHGEKPCTLRPATTCSPSQGPCCT-ESCQLR---YGVKCRDDNGCRDSAFCDGSGPKCPPSNNKANKTVC-NEEFVCFMGECTGSICIAYGLQSCQCLQGPPTKACELCCKLPGDDQPC--LSSFEWNTPPY------DVPSAHAKAGTPCNNYNGYCDVFQRCREVDPSGPLATLRRLLLSDESIASLKKWIED.................................................................................................................................................................................. 476
74 0.000e+00UniRef50_S7N6P1 Disintegrin and metalloproteinase domain-containing protein 23 n=2 Tax=Myotis TaxID=9434 RepID=S7N6P1_MYOBR  ali  16 1176..........................LPSRLVYY--INQDSESPHVLDTKARHQQKHNKAVHLAQASFQIQAFGSRFILDLTLNNGLLSSDYVEIHYENGKPQYSKEHCYYHGSIRGVKDSRAALSTCNG-LHGMFED-NTFVYMIEPLE--LIHDEKSTGRPHIIQKTLAGQYSKQMKNLSVESSDQWPFLSEL-------------------------QWLKRRRKRAVNPSRGVFEEMKYLELMIVNDHKTYKKYRSSHAHTNNFAK---------SVVNLVDSIYKEQ-----LNTRVVLVAVETWTEKD----HIDITTNLVQMLHEFSKYR------QRIKQHADAVHLISRVTFHYKRSSLSYFGGVCSRTRGVGVNEYG----------------------------LPMAVAQVLSQSLAQNLGIQWEPSSKCDCTESWGGCIMEETGVSHSR----KFSKCSILEYRDFLQRGGGACLFNRPT-------------KLFEPTECGNGYVEAGEECDCGFHVECYGLCC---------------KKCSLSNGAHCSD--GPCCNNTSCLFQPRGYECRDAVNG-CDITEYCTGDSGQCPPNLHKQDGYACNQNQGRCYSGECKTRD------NQCQYIWGTKASGSDKFCYEKLNTEGTEKGNCG-KDGDRWIQCSKHDVFCGFLLCGTPCGP--SMMCLDRKCLQIQALNPLDSKGKVCSGHGVCSNEATCICDFTWAGTDC.......................................................................................................................................................................... 1832
75 0.000e+00UniRef50_UPI000B8FF951 disintegrin and metalloproteinase domain-containing protein 12-like n=1 Tax=Folsomia candida TaxID=158441 RepID=UPI000B8FF951  ali  16  69.................................YDVLRGVKSTLQRSRRIRRHHSDVEVGGHLEKVRLELALNESDTILHLTLNRGLLPSGYFEKHVVNNPSYEEAELCHYQGVVEGRPSSYAAISTCLGKISGVIFDGDQVHYLEPVANNQTAKRDNDHAWDLVHY-------------------------NGADFRGSSLSPRGVGHDAPSSPKNVTRVKRGASSHSDLRLPWNSNGKSRYVELVMVVDNKKYRDLGGD---------VKAAVRRSKDVANIVNALYQPF------NIFVALVGVVVWSERD----EIAISAKGDDTLSSFLLYRRERLLKDHPNDNAQ---LLTGVEFEDGVVGKAMQGPMCSFKYSGGVNSD-------------------------FRHNLVGIVATTVAHEMGHNFGLSHDGDD-CHCPAEGNRCVMAASASSNRTSQ---WSSCSIKDMAYAFEHGMDYCLRNKP-------------ISLYNGPTCGNGFTEPGEECDCGLPE----HCDNPCC---------DASTCLIHDNATCA--SGTCCDTLTCHVKTGGTPCRETS-GRCDLPEFCTGESEFCPEDVKMLDGLECESGKAYCYAGECRTH------TDQCKLLWGPSGNNSEDLCYQRNSNGSRLAHCGYDLLTEKYAQCATEDSKCGVLHCGAPCGSGK--MCVAQKCVEAGVVGVLGECGGDCSSHGVCNSKGHCHCNDGYGGALCEGPGLGGSVDSGP............................................................................................................................................................. 758
76 0.000e+00UniRef50_UPI0003F0DCEA ADAM 17-like protease-like n=1 Tax=Saccoglossus kowalevskii TaxID=10224 RepID=UPI0003F0DCEA  ali  25  1.......MLKLLLLFTFANVQGITGSLHDALHYFETLHLSQVT----HQMVRRDADTALR---DVKQISFSVLGRDFNLHLFPTKGILSSDFKAYSVKGDGEHIVKEDLLYHGYTTDEQNSYAKVMIEKDGLTASIKTPDDV-YIIEPSWRHVPEP---HDFHMIAYKGSDMKYNFTKDGQSSFCGHGHHLPK-----ELQQDLENYRQSWKYSPNAYSNVTDQKKHSRSKRR----IPSKNICQLLLVADYRFFETMGRGE--------EENTVNYMISLVNRVKTIYKDTYWGDLIGLSFEIKEILVHTEATF--VTKDQRHYNERKSNPWDVSDLLEVFSVHDYSDVCLAHLFTYQDFSNGVLGLAYIATARSYAVGGICSDPYY-----SSSGKLFLNTGLTTTLNWGRRILTREADLVTAHELGHNFGSEHDPDTKECSPDDGGKYIMYPAAVSGLFDNNKLFSPCSQRFVGPVLESKINKC------------------FTYPSGAFCGNFQVEAGEECDAGLVGLETDQ--HNCCSSD----------CYLK-NVQCSDANSECCV--ECSFATAGMDCRVSDDIGCIATAQCTGNSDVCPESQPKANHSDCVDDGK-CYGGRC-YTFCETKHMLPCMCP--QESESCYRCCHEP--------GSDSVLDCNIYTDDEDFKHPF-KLPDGQPCGHGF---CQNGYCEK-STQDVVKRLWSII-EDININKIVKFMEDN................................................................................................................................................................................. 658
77 0.000e+00UniRef50_A0A1A9WS33 Uncharacterized protein n=5 Tax=Calyptratae TaxID=43742 RepID=A0A1A9WS33_9MUSC  ali  16  33..................................EFSTHSVIKPQIHHSKHKRAVHSTDGLHIPHIVLTYKHQGQNILIDLKRNDNLLPDKHFLRYQNNNFTKTEIALCHYQGSIRDKPQTYVAVSTCNGGINGIVFDGIDTYFI------HSGSDGQLHDEHLLFRQSDLLNKNTSCGYDHEHYDEKQAFAKNAAGSVDDAIARNRIDGSEFNRILRYKRSYDE--SHVIRGPFNSNKHSSYVELVMVVDNKAYKSFGENMKKVHQHCKDLANXXXXXXXXXXXXXXXXXXXXXNESN-------------------EIEITPDADVTLRNFLIYRRTKLVLEHPNDNAQ---LLTKVKFEKGVVGKALKGPICTHEYSGSVSME--------------------------HSQIVAVVATTMAHELGHNFGMEHDSPD---CKCQDEKCIMSASSTS---VVPVHWSSCSIDQLNIAFSRGMNYCLRNKPH-------------KLFNSPQCGNGFVEPGEQCDCGLP----AYCENTCCDPH---------TCMLYSNASCA--TGQCCDLTTCRPKIASTLCR-NAENECDLPEYCTGESEYCPIDVFKRDTEECDNGQAYCYQGNCRSHS------HQCRILWGPTGENSEPCYLQMNTEGKRGGNCGFNRLNNTYIPCEKEHAACGMLHCGAKCGDQK--MCVDQKCLSIEYLRTTKTCTQNCNGNGVCNSRGNCHCNVGFTGSTCMMPGHGGSLDSGPA............................................................................................................................................................ 734
78 0.000e+00UniRef50_UPI000B910180 disintegrin and metalloproteinase domain-containing protein 12-like isoform X1 n=4 Tax=Acanthaster planci TaxID=133434 RepID=U  ali  17  34.................WSYQAGRAKQLGKLNNYDITIPYRLD-----GRQRRDAETTEGGHLEEATFVLQLGREEITVDLKLNEDLFPARFIQRSYLPDGKPHRLHHCYYHGEVRGKNSSRVALSTCNG-LSGLIIIDGKSHYVERLS---------DSEGEHVVYTPDSVRRKKKTWVYDTGLSNEPV-----------------------------ASNWPESMHQQARVRRDVFDETKYVELFIVADNAEF---------IDQGSDKEKVFARCKEMANAMDMIYRQL------NMRVALIGVEVWDEGD----QFDVSTNPTLTMQYFHRWRKETLLPNVYNDNAQFV---TGKSFDGSTVGMASLSVMCSLDRSGG--------------------------VNEDHGVNAADVASTMAHEMGHNMGFVHDTDRNCQCDAPSTGCVMEPSS---GSIPPTIFSSCSQADLEAALLKGLGACLFNYPKE-------------IFQGPHCGNGFLEKGEECDCGTVEE----CKNECCVPER---------CILHENATCA--NGECC--EDCQLKEAGVRCRDEV-NECDLPEYCTGIDNECPGNVYRQNGEDCKTSDAICYNGQCVTYD------DQCRALWGNGATNGHELCY-DFNEQGSNHGNCGMDENDNFIRCPKRDLKCGKLMCGSLCGSSKTQLCFETSCVNKSDLNIRDCPFN-CYNHGVCNSNNHCHCDPKWAPPLCKSSGYGGSIDSGPA------RPQGDAPTVPPLTSDKSDNLNPDFTDHDKEVEAYNNXXXXXXXXXXXXXXXXXXXXXXXXXKRQKLQQILCKKSSVPPVASHLQRPMYKHDIKRPSRQGFKSVPESTSTRADVTNGHPARNPTPRPDIVVNTYSASRDPSV......... 846
79 0.000e+00UniRef50_B4PXA1 Uncharacterized protein, isoform K n=25 Tax=Neoptera TaxID=33340 RepID=B4PXA1_DROYA  ali  17  63...............................HYYQIIYPVQLRHHEKMGISTREVSGRTKKHFHRTSLLIKAFNHKFRLDLELNSQLLSPNIQQKHYHVDGNRHDIEHCYYHGTVKDYPGASAAFHTCNGV-SGVIHIGN-ETFVIHPFYGGDLSKHPHVIFEA---------------------RTKANKGCANSGNLDSWRLSRRTKHLSAGVAGVVEEILQAGVGRNKRDVREA---TKYIETAIIVDKAMFDKRN--------GSTRAEVIHDAIQVANIADLYFRTLN--------TRVSVVYIETW-GKNQAVIDGSKDISKAISNFNDYTSRNLFQIER----DTTQLLTGETFAGGEAGMAVPETVCTPRAVGISVDVNVYE--------------------------PHLLAGTMAHMIGHNIGMGHDDGREECFCRDWHGCIMAQSIVGQENVQPYKFSECSKKDYIDALRTGHGLCLLNKPNEIELRRN-------------CGNKVVEEDEECDCGTFEECAL---DPCC---------DGITCKLKSEAQCA--SGACC--DQCRLRPKDYICRDS-NNECDLPEYCDGEIGQCPSDVFKKNGSPCGLSSGYCFQGYCPTLS------LQCEAIWGYGGSAADRQCYEQFNSKGSINGHCGRDANEHYIKCEPENVQCGTLQCGTPCGDN--LICLNQTCVSLFPHVDQTKCPANCSEHGVCTNTNRCFCDMGWGGNDC.......................................................................................................................................................................... 754
80 0.000e+00UniRef50_UPI000BF4E77B A disintegrin and metalloproteinase with thrombospondin motifs 7-like isoform X1 n=2 Tax=Varroa jacobsoni TaxID=62625 RepID=UP  ali  13  107............................................PHQHLRSRRNVSPASSNKDEEVYYELPIEGTNYHVMLRPNRYFVSPALVIERHRGVGNIAHSRHCHFSGKLRGYLSALAAISTCNG-LTGLIQMEDADYLIEPLKGYNTTSPKGNWTTDEVSEPQPHLIYRRSAAFSQFNGRISRPIGGPLIHDSFHKEHFEAGYRERMKYERRLRRKTSGSSGPSRRRNKRSVSIERNVETLLVADRTMLDYY-----------SNEDIETYLLTVLNMVSTLYHDASIGNAINVVLVKIILLESKEQEKEEILSSVSDEAELTLKSFCKWQRFVNPSDESHNHHDVAVLVTRNNICCTTLGLAEVAGMCQPQRSCNVNED-----------------------------SGLTLAYTIAHEMGHNFGMSHDGPHNCQAPLGERQHVMAPHLN--SDTSPLVWSNCSRQEITNFLDRDWGRCLDDEPLAHNFTFPVLPPGAMYDADHQCRLQYGSEAKYCDGIEEVCQTLW----CRLNNKCVTKMEPAAEGTVCDKNKWCYLGNCTEMGDRPEAIDGEWGSWSAWGECSRTCGGGVIHAERHCDNPAP-----AHGGRYCIGERKRYRMCNTE-----ECPEGTPSFRAEQCASFNNLPYKGELFNWPCQLHCKPDGKFFSVMLRDTVIDGTPCLPGSRDVCINGRCRSVSCDWGIETSAQICHGDGTCSTVRQ...................................................................................................................................................................................... 788
81 0.000e+00UniRef50_A0A210PMZ6 Disintegrin and metalloproteinase domain-containing protein 10 n=2 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=A0A210PMZ6_MIZYE  ali  37  5..........................................................................RDFQLELVPDDSIFTPDFVLQHTNGSTYPADIS-FVYTGKVKGDPASYVHGSVLDGVFRGFLVLGDGTVYHIEHVRRFLPAGQVVP-YHSVIYKSDHVNLDPYRHRRAPGVGTCGVDRHGHSDAAGTTQHDTEDAITPDNTSKTPSNASQRKHSDDRVRRNVPKSNQNTCYMYLRSDPVLWRYIKQQVT--DDSVAKNEILAMFASHVAAINLIYNPTNFTTYIGVRFRVQRTSVMTDESENC---NTTRANQFCNPDIDVSNFLDLTSREDHDQFCLAFTFTARDFSGGTLGLAWVASP-ENSAGGICERYKTFPGEDGRSVSKSLNTGIVTIINYGKRVAPTVSHLTFAHEVGHNFGSPHDTGICHYPGASEGNFIMYASATHGDLPHNREFSACSKDNMTRVLHS-------------LLEERFKKNCLQNQQGSFCGNGIVEEGEECDCGYKDD----CDDKCCNPRHEPKRDTDCTLRLHQKVYCSPSQGPCCTSE-CQYIPTASNKTCRASSDCIEAAYCPSDSATCPPTRNKPDITLCNENLSVCQKGECTGSLCKTIGWDECMLSSSSCYLSCRLKG-NNHSCISSDAIPEDPQYQDYKNFVKNRTVSKVFLPAGSPCNDFKGYCDVFSRCRGVNNNGPLARLQNLIFGNQT............................................................................................................................................................................................ 700
82 0.000e+00UniRef50_Q9VXL1 Mind-meld, isoform F n=193 Tax=Neoptera TaxID=33340 RepID=Q9VXL1_DROME  ali  17  63...............................HYYQIIYPVQLRHHEKMGISTREVSGRTKKHFHRTSLLIKAFNHKFRLDLELNSQLLSPNIQQKHYHVDGNRHDIEHCYYHGTVKDYPGASAAFHTCNGV-SGVIHIGN-ETFVIHPFYGGDL-----SKHPHVIFEARTKANKGCANSGNLDSWRLSRRTKHLSAGVAGVVEEILQAG-------------------VGRNKRDVREATKYIETAIIVDKAMFDKRN--------GSTRAEVIHDAIQVANIADLYFRTLN--------TRVSVVYIETW-GKNQAVIDGSKDISKAISNFNDYTSRNLFQIER----DTTQLLTGETFAGGEAGMAVPETVCTPRAVGISVDVNVYE--------------------------PHLLAGTMAHMIGHNIGMGHDDGREECFCRDWHGCIMAQSIVGQENVQPYKFSECSKKDYIDALRTGHGLCLLNKPNEIELRRN-------------CGNKVVEEDEECDCGTFEECAL---DQCC---------DGITCKLKSEAQCA--SGACC--DQCRLRPKDYICRDS-NNECDLPEYCDGEIGQCPSDVFKKNGSPCGLSSGYCFQGYCPTLS------LQCEAIWGYGGSAADRQCYEQFNSKGSINGHCGRDANEHYIKCEPENVQCGTLQCGTPCGDN--LICLNQTCVSLFPHVDQTKCPANCSEHGVCTNTNRCFCDMGWGGNDC.......................................................................................................................................................................... 754
83 0.000e+00UniRef50_A0A0P5NNW3 Putative Disintegrin and metalloproteinase domain-containing protein n=39 Tax=Daphnia magna TaxID=35525 RepID=A0A0P5NNW3_9CRUS :_  ali  18  64...............................SHYQIVFPVQLRHREKMGISTREIQQQTGKHYHRTSLLIKAFSHKFRLDLELNSQLLAPNLIQKHFLPGGVEQEIEHCYYHGTVKDYPGAVAAFRTCSGV-SGIIHIGN-ETFVIHP----FYGGDLSRKHPHVIFEARTKVKQMCANTGMLEWGLRSGNYRG-------------------------GKNQKNSPKSNERQKRDVREVTKYVETALVLDKAMFEKRNGSR--------RIEVVQDAIQIANIADLYFRTLN--------TRVSVVYIETWASENQALIDRSQDIHRALLNFNDY----ISRKHYNFEKDTTQLLSGETFAG-VSGMAAPDTICTVKSVGLSVDINPYE--------------------------PHLVAGTMAHMIGHNIGMGHDDGRDECHCGDWHGCIMSHSIMGLDNVQPYKFSECSLSDYIDTLRIGHGLCLFNRPNQLGDF-------------RTCGNGVVEVGEECDCGTIEECHE--SDPCC---------DPITCKLTAEAECA--SGPCC--DDCKLRPKGYLCRDAT-NECDLPEICDGRSGQCPLDIFKKNGNQCEINKGYCFNGVCPTLD------SQCRLIWGDGGLSADRKCFEQFNSQGSINGHCGLDSQNNYIRCDAEHVMCGSLQCGTPCGNN--LICMNKTCSSIYPYCPSNNVALDCSGHGVCSNVNSCFCDAGWTGHDC.......................................................................................................................................................................... 732
84 0.000e+00UniRef50_A0A146KY61 Disintegrin and metalloproteinase domain-containing protein 9 n=2 Tax=Cimicoidea TaxID=33355 RepID=A0A146KY61_LYGHE  ali  15  1.....MGCLQLFLAACFIVHTSTAEVEGKFLRPEDFSHPSVVRPSIVHARTKRHITSTRQEHIHDISMRVNIAGKEQIIDLQLNRDLIPKNHFIRHQENNPAPHELELCHYYGDIRGVPGSWAAISTCNGV-RGMVHDGNRPHYIE-----RAPENDGEITGNHLIYDHQDLVANHTCG------------FEGTPHDVLESIERVNVVARS------------KRSPQLIRGPYNADKRSRFVELVLVVDFKLYEGMNKNRSAVHNHCKDIANXXXXXXXXXXXXXX-------------------XXXXXXXXEFDEITLSTKGDTTLTNFLHYRRETLVKQQANDNAQ---LLTRVQFEGGVVGKALKGPICTYEFSGGVS--------------------------MDHSTVVGLVATTVAHEMGHNFGMEHDASS---CECPDDRCIMAASSSSTM---PTHWSSCSLTYLASAFEHGMDYCLRNRPE-------------RLFDPPVCGNGFVELGEQCDCGLKDR----CNNPCCN---------ASTCMLYSNASCA--TGECCDLSTCHPKTAGSMCR-TADHECDLPEYCTGESEYCPNDVFKMDGETCYEGKAFCYKGTCRSHS------DQCKLLWGPSGKSSDMKCYHMNTKGSRHGNCGYNRLNQSYIKCFDEHIYCGMLHCGAKCAEGK--MCVGQRCLPVGSLKVDSKCRNNCNGNGVCNSLGHCHCNTGFAPPDCHNPGTGGSEDSGPASQPNARRXXXXXXXXXXXXXXXXXXXKRNALLRRKPRTVIHEKKSHHHGGGAGGVRGPPPPISGPLNLDHSLLLPPRNEDSSSADLHNNLLGQTPIQHAPGKVPQESPKVAPSRPAPKVPPHQRAPEPPRHPEIHRPRPSNDVTTPSPATVPDGN. 881
85 0.000e+00UniRef50_A0A1X7UAN2 Uncharacterized protein n=1 Tax=Amphimedon queenslandica TaxID=400682 RepID=A0A1X7UAN2_AMPQE  ali  30  1MRLNRLLLIVFGSLLVSIAGADRSDPLLTRLSYYEPLSYSTHHLKTGHLMIKR----RSVPDDNKLHFTITAYNSTFNLLLWPSSDVFSPNVEFNVHQENGPSNYDPSTFYKGIIKGQPLSSVHGHIHDGVFDGEVRTAAGTTYHIEHMKYPGVTQHVPAGTHSLIYSDEHMIVPKSTCALK-----------KVLFDKLQSIQATGEPIHKKPRPLTDDEYYENERVKRNSKKVNTASGGRFCQIFVAVDHLFLQHV--------VGGSETMAISEVTTIFSSSQNIFQTTDFDSFDGITPQLVRTDI---------LNRDSYNGKFRSDNIDVNRYLNLWSEIDHSTYCLALLVTYRDFSDGVLGLAWVAQPPGGSSGGICEGRVRLSI-----GERSLNTAIASYLNYGARQPRGVVTITVAHEFGHNFGSPHDPSSQCSPGGSGGNYIMYPRATDGRQDNNDRFSPCSINSIYAVLTTK-STCFTN-------------------DGAFCGNAIRELGERCDCGIGDQTDCNRVDPCCTAGE---------CTLNPNAECSATDGCCV---SCQNATAGYVC--SEETECAAESLCTGNSSTCPEPYYR--NIPCNGGTRFCEEGQCTGSVCRTIGLVECQCTD--SDKLCQVCCITNDTD-TCTSTFELSSAGVLSVPGQYRDS-------GRSCNQFRGYCSDSNTCIGVDNERTLNDLLD-IFTLETLNN......................................................................................................................................................................................... 663
86 0.000e+00UniRef50_F6YN24 ADAM metallopeptidase domain 33 n=91 Tax=Eutheria TaxID=9347 RepID=F6YN24_HORSE  ali  18  85..................................................................................KNHRLLAPGYTETHYSPDGQPVHTDHCHYHGRVRGFPDSWVVLSTCSGM-RGLISLSSNSSYYVHP----GPAGDSKDFSTHKIFQMEQLLSWKGACGHRDPEDKGGMASLSHATQIRERREAHRSW--------------------------------RYLELYLVADHTLF---------LTQRRNLNHTKQRLLEVASYVDQILRTLD------IQVAVTGLEVWTEQDRSR----VTLDANATLWAFLQWRRGLWVRR----PHDSAQLLTGRAFRGATVGLAPVEGMCSAESSGGVST--------------------------DHSELPIGAAATMAHEIGHSLGLSHDPDGCCVEAAEQGGCVMAAAT---GHPFPRVFSACSRRQLRAFFRKGGGACLANAPDSGLLLP-----------RARCGNGFVEEGEECDCGAGQE----CPDSCCLAHN---------CSLRAGAQC--THGDCC--ARCLLKPAGTPCRWAA-GDCDLPEFCTGASPYCPPDIYLLDGSPCASGRGYCRDGACPTLE------QQWQQLWGPGSSPAPEACFQLVNSAGNAHGNCGQDSEGGFVPCAQRDAQCGKLQCGTQCGP--RMVCQDRRCQNI-TFRELERCVTACHGHGVCNSNHNCHCAPGWAPPSCDKPGFGGSVDSGP............................................................................................................................................................. 695
87 0.000e+00UniRef50_U3KEU1 ADAM metallopeptidase domain 8 n=30 Tax=Archosauria TaxID=8492 RepID=U3KEU1_FICAL  ali  17  2..........................................................QSTYPDHVLYSVRAEGREYLLWLEKNRALLGQHYTETHYSADGSPDTQDHCFYQGRVRGHPGSAASISTC-GGLSGFFRV-NETTFLLEPLEGAVAGRHAVYRAAHLRGKRGTCRQPGATLEYDHEPKIPAAMKL------------------------------------YRWKSGPVQKGPRYVELVLVADNQEFRKHKDLRT----------VQNRMKEIVNHVDKLYQPLR------LRVALIGLEVWNHRDK----ITVSPNPEVTLDNFLHWRESELLRKKPHDNAQLI---TGVDFHGNTVGLAKKLVMCTRDSGG---------------------------VNQDHSTNPIGAASTLAHEMGHNLGMSHDEDCRCPVPKADGGCVMAGSV---GLVYPKLFSQCSEQDMWQFLGDPRTSCLLNAPRADELYG-----------GPVCGNQFVERGEQCDCGTPEE----CTDRCCN---------ATTCQLREGAECA--RGECCQ--DCKVKAAGALCR-ASKNDCDLAEHCSGLSAECPEDVFQENGISCQHGKGYCYNGACPSH------GEQCRALWGAEAQVAPDVCFKHNSEQHVHLHCLTEYGKQ---PCSPKDVKCGTLLCGAKCGEE--MVCYAGRCQNLQVYG-DKNCSAKCNNHGVCNHRRECHCDPGWAAPYC.......................................................................................................................................................................... 629
88 0.000e+00UniRef50_A0A0C9QXZ9 Adam11_0 protein n=22 Tax=Pancrustacea TaxID=197562 RepID=A0A0C9QXZ9_9HYME  ali  18  68...............................HNYQIIYPVQLRHHEKMGISTREARSRAGKHFHRTSLLIKAFNHKFRLDLELNTQLLAPNLIQKDFLSRDVEQEIEHCYYHGTVRDYPGASAAFHTCNGV-SGVIHLGN-ETFVIQPFYGGDLSRHPHVIFEA---------------------RTKANKGCGIAGNLERRLAKNRRQ----------KHVLGLSESIGDRYKRDVREATKYIETAMVIDKAMFDKRN--------GSSRAEVVHDAIQVANIADLYFRTLN--------TRVSVVYIETWSGGNQASIETGMEINRAIHNFNDYTIRKLYQ----ITEDTIQMLTGETFQGGESGVAAHETVCSPKSVGISVDLNTYE--------------------------PHLLAGTMAHMIGHNIGMKHDDGRENCFCRDWHGCIMAQSIVGADNVQPYKFSECSKADYEEALRSGHGICLFNKPNELET--------------RLCGNRVIDDGEECDCGTLDDCPD--IDPCC---------DPITCKLKAEAECA--SGPCCN--ECKLLPRGSICRESS-NECDLPEVCSGETGQCPVDLYKKNGKPCANNQSFCFGGLCPD------LNVQCTQVWGENGKAADMQCFEEFNSKGSINGHCGTDPAGHFVKCESRNVRCGSLQCGTSCGEN--LVCVNQTCTNVFPKCPSNQHNLECSGNGVCTNINKCHCEIGWSGPDC.......................................................................................................................................................................... 750
89 0.000e+00UniRef50_W5LMN1 Uncharacterized protein n=2 Tax=Astyanax mexicanus TaxID=7994 RepID=W5LMN1_ASTMX  ali  18  3............LTCVCVFVCVSGELRLELLSEYELVRPVRLNTHQQ--------KHTQFSHTDTVSYRLELQSNIITINLRRNRDLISSSYTETHYTPNGTRVTTDQCYYLGSVGDEQQSVVSMSTCDG-LRGFFRTGGQDYVIEPLTDGEAGD----------------------HAVFKAEFLKNKNLLCGVTEKTVESVLP-----------------AFNTKGSRRAVQDALMDEQKYIEMYLVVDNSEFQNLGSD---------INKVRKRMFQIINFVDMVYLPLHTF------IALVGLEVWSDRDK----INVSSSASNTLTAFTQWRINQAKTFKQNDNAQLI---TSMNF-GDVVGLANVGTLCTPD---------------------------SCSVIRDFSSNALATGAVLAHELGHNLGMEHDEP---TCSYSSAHCIMSAEL---SNPPPEKFSNCSVAEYREFLQTTSATCLLDKPAEGSIIAP-----------PICGNNFKEEGEECDCGLVEE----CTNPCC---------DAATCTLTPGSQCS--SGECCN--NCKLVPVDSLCR-SVMSECDLPEYCTGASGDCPADTYREDGLPCRNNSGYCYHGHCPLR------LDQCIQMWGDTAEEAPESCYDLNTKGTDYAYCRRPR-TQEYIGCPQKDVLCGTLQPGTKCGD--GLVCSNGACVELEEAYGEPNCSKACTGNSVCNNIGECQCTPGWVPPDCTT........................................................................................................................................................................ 645
90 0.000e+00UniRef50_Q9BZ11 Disintegrin and metalloproteinase domain-containing protein 33 n=157 Tax=Gnathostomata TaxID=35060 RepID=ADA33_HUMAN  ali  18  83..................................................................................KNHRLLAPGYIETHYGPDGQPVHTDHCHYQGRVRGFPDSWVVLCTCSGM-SGLITLSRNASYYLRP---WPPRGSKDFSTHEIFRMEQLLTWKGTCGHRDPGNKAGMTSLPG---------------------------------GPQSRGRREARRTRKYLELYIVADHTLF---------LTRHRNLNHTKQRLLEVANYVDQLLRTLD------IQVALTGLEVWTERDRSR----VTQDANATLWAFLQWRRGLWAQR----PHDSAQLLTGRAFQGATVGLAPVEGMCRAESSGGVST--------------------------DHSELPIGAAATMAHEIGHSLGLSHDPDGCCVEAAESGGCVMAAAT---GHPFPRVFSACSRRQLRAFFRKGGGACLSNAPDPGLPVPP-----------ALCGNGFVEAGEECDCGPGQECRDLCC-------------FAHNCSLRPGAQCA--HGDCCV--RCLLKPAGALCR-QAMGDCDLPEFCTGTSSHCPPDVYLLDGSPCARGSGYCWDGACPTLE------QQCQQLWGPGSHPAPEACFQVVNSAGDAHGNCGQDSEGHFLPCAGRDALCGKLQCGTQCGP--RMVCQSRRCRK-NAFQELQRCLTACHSHGVCNSNHNCHCAPGWAPPFCDKPGFGGSMDSGPVQAEN----------HDXXXXXXXXXXXXXXXXXXXXXXCCYRLPGAHLQRCSWGCRRDPACSGPKDGPHR----DHPLGGVHPMELGPTATGQPWPLDPENSHEPSSHPEKPLPAVSPDPQADQVQMPRS.......................... 810
91 0.000e+00UniRef50_A0A1D1UZB6 Uncharacterized protein n=1 Tax=Ramazzottius varieornatus TaxID=947166 RepID=A0A1D1UZB6_RAMVA  ali  19  10.....IVMCWIVLLSIFLWTTDAAGELAQEFHKFDIASPVVSVIRNSED----DLLHYGPIKPERRRLQFTAFERLFDLDLDLNGDLVPNRFKVSVVEGDTSWPKTENCRYRGKLRGSAGSVAAISICKDGIRGYIQDGAKEVYYVEPVE--------SGLKQIVIVRDSDKISESKNCGVDLDSSSKHGAAN----------------------HSLVSSLSAMRTKRSIKPPSTSNADSLFVELVLVADTKVYERYVKNETR---------VTNRFIEIVSVVNALYAPL------NIFVALTGVEIWTTVDK----ISITNDSEVTLKNFLRYRKKELALRLSNDNAYLITLAT---FDGMVVGKALKGQMCTYEYSGGVAK--------------------------DHSRMAGPVAATVAHEMGHNFGMEHDFTD---CQCLDDRCIMTPASVGQTPSN---WSSCSRKYLEDNLARGIGSCLKRAPQKVE--------------GAYCGNGFLEDGEECDCGPDE----FCHNKCCI---------AAACKLSVNATC--GHGSCCDLDTCSPKKESTVCRERTSDECDLPEYCDGKVGTCPHDFWKDDGTTCRDGQAYCANGACRTH------KDQCAYLWGSTGNVADDKCFELNVKGNANGNCGRDRVNENYTMCAVRDTKCGLLHCGAKCGED--MMCYNQVCTHIS-NVPRKCSASSCSGHGVCNNLGHCHCDAGYAPPDCSYSGYGGSIDSGPA............................................................................................................................................................ 701
92 0.000e+00UniRef50_A0A267EUM0 Uncharacterized protein (Fragment) n=4 Tax=Macrostomum lignano TaxID=282301 RepID=A0A267EUM0_9PLAT  ali  34  58...........................SETVLDHDRLSYAPVS-ERHHRRAKRSAPLAG-----QVDLAFPAHGRQFRLRLEHNSRVAAPGAVLEFDGRVEPLSFPE--AVTGRLIDDPGSWAFGSLIDGVFRGSIHESSGSGWYIEPAAHYFNGRRE---FHSIMYNDSHVQWPKRYKRSALLHPPAVADSIGPPCGLADSSIANQLSRQSANPSLRQMKQQPPSRSRSSRWADSGRPDPKVCSLYMQSDTMLWEAMGLSNVNGDRDRAKTEIKALFQHHVSAASAIYSGTRFVSRDGIQFTVNRVRINTTADCSQPHV-----NKFCNRNIDVTNFLNLHAYSNHSEHCLAYLFTYRDFNGGTLGLAWVGTKDQN--GGICEKYREYDDQAPGRRAKSLNTGIVTLVNYGRRIAEKVSYLTFAHEMGHNFGANHDDGAECQPTADQGNYIMFSSATTGDLPNNKQFSQCSRESIGTLLRNGKQNCLR-----------------PSDDASFCGNSLLEPGEDCDCGYEDE----CTDTCCVPK-SAKGVNANACRVAAGKACSPSGNPCCTAS-CNYSDSSIQCR--AETDCTYATACSGGNQTCPPPLSKPDNTTCNGNTKLCRSGGCELSICSLIGWEECLQSSEDTDADASSMCYRPNNATPCVSSSRQDRTSPLYSILQRVNQQGLQLQVGSPCDNYRGYCNAYYECRRVDSKGPLGRLQDLLFSPETLELVKNXXXXXXXXXXXXXXXXXXXXXXXXKACAVHTPSSNPQRAAHRKLT......................................................................................................................................... 815
93 0.000e+00UniRef50_A0A195BHR3 Disintegrin and metalloproteinase domain-containing protein 11 n=203 Tax=Neoptera TaxID=33340 RepID=A0A195BHR3_9HYME  ali  15  121...............................HYYQIIYPVQLRHHEKMGISTREVRLRTGRHFHRTSLLIKAFNHKFRLDLELNTQLLAPNLIQKDFLAGNSKQEIEHCYYHGTVRDYPGASAAFHTCNGV-SGVIHLGN-ETFVIHPFYGGDL-----SKHPHIIFEARTKVNKGCANSGNLEWR---------------------------VKNRRQKHIFGLSETISDRYKRDVREATKYIETAIIIDKAMFDKRN--------GSTRAEVVHDAIQVANIADLYFRTLN--------TRVSVVYIESWKGSNQAQIDNGIDIDQALLSFNDYTM----RRMYQVAQDTTQLLTGETFSGGESGVAVPETVCSQRSVGISVDLNTYE--------------------------PHLLAGTMAHMIGHNIGMSHDDGRNDCNCRDWHGCIMAQSIVGLENVQPYKFSECSKTDYIEALKSGHGICLFNKPNELEI-------------RRSCGNRVIDDGEQCDCGSIEECKEY--DPCC---------DPITCKLTTEAECA--TGPCC--SDCKLRARGVVCREST-NECDLPEMCTGDTGQCPPDVYKKNGNSCANNAGHCFNGICPALD------LQCEQVWGYGGIAADQECFEQFNSKGSINGHCGTDSSGHLIKCESENVRCGSLQCGTSCGDN--LICVNQTCTSLFPYCPSNHDDKECSGNGVCTNVNKCHCFLGWSGPDC.......................................................................................................................................................................... 803
94 0.000e+00UniRef50_G3WJ67 Uncharacterized protein (Fragment) n=3 Tax=Sarcophilus harrisii TaxID=9305 RepID=G3WJ67_SARHA  ali  32  6............FLMFPSSLGGQTECSRSFIRYHEQVSYNRAALDQELWRIHRAKSGG----EESVQLDFQAYQRTFKLSLKRDNSIFSKDFELTGMRRTTSFNV--SFLYSGELRDEPGSSCHGSIISGLFEGIIHTKDGTFYVELTKASSGNEKEPRRS---IIYHQREIDKSTNQREEEGKEGGCFGYHSTF------------VFLRTFALTGNHQSPTIPEKETLPRQRRSLDYSRTSCLMHFKADFLFYKRFG----------SLESVVAQIASYVKAVNTIYEKADFGGIKYIDFKIKTLHKGSVLNKTVVQ-EDDPTSSMYSPFIGPEKLLMLHAQSNWDGYCLSYLLTDRDYSG-ILGIAFNGQA--GDLGGICSKHRMFQ-----GSLRSLNTGLITIQKYGHYLPPRIIHITLAHELGHSLGAHHDESQQCARFSTHGNFLMFAHATDGDQPNNDRFSPCSTTFIGKTLRGKKDQC------------------FVETDRPICGNHVLDPGEGCDVGSST------TDPCCY---GAGESEGLRCRLKAGVQCSPSQGPCCSPD-CKYFSMGKLCQ--SETECLWESTCLGNAAYCPVPLPKANFTPCLMGAKICLDGSCRGSLCLNHGLEPCECVSISPWEQCHLCCQKP-------GRPRTCASTTSSLLRSEFNGSRVPLTPGTACKGRQGYCDKFHICRLVDEDGPMARVKNAIVGFMELEDPAAWMKTRWWAI............................................................................................................................................................................. 668
95 0.000e+00UniRef50_A0A162QEG4 Disintegrin and metalloproteinase domain-containing protein 28 n=9 Tax=Daphnia magna TaxID=35525 RepID=A0A162QEG4_9CRUS  ali  17  31..................................QFARHRTFRPSAYHGREKRQLLHTRREHVNDLSIIYSLDNDSYILDLRLNRDLVPDGYFEKYHQDGEQITERSNCQYQGQIRHVPKSWAALSTCAG-LRGVIFDGQELHYVEPQSGSSLDDEHLLMKHSDLTANFSCGTHSALPH-------------------------------SSHSHPRVRRQTDLPSGTPAASGPFKANSRSRYVELVLVVDNKSYESQDKDLNRVFRRCKDIANXXXXXXXXXXXXXXXXXXXXX-----------------SEKDEIQISVKGD--ETLTNFLHYRRVRLSKEHPNDNAQ---LLTGVQFQGGVVGKALKGPMCTYEFSGGVA--------------------------MDHSPTVGLVATTVAHEMGHNFGMEHDNDSLCHCPDD--KCIMAASS---SAVSPTHWSSCSLENLALAFEHGMDYCLRNKP-------------VSLFKSPECGNMFVEDGEECDCGLP----GRCDNPCCN---------AHTCKLHVNATCA--TGDCCDTATCRMKNAGSPCR-SSLQECDLPEFCTGKSEYCPVDLHKLDGTSCGQDKAYCYEGSCRSHS------DQCRLLWGPSGKGSDAKCYDQNTHGNKTGNCGYLKANDTFAKCLDENTHCGLLHCGAKCGHNK--MCVDQRCVAVSSI-IKAGCPQKCGQNGECNNLGKCHCKVGFDPPYCQHFGAGGSEDGGPA............................................................................................................................................................ 699
96 0.000e+00UniRef50_A0A1U7RNS3 disintegrin and metalloproteinase domain-containing protein 10-like n=10 Tax=Amniota TaxID=32524 RepID=A0A1U7RNS3_ALLSI  ali  32  27......................RPEHLRPFVKYHERVFYDTEALEQLHQRSKRAA----EEHETLIQLEFQAYRRTFKLRLSRDTSAFTKDFEIQV--KDTLKPGDVSFIYSGDLHDEPGSFCHGSIHNGLFEGFIRTKNGTYYVESAGACTSTSPGHSLIHHERDIDYSLLEDP----------------------------DSAALTERAHQILQHFQQELKLKGETLEREKRSLDYSRTSCLLHLQVDYLFYQRFG----------TTEAVVSQVASYIKAVNAIYEGADFDGIKHVDFKVKTLSIIQE---------DDPSGSRDSPYIGPEMLLLLHSKSNWNTYCLSYLLTDRDYSG-VLGIAFNGQ--TGDLGGICSKHKKFQD-----QEASLNTGLITLQNYGQYLPPRIIHIVLAHELGHSLGAHHDESKECARFNTYGNYLMFGHATDGWQHNNDRFSTCSIEYIGKLLRAKKDTC------------------FVETDRPICGNRIVDPGEECDVGNDI------SNHCCYAAR---EPNGIGCRLKPGAQCSSSQGLCCSQD-CVFKSQGELCQ--EETECAFASICSGLAAQCPTPVPRDNGTFCSRGTRICLAGLCLASLCVKYGLEQCDCVSSSMREKCHLCCQQPGQARTCAST--------------------IPLTPGSPCWDKTGYCDKFHTCRLVDEDGPIARVKNSILAFIELEDVAAWMK................................................................................................................................................................................... 639
97 0.000e+00UniRef50_A2AP51 A disintegrin and metallopeptidase domain 33, isoform CRA_b n=25 Tax=Boreoeutheria TaxID=1437010 RepID=A2AP51_MOUSE  ali  18  64..............................................................PDSVLVALEAEGQDLLLELEKKHKLLAPGYTETHYRPDGSPNHTDHCQYHGRVRGFRESWVVLSTCSGM-SGLIVLSSKVSYYLQPR---TPGDTKDFPTHEIFRMEQLFTWRGVQRDKNSQYKAGMASLPHV---------------------------------PQSRVRREARRSPRYLELYIVADHTLF---------LLQHQNLNHTRQRLLEVANCVDQILRTLD------IQLVLTGLEVWTEQDLSRI----TQDANETLWAFLQWRRGVWARR----PHDSTQLLTGRTFQGTTVGLAPVEGICRAESSGGVST--------------------------DHSELPIGTAATMAHEIGHSLGLHHDPEGCCVQADEQGGCVMEA---ATGHPFPRVFSACSRRQLRTFFRKGGGPCLSNTSAPGLLVLP-----------SRCGNGFLEAGEECDCGSGQ----KCPDPCCFAHN---------CSLRAGAQCA--HGDCC--ARCLLKSAGTPCRPAA-TDCDLPEFCTGTSPYCPADVYLLDGSPCAEGRGYCLDGWCPTLE------QQCQQLWGPGSKPAPEPCFQQMNSMGNSQGNCGQDHKGSFLPCAQRDALCGKLLCGEPNPLVPHIVTMDSTCRGAFVDLGLVEPGTGCGPRMVCNSNRNCHCAAGWAPPFCDKPGLGGSVDSGPA............................................................................................................................................................ 669
98 0.000e+00UniRef50_O35674 Disintegrin and metalloproteinase domain-containing protein 19 n=133 Tax=Euteleostomi TaxID=117571 RepID=ADA19_MOUSE  ali  15  9.......RFCLLALALQLHWPLAACEPGWTTRGSQEGSP-PLQHELIIPQWRTSESPGRGKHPLRAELRVMAEGRELILDLEKNEHLFAPAYTETCYTASGNPQTSDHCFYHGTVRDVDESSVTLSTCRG-IRGLIIVRSNLSYIIEPVPN--------SDSQHRIYRSEHLTLPPGNCGFEHSGPTSKDWALQFTHQT---------------------------KKQPRRMKREDLHSMKYVELYLVADYAEFQKNRHDQ---------DATKRKLMEIANYVDKFYRSL------NIRIALVGLEVWTHGDKC----EVSENPYSTLWSFLSWRRK-LLAQKSHDNAQLI---TGRSFQGTTIGLAPLMAMCSVYQSGGVS--------------------------MDHSENAIGVASTVAHEIGHNFGMSHDSAHCCSASAADGGCIMAAAT---GHPFPKVFSWCNRKELDRYLQTGGGMCLSNMPDTRTLYG-----------GRRCGNGYLEDG----EECDCGEEEECKNPCCN---------ASNCTLKEGAECA--HGSCC--HQCKLVAPGTQCREQVR-QCDLPEFCTGKSPHCPTNYYQMDGTPCEGGQAYCYNGMCLTYQ------EQCQQLWGPGARPALDLCFERVNAAGDTYGNCGKGLNGQYRKCSPRDAKCGKIQCGTHVYRGGTKCGHNHICFEGQCRNTSEGCGKKCNGHGVCNNNKNCHCFPGWSPPFCNTPGDGGSVDSGPLPPKXXXXXXXXXXXXXXXXXXXXXXXHCYRQSHKLGKPSALPFKLRHQFSCRVSQSGGTGHANPTFKLQTPQGKRKVTNTPESLRKPSHPPPRPPPDYLRVESPPAPLPAHLNRAAGSSPEAGAR............................... 826
99 0.000e+00UniRef50_UPI000854F646 disintegrin and metalloproteinase domain-containing protein 15 n=1 Tax=Nanorana parkeri TaxID=125878 RepID=UPI000854F646  ali  15  5.TSTTMCLLLTLSSALRSPQTGFALPVSEQMPYWEV--YPQLSSSDG---RRLTPQEVVGDPPSHLQLSLVINGTWIHMKLQQNRHLTPDFHTLSFYLPDGTRVTENSCYYQGRLAGRSGPWSSLSLCSG-LRGILALEQ---------QYSMEPVLGDPSFKHILRPVGDHRNITCETRDAARTSTNHKPGRTLLSMGDPQSDQEELALPHLAGG------------APDQVQRSWISETKYVELVMVADNSEYELYRRD---------LNALHTRILEIANRMDAFYRT------VNIRVILVGVEVWNQKD----QITVSSDPAETLNHFLSWREKELLRRIHHDNAQ---LLTGVTFQGSAVGMATVDSICTADCSGGVS--------------------------MDHSVSILGVASTVAHELGHNLGLNHNVDGKCGQPSTGKYWIMEQGTRAGYMPG-LEFSNCSRSELDAIFKQGGGKCLFNVPSPS-----------SVFGQARCGNLVVEKGEECDCGLTQE----CTDPCC---------NASTCQLVAGAECA-SDGLCC--EQCKIQPLATLCRP-PLGDCDLPEYCNGVSPHCPANTYLQDGETCARGQAHCYKGECRT------LKSQCQSVWGPGSSPAPEACFKKVNMRGDRFGSCGRRTNGTYLPCSPRNALCGTIQCGTVCGLGK--VCVDQRCQDVAVLKAL-TCTNNCNGHGVCNSNSNCHCDRGWAPPDCGRSGDGGSVDSGPMALERXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVSLQRKSNGSKCQYRVTQNSSELRPQRPPPPHWTQSTELQVMSASNQDYSFALPAQSNIEGYDRPDPPSKPLPPDPVP---------RPSQADPQERPPAPNRPLPADPR............ 850
100 0.000e+00UniRef50_UPI00078AE183 mmd, isoform E n=44 Tax=Holometabola TaxID=33392 RepID=UPI00078AE183  ali  17  63...............................HYYQIIYPVQLRHHEKMGISTREVSGRTKKHFHRTSLLIKAFNHKFRLDLELNSQLLSPNIQQKHYHVDGNRHDIEHCYYHGTVKDYPGASAAFHTCNGV-SGVIHIGN-ETFVIHPFYGGDL-----SKHPHVIFEARTKANKGCANSGNLDSWRLSRRTKHLSAGVAGVVEEILQAG-------------------VGRNKRDVREATKYIETAIIVDKAMFDKRN--------GSTRAEVIHDAIQVANIADLYFRTLN--------TRVSVVYIETW-GKNQAVIDGSKDISKAISNFNDYTSRNLFQIER----DTTQLLTGETFAGGEAGMAVPETVCTPRAVGISVDVNVYE--------------------------PHLLAGTMAHMIGHNIGMGHDDGREECFCRDWHGCIMAQSIVGQENVQPYKFSECSKKDYIDALRTGHGLCLLNKPNEIELRRN-------------CGNKVVEEDEECDCGTFEECAL---DQCC---------DGITCKLKSEAQCA--SGACC--DQCRLRPKDYICRDS-NNECDLPEYCDGEIGQCPSDVFKKNGSPCGLSSGYCFQGYCPTLS------LQCEAIWGYGGSAADRQCYEQFNSKGSINGHCGRDANEHYIKCEPENVQCGTLQCGTPCGDN--LICLNQTCVSLFPHVDQTKCPANCSEHGVCTNTNRCFCDMGWGGNDC.......................................................................................................................................................................... 754
101 0.000e+00UniRef50_A6H8I8 LOC100101326 protein (Fragment) n=7 Tax=Xenopus TaxID=262014 RepID=A6H8I8_XENLA  ali  16  46.........................................VTPELHRRGHRLSLQDVMRTLPSDLHMSMEIDGNQVELDLEWNRHLLPESHSLTYYLPNGSHVRVENCYYHGQLEGQTGPWSSISLCSG-IRGIILTSPERGYSIEP-------LPGDPPHKHIVRLTPGNSRNSTCGSTEAPQS--------------------------------------LKLSPHHRIKRDVVTEAKYVELVLVADNTEYKMF---------SGDMKSLHLRILEIANKVDAFYRPL------NVRVALVSVEVWNQKD----QINVTTNPAETLYHFLSWREKNLLPRVTNDNAQ---LLTGITFMNSSVGMATMNSMCSAGYSGGVS--------------------------MDHSVTILGVASTLAHQLGHNLGLSHDTDRKCGQPSKGKKWIMEPS---GGFLPGLEFSNCSFTDLEFSLRRGGGMCLFNVPPPKRLFG-----------EPQCGNFLVEEGEQCDCGLSQE----CTDQCCES---------TLCQFRGGAECS-SGDQCC--EGCKLKVSGSMCR-EPLGVCDLPEYCNGESPHCPPNVYLQNGETC--DQGYCYQGECRT------IQAQCKDLWGPGSSPAPDPCFSKVNIRGDKYGNCGRSLNGTYLPCAERDVWCGKIQCGTPCGAGK--VCVGHKCEDVSKLKV-QNCRSKCNGHGVCNSNRNCHCDAGWAPPDCAASGQGGSIDSGS............................................................................................................................................................. 687
102 0.000e+00UniRef50_UPI0008550C9A zinc metalloproteinase-disintegrin-like batroxstatin-2 n=1 Tax=Nanorana parkeri TaxID=125878 RepID=UPI0008550C9A  ali  21  26...............................QRYEVVYPRKL-----HTQHKRDTQS---KYPDLVHYGLEFNGRPLELQLQKTEDLLTNNYTETHYLDDGTPVTQDHCYYQGHVKNDNNSQVSLSVCHG-LSGFIMTQEQKLLIEPLNKTEDGAHAVYT-----------------------YQAQEAPKTCGVDDTMYND-----------------SIQTKISFSISNAEKTAFLRARKYIELYIVADYSMFIKYKS---------NKALLRERVYGIVNFVNLVYKPL------NIFVALTGLEIWDTGD----QFQVVTLANTILNDFSKWRENDLLPRKPNDNAQF---LTHTDFDGATVGLAWVSTMCQDFHS--------------------------TGVIQDHSIEYVPVGATIAHEMGHNLGMDHDGIS---CLCSSKSCIMAPTL---SYNTPREFSSCSHQNYQDFLLKNMPLCMRDMPDKKDIV-----------SAAFCGNKFTEVGEECDCGTVEE----CTNKCC---------DAKTCKVKENAQCA--EGECC--SDCKLKTAGSVCRAATD-DCDLSDMCDGTSATCPSDRFRINGFPCRNGEGHCYNGKCPTHQ------SQCLMHWGQGWVAGSDTCFSLNTRGRE----GFCRHNGVNVRCPVKDVNCGLVKDGTRCGEES--VCQSGSCTSIDAAYKSRDCSAKCPKNAVCDHELKCHCEEGWAAPNCDT........................................................................................................................................................................ 632
103 0.000e+00UniRef50_A0A0C9RC68 Adam12_4 protein n=6 Tax=Opiinae TaxID=68883 RepID=A0A0C9RC68_9HYME  ali  17  13.....LWCASIVFIIQSTSQVRGAPGPSSEFRTYARVQPRVFHRNNQITT---HTKINNSSHPQVLRVDLNIDGVSRTIDLRLNIDLISSGYRQVHHSKTEVPETVELCHYHGSIRGIRSSWVAVSTCRG-LRGVIYTGKTLHH-IHPEEDSLSSLHYLYSHSDLISNKTCGTPGVAHDFPRKKREVPWGYPKG---------------------------------------PYNSNRDSRYVELALIADTTI---------YKNLDRNLNNVHHHLINLANIINALYTPL------NVFVALVGVEVWTSRD----EIVITTDSLRTLTNFMNYRKSKLLNKIPNDNAQ---LLTATRFQDGVIGKAGVGAMCTLSSSGG--------------------------VIRDHSDIVGVVAATIAHEMGHNFGMHHDANY---CNCPDEDCIMVSTLTSST---PTHWSSCSLEQISASFSQGLDYCLRNRPKS-------------LFGGSTCGNGFVEPGEDCDCGSK----DNCHISCCNPN---------TCTFRGNASCA--TGECCDLSTCQLKRAGVTCRIAER-ECDLPEFCTGTSEYCPEDIYKINGLVCRGGTAFCYEGLCKSH------GDQCRILWGLSGSSSPRVCYQQNTKGSEYGDCGYNPLDSTYSPCEEVDILCGRLHCGARCAEGK--VCVDQRCRLLGRVDRSSSCLKNCSGNGICNSIGKCHCDEGFAPPDCRRGGTGGSEDSGP............................................................................................................................................................. 696
104 0.000e+00UniRef50_A0A146PLK2 Disintegrin and metalloproteinase domain-containing protein 19 n=24 Tax=Euteleostomi TaxID=117571 RepID=A0A146PLK2_FUNHE  ali  15  41.....................SRQRRVLEHVQSYEITSPVWLDPL-------RLIRSASKEHPAEVQVLISAEGQQLRIHLEKNEQLLAPGYQEIWYTPDGPPASSANCFYHGGVVGMEGSSVAVSTCSG-LRGLISLNASVSYLIEPL-----PGSTDAGQHAVFKAESLHLPEGSCTHHRGNEEHQGGL---------------------------GDFIRGAALPRSGREKREVMQNMKYVELLLVADRAEFERH---------EMSFHKTQHWLLEAANLVDKYYK------ALNIRVALIGLEVWTDQDK----INVSSNPHSTLAAFLSWRRKMLKTLPN----DNAQLVTGVAFKGSTIGLAPLKTMCSEYQSGG--------------------------VNTDHSPQPVGVAATIAHEMGHNFGMNHDREGCCQAKAEDGGCIMAAAT---GAPFPRVFNDCNLKELKRYLSSGGGKCLFNLPNINSLYG-----------GQRCGNGYLEQG----EECDCGEEEECTTPCCNANN---------CTLKAGAECA--HGVCC--HNCKIKSPGELCR-ATSGLCDLPEYCDGKSESCPSNFYLADGSSCAHGRAYCYTGMCLSLE------QQCQSLWGQDARPAPDLCFIEVNKAGDMFGNCGKNQEGKYRTCGSRDAKCGKIQCTTVKMNSKRTVCFNGECRNASFLRADECN-AKCHGHGLCNNNENCHCEPGWAPPWC.......................................................................................................................................................................... 702
105 0.000e+00UniRef50_A0A0N8K2X4 Uncharacterized protein (Fragment) n=1 Tax=Scleropages formosus TaxID=113540 RepID=A0A0N8K2X4_9TELE  ali  19  1......................SFRPELDGVKDYEVITPVRL-----HTLHRRDTQTSR---PDVMKYKIPVEGKDTVMHLEKNEGLLAEGYSETTYTQDGTPVTSDDCYYHGRIVNDSESTVSLSTCDG-LRGYFRTA-ARQYLIEPLSGAEDGAHALFKYEAV---------------------NAEPPVCGVTNSSWEPVYPPLI-----------------SKSRSRSSGLSPLQQQKYVELYLVADNREYKKMNSD---------INEVRKRIFEIVNYVNVVYKPLKTF------IALIGLEIWTDQDK----ISVTTPAGSTLDAFTNWRNNYLLKTKPHDNAHLILSCSGIDFDGATVGLAYIGSLC---------------------------TGHSTGVVQDHNSRAIAVGATLAHEMGHNLGMNHDSSS---CICTGSTCIMSAALSYDIPEN---FSSCSDANYEQFLTSRNPPCLFNKPDY-----------MSLISTPKCGNGFVENGEQCDCGTVEE----CKNPCC---------NATTCTLTAGSQCS--AGDCC--EDCKFTPPSRVCRRQQD-ECDLAEYCTGKSTECPEDVFTVNGLPCKGGQSYCYNGLCPTK------ADQCVKVWGSTAEVAKPSCYDQNTRGTYYAFCN-RPSREQYIGCQKKDVMCGKLFCGNDNPNYNRFV-KFLDCKAIFSDDPDNDFGTKCGDGMVC........................................................................................................................................................................................... 616
106 0.000e+00UniRef50_E0VJV8 ADAM 19 precursor, putative n=1 Tax=Pediculus humanus subsp. corporis TaxID=121224 RepID=E0VJV8_PEDHC  ali  15  11.......................GSRPSKDFTEHSVTKPRIYHGRTKRELSRSHDPGEKGGHAPDLIISLHLDGIERILELTINYDLISKSYFEKYHVHKPTPDEMELCHYNGYIRNVPGSWAALSTCTH-LKGIVHDGKETYYV---------DKGPEEGFNYVY----------------------------------NGKHINPNKTLSCGFPQSDKLLRLKRDTDAIRGPYNANRQSRYVELLLVVDHEEYKALGD----------LKDVYQHCKDITNXXXXXXXXXXXXXXXX----------XXXXXXEKNEIFLSTNGDKTLTNFLLYRKEFLVKKHPNDNAQ---LLTRVQFDGGVVGKALKGPICTFEYSGGI--------------------------FMDHSSVVGLVATTVAHELGHNFGMEHDRSD---CECPDDRCI---MAPSSSAMSPSHWSSCSLEFLAQAFEHGMDYCLRNKPT-------------KLFDSPVCGNGFVEPGEQCDCGLPHR----CNNPCC---------NATTCMLFANASCA--TGECCDFETCKPKGAGIECR-SAEHECDLPEYCTGESEYCPSDVFKIDGDSCSKGKAFCYQGKCRSHS------DQCQLLWGPSGKNSDTRCYEKNINGNMHGNCGYNRLNKTYVKCYSENVYCGMVHCGAKCGEGK--MCVNQKCMSVGDLSNLESCPNNCSGNGICNSKGHCHCNRGFAPPLCAYPGAGGSTDSGPA............................................................................................................................................................ 675
107 0.000e+00UniRef50_A0A1U7SCS4 A disintegrin and metalloproteinase with thrombospondin motifs 7 n=7 Tax=Euteleostomi TaxID=117571 RepID=A0A1U7SCS4_ALLSI  ali  14  6................................DYDVVHPIKVDDLSQRAVHKRALSPRTGLPA---FYELHYKGQHLRFNLSLNSQLLAPGFVSERRYGGIAEAKIHSCHMLGEVQSQKGGLAAVSTCDG-LKGAFRLANED-YLIEPLPVNTHEDRAARPHRIYKRHAPKHGQEDLMVESSRKQERNQPTTVRTCGXXXXXXXXXXXXXX--------XXXXXXXQQKKRRIKQRSISKEKWVETLVVADTKMVEYHGS-----------ENIEKYVLTVMNMVAGIFHDASIGNPINIAIVRLILLEDDEEELKITHHADNTLRSFCKWQKSINVK----GDSHPQHHDVAVLLTRKDICCETLGLSHVSGMCQPHRSCNINED-----------------------------TGLPLAFTVAHELGHSFGIQHDGSGNDCEPVGKRPFVMSPQLL--YDTSPLTWSRCSREYITRFLDRGWGLCLDDPPAKDVVDFPLVPPGVLYDVSHQCRLQYGQYSTFCDDMDSVCNTLWCTVG----NTCHSKLDAAVDGTKCGENKWCFNGECMPVGFRPDAIDGSWGAWSSWASCSRTCGTGVQNAERQCSNPTP-----KYGGKYCLGERKRFRICNIK-----PCPADKPSFRQLQCSQFDYKWTPVLHNVNLCELHCRPEDDYFAEKLRDAVIDGTPCYDGNGDICINGICKNVGCDNAVEDRCGVCHGDGTCQTVKK...................................................................................................................................................................................... 677
108 0.000e+00UniRef50_A0A2P2HXI6 Disintegrin and metalloproteinase domain-containing protein 10-like (Fragment) n=2 Tax=Pancrustacea TaxID=197562 RepID=A0A2P2HXI6  ali  43  111...................................................................................................................................................................................................SNPSLYTKYKQLYHKLQRDYHNKYSEDANMRSKRSISSGGVGEDNKGTCTLSIQTDPLLWRYIYQQEKN-DSIKTRDEITAMVSQHIKAVNHIYGDVVFHGHKGIRFEVQRIKIDDDSGCPRYGSHRNLGNDFCKTNVDVSNFLNLHSQTNHDDFCLSYVFTFRDFTGGTLGLAWVASP-SGASGGICEKYKTYTENLAGTEQRSLNTGIITFLNYNSRVPPKVSQLTLAHEIGHNFGSPHDFPSSCKPGGREGNFIMFSSATSGDRPNNNKFSSCSVRNISQVLDAIAEN--------------RRKNCFKATNGTFCGNKIVEDGEECDCGYDDAD---CEESCCYPRDTKLNSSAKMCSRRQHTQCSPSEGPCCNMQTCSFERAIE---CHSFTDCTKSSNCNGRMATCPTPQWQKNFKPCNEDTKVCMDGECRGSICLAHNMSECFLTSDDKKKLCEIACQIGNSTTTCKSTSELSD---------IIFPEPVFMRPGAPCNNFQGYCDVFQKCRAVDAEGPLARLKNLLFNEDTLNTVAEXXXXXXXXXXXXXXXXXXXXXXXXXCCAVHTPSSNPRKTPARSITETLRRPVNTLRRVKRHQHGRPEAIQLQQQQHNNXXXXXXXXXXXXXAPPSGGSRENRGRRVADRYPPSPHPAGA............................................................... 760
109 0.000e+00UniRef50_F7CYW1 Uncharacterized protein n=1 Tax=Monodelphis domestica TaxID=13616 RepID=F7CYW1_MONDO  ali  20  1........FWGCFLFLCLGSTLREGQGSSVLDQYEVVRPRRLPVSGALD----ELSSSATPYPETLRYLLGLRGNNFTLHLRKNRHLVGSDYTETYTLANGTEVTAHHCFYQGHVEEHQNSMASVSTCRG-IRGFFKTGSTE-------KASRAKPPRDQGKHAIYRQRG---------------LQEKQGACGVSKVSLKGELETLMAAASKPLNW---------------KTGAVSKETRYVELFVVVDNTEYQKYK----------SLSTVRQRVKEIVNHVDRLYQEINF------RVVLIGLEIWDQADKAAINSNVHS----ALASFLRWRESHLIGKKSHDNAQLI---TGVSFEGTIVGMGRLASMCTEGSGG---------------------------VNHDYSENPLGVATSVAHEMGHNLGMDHDPGCQCEEDTKHGGCIM---TGGWSMVFPRKFSSCSKENLQKFLWGTIPSCLNNYPNLEKMS-----------EAPVCGNKFLERGEECDCGLPGE----CLNQCCNPN---------TCRLASGAQC--TEGECCQA--CQVLPAGQVCREAQ-NACDLTEFCDGQHPRCPENVYKENGSPCSDG--YCYNGSCPT------YKQQCQALWGLQADLSTDKCYMPKACTEAFYPSKQGLNKCEFLFCSRPNDPFEMVATGTKCGTDK--VCFQKQCRDLSIYGP-KNCSSKCNGRGVCNHKKECHCHPGWAPPLC.......................................................................................................................................................................... 650
110 0.000e+00UniRef50_T1JKJ7 Uncharacterized protein n=1 Tax=Strigamia maritima TaxID=126957 RepID=T1JKJ7_STRMM  ali  18  1.....................................................................................DLFPSYFVERHQHKGKTVIHSSHCYYHGKIENSHASWAAVSTCNG-LSGIIFDGVEMHFIERIANST-------DNLHYVYRESDMKPRNFSCGFKGS----------------------------STLTDTFTTRQRRFRRNLGIRGPYNSNKGSRYVELVLVNDYKEFKEMKE---------NKDAVIARNKDIANLVNALYSPL------NIFIALVGIEVWSEFD----QITLAKDGDTTLTNFLHYRRERLVSEIPNDNAQLI---TGITFEGGVVGKALKGPICTYEYSGG--------------------------VNMDHSPNVALVATTVAHELGHNFGMEHDNDE---CSCPDERCIMAPSSSSNS---PTHWSECSIKYLHTAFDHGMDYCLRNQPSRIL--------------GPVCGNGFVEHGEECDCGLP----LFCHNPCCN---------ASSCTLFANATCA--TGECCEISTCQFKTAATLCRHSS-GECDLPEYCDGKNEFCPNDVFKQDGSSCSNERAYCYRGDCRSHS------DQCKLLWGPTGQMSDSRCFDQNKRGSASGNCGYLRLNQTYKPCDRDDILCGMLHCGARCGINK--VCVSQRCMPVDSLRT-AKCPYDCNGNGVCNSRGNCHCKVGYAPPFCDVEGSGGSEDSGPAADPH........................................................................................................................................................ 612
111 0.000e+00UniRef50_UPI000BA080A2 uncharacterized protein LOC111075401 isoform X1 n=9 Tax=Neoptera TaxID=33340 RepID=UPI000BA080A2  ali  17  63...............................HYYQIIYPVQLRHHEKMGISTREVSPSTKKHFHRTSLLIKAFNHKFRLDLELNSQLLSPNIQQKHYHVDGNRHDIEHCYYHGTVKDYPGASAAFHTCNGV-SGVIHIGN-ETFVIHPFYGGDLSKHPHVIFEA---------------------RTKANKGCANSGNLDSWRLSRRTKHLSVGVADVVDEILPNHSARSKRDVREA---TKYIETAIIVDKAMFDKRN--------GSTRAEVIHDAIQVANIADLYFRTLN--------TRVSVVYIETW-GKNQAVIDGSKDIGKAISNFNDYTSRNLFQIER----DTTQLLTGETFSGGEAGMAVPETVCTPRAVGISVDVNVYE--------------------------PHLLAGTMAHMIGHNIGMGHDDGREECFCRDWHGCIMAQSIVGQENVQPYKFSECSKKDYIDALRTGHGLCLLNKPNEIELRRN-------------CGNKVVEEDEECDCGTFEECAL---DPCC---------DGITCKLKSEAQCA--SGACC--EQCRLRPKDYICRDS-NNECDLPEYCDGEVGQCPSDVYKKNGSPCGLSSGYCFQGYCPTLS------LQCEAIWGYGGSAADRQCYEQFNSKGSINGHCGRDANEHYIKCDPENVQCGTLQCGTPCGDN--LICLNQTCVSLQTKCPTNKQGQECSEHGVCTNTNRCFCDMGWGGTDC.......................................................................................................................................................................... 754
112 0.000e+00UniRef50_A0A1U7T283 A disintegrin and metalloproteinase with thrombospondin motifs 6 n=10 Tax=Euteleostomi TaxID=117571 RepID=A0A1U7T283_TARSY  ali  15  1MEILWKTLTWILSLIMASLAYSSQEEFLTYLEHYQLTIPIRVDQNDKHSRRRRSMDPDPQQTVSKLFFKLSAYGKHFHLNLTLNTDFVSKHFTVEYWGKDGPHDFLDNCHYTGYLQDQHSTTVALSNCVG-LHGVIATEDEEYFIEPLKNTTEDSKHYENGHPHVIYKKSALQQRHLYEHS----------HCGVSDLTRNDRPWWLNDTSAFPSSLPIKDTHI------HRRQKRSVSIERFVETLVVADKMMVGYHGR-----------KDIEHYILSVMNIVAKLYRDSSLGNVVNIIVARLIVLTEDQPNLEINHHADKSLDSFCKWQKSILSHQSENGIAHHDNAVLITRCTYKNKPCGTLGLASVAGMCEPERSCSINEDI-----------------------------GLGSAFTIAHEIGHNFGMNHDGIGNCGTKGHEAAKLMAAHITA--NTNPFSWSACSRDYITSFLDSGRGTCLDNEPPKRDFLYPAVAPGQVYDADEQCRFQYGATSRQCKYG-EVCRELWCSNRCVTNSIPAAEGTLCQTGNIEKGWC--YQGDCVPFGTWPQSIDGGWGPWSLWGECSRTCGGGVSSSLRHCDSPAPSG-----GGKYCLGERKRYRSCNTD-----PCPLGSRDFREKQCADFDNMPFRGKYYNW......................................................................................................................................................................................................................................................... 639
113 0.000e+00UniRef50_Q9UKP5 A disintegrin and metalloproteinase with thrombospondin motifs 6 n=188 Tax=Euteleostomi TaxID=117571 RepID=ATS6_HUMAN  ali  15  1MEILWKTLTWILSLIMASSEFHSDHRLSTYLEHYQLTIPIRVDQNDKHSRRRRSMDPDPQQAVSKLFFKLSAYGKHFHLNLTLNTDFVSKHFTVEYWGKDGPHDFLDNCHYTGYLQDQRSTTVALSNCVG-LHGVIATEDEEYFIEPLKNTTEDSKHFSYGHPHVIYKKSALQQRHLYDHS----------HCGVSDFTRSGKPWWLNDTSTVSYSLPINNTHIHHR------QKRSVSIERFVETLVVADKMMVGYHGR-----------KDIEHYILSVMNIVAKLYRDSSLGNVVNIIVARLIVLTEDQPNLEINHHADKSLDSFCKWQKSILSHQSENGIAHHDNAVLITRCTYKNKPCGTLGLASVAGMCEPERSCSINEDI-----------------------------GLGSAFTIAHEIGHNFGMNHDGIGNCGTKGHEAAKLMAAHITA--NTNPFSWSACSRDYITSFLDSGRGTCLDNEPPKRDFLYPAVAPGQVYDADEQCRFQYGATSRQCKYG-EVCRELWCSNRCVTNSIPAAEGTLCQTGNIEKGWC--YQGDCVPFGTWPQSIDGGWGPWSLWGECSRTCGGGVSSSLRHCDSPAPSG-----GGKYCLGERKRYRSCNTD-----PCPLGSRDFREKQCADFDNMPFRGKYYNWKPYTGGGVKPCALNCLAEGYVIDGTQCNADSLDICINGECKHVGCDNIL........................................................................................................................................................................................................ 697
114 0.000e+00UniRef50_H0W7I0 ADAM metallopeptidase domain 33 n=13 Tax=Amniota TaxID=32524 RepID=H0W7I0_CAVPO  ali  18  66..............................................................PDSGLVALESEGQALLLELE-NSRLLAPGYTETHYGQDGQPVHMDHCLYHGRVRGFSNSWVMLSTCSRV-RGLIGLNSNASYYLHP---WPPGDPEDWSTHRIFQMERLLTGKGTCGYR---------------------------------EHRDKEGMARLPSAPQSRDKREAPRGPRYLELYLVADHSL---------YLIQHQNLNHTKQRLLEIANYVDQLLRTLD------IQVVLTGLEVWTEQDRSR----VTADANATLWDFLQWRRELWARR----PHDSTQLLTGRTFRGSSVGLAPVGGICRSESSGGVST--------------------------DHSELPIGAAVTMAHEIGHSLGLSHDPDGCCT---EQGGCVMAAAT---GHPFPRVFSACSRRQLRAFFRKGGGACLSNAPEPGLPVPP-----------SRCGNGFVEAGEECDCGSGQ----KCPDPCCFAHN---------CSLRAGAQCA--HGDCC--ARCLLKPAGSLCR-QAAGDCDLPEFCTGASPHCPPDVYLLNGWPCAGGRGYCRDGACPTLE------QQCEQLWGPGSRPAPEACFQQGNLAGDASGNCGQDGAGRFLPCAQRDAQCGTLQCGTHCGP--GMVCQDRHCQNASSQE-LERCLTACHNHGVCNSNQNCHCSSGWAPPFCDKLGFGGSVDSGP............................................................................................................................................................. 691
115 0.000e+00UniRef50_A0A068YEK4 Disintegrin and metalloproteinase n=5 Tax=Eucestoda TaxID=6200 RepID=A0A068YEK4_ECHMU  ali  31  7.......SCLLLLTLITSPFLAEQAYI-PQIGQYWELNYSALQPP--FPRSKRSTDRPSS------SFFFHAFGHNFSLVIYRDEGVLSPTALVVAGGQTRLLSSDDNSAYRGFLKSHPKSLVYGSVLNGIFRGTIALNAEDVYFVEPAGNFLPN----PDFHSVIYRADVLFRQKRSLGIAGGDDASEPAFCGYSNREIARQLREMSQPALDPVKRLTRSVDGIRGQRRDQRSYDAGPTSRVCNLYLQSDTFLWDHIKLPHIRFNRDLAIKEITSIFTQHVQGAQAIYQYTNFKSYHGVGFRVDRVLINTEEDCHPPPRNYTPENPFCSENVDVTNFLNLNSYINHDDFCLAYVFTYRDFTGGTLGLAWVAEL--GGSGGVCEKHRLMREGSH-TVKKSLNTGVVTLLNYGTRVSMKISQLTFAHEMGHNLGAKHDDDFKCLPSDPKGNYIMFASATGGDKENNNKFSVCSVNSIARLLHQ---------------VLKSESNCFFTSNGSFCGNRLTEEGEQCDCGFTRED---CDDVCCYPKDSKE-----PCKLKKFANCSPTAGECC-MSKCQYRDSKHLCR--SAGECHKASYCSGSSAQCPPPVNIPDGTPCMNHTRICKSGECLGSVCERIGWQECSLARGEPEMMCYVACRNIHNCISTIQLETDENLRKAYLAAELLQQPGGRLQPGTPCDNYRGYCDVFFVCRSVEVEGPLARLHKLLFSPQVLSKVKTWITXXXXXXXXXXXXXXXXXXXXXRLCSYSTPSSRTYHYHQQQLR--APPPALHPPPALLAPRPAEAAAPRRQPQGLPREYFVPPFRLKRRRTIDPVNGVERHVSELIPASSVPVPRYRPHPQKGQTKTRPVSVVVYPRPAL----PSHVRDLPSRQQQQQ---QAAVSVAPFGRGSRSAGQ 1033
116 0.000e+00UniRef50_Q6QU65 ADAM metalloprotease n=17 Tax=Drosophila TaxID=2081351 RepID=Q6QU65_DROME  ali  15  47..................................EFSTYTVIRPQVEHGRTKRSLDATDGLHTPQISLSYTHEGKRVVVDLQRNDLLLPNSHFLRYQNASRTKTEVDLCHYQGHIRGKPESVVALSTCDGALDG-IVIDGRQTYFIHPHIDGRGRLQDDHYLLKQADMHPTNATCGYDNHRDDHSHDYEKADGDNGLGGGIPSLPLRLDGGEFSRTLLRKRRQADDSSQLIRGPYNANKYSSYVELVIVVDNKVYKNFQENTKKVHQYCKGIANXXXXXXXXXXXXXXXXXXXXXNESN-------------------EIEFSSDGDLTLRNFLNYRSTKLVLDHPNDNAQ---LLTKENFAGGVVGKALKGPICTYEYSGGVS--------------------------MQHSPNPAMVATTMAHEMGHNFGMEHDTSD---CHCRDEKCVMAASSTSFIPVN---WSSCSIDQLTIAFSRGMNYCLRNKPE-------------RLFESPTCGNGFVEPGEQCDCGLPEHCENACCN-------------AQTCMLHSNATCA--TGECCDLTTCRPKLAGSACR-EAENECDLPEYCTGESEYCPADVFRRDTEPCDGGQAYCFHGTCRSHS------NQCRTLWGPTGDNSE-HCYNKNTEGTRLGNCGYNRLNKTFLRCEEQHVNCGMLHCGAKCGVDK--MCVDQRCLPVDAVGMGKPCPEDCNGNGICNSRGHCHCDVGFGGESCSKAGSGGSPDSGPATXXXXXXXXXXXXXXXXXXXCYKNGMLTRGKLADNILKSSGGSKPITTRTNQNGTGPPPSKSTPSSTDDMDSALLKSPSDSTPSRPLNDASSPASNYNGPNVAFVQPTVQQDGPQRMAPPPPVVKPGTAPIHPPSPKPEA................ 922
117 0.000e+00UniRef50_A0A0L8GXX3 Uncharacterized protein n=2 Tax=Octopus bimaculoides TaxID=37653 RepID=A0A0L8GXX3_OCTBM  ali  16  48.......................................................EAHRKAHVENISIVIPTRRKKIVLKLKKNSELISNRYISRTLLPTGIHYYTQHCYYNGHIEGDPYSSVAVSTCDG-ISGLVIKDDGLYHIEPAGNSLDPTLHY--------------------------------WYKNMTDETASHCGNDAHDYEHKDIHEIFSRNLLKRVRRSIRGPYGSNKETRYVELYLVADSGTHNLHKD------------KTERRLINIANTVNMIYRPL------NLYIGLVGVEIWRDPSNIPIKI-DRGDPQETLTRFLHYRQQRINPIQLNDNAQLLVGF---KFANGVIGKASQGKICMHQSSGGVNSDHIHS-------------------------TVASVAMTVAHELGHNLGMLHDRTT-CVCPGESAKCIMEATSGDRSSP---KWSSCSKEAIKEAFEMGMDYCLYNKPESLFHTS--------------CGNNFVEDGEECDCGLPEV----CDNKCCEP---------TTCKLKGNAVCA--TGKCCNLNTCQLRPPGTVCRPK-EGECDLDEYCTGKGEYCPENVFIHNGRSCSGGLSYCYKGQCNTH------TKQCQLLWGDTGRVSDDICFRANNVLGNVSGNCGNWQTDRYTACAVNDVRCGMLHCGSKCGADK--ICVEQQCKPLQKLGFP-DCPKGCNGHGVCNSRGNCHCDAGYGPPYCDKEGKGGSVDSGIANLEKXXXXXXXXXXXXXXXXXXXXXXXXXXXRNDLIQKKKSNFNMHLPPALTNIKLPKVQLPTRTDTNRQSRTSRLGPPISKPMLTHSTNSNSQALVTPVEAPQDAYIPKREPRSATRPLSA.................................. 819
118 0.000e+00UniRef50_A0A0R4IB54 ADAM metallopeptidase domain 15 n=2 Tax=Cyprinidae TaxID=7953 RepID=A0A0R4IB54_DANRE  ali  20  96.........................................................................................................QTHCYYHGSVQGFPESRVALSSCSG-LRGVIVINATLSFELLPEGEEERGKDDE--------GSGEMEEGEMHAIYSTHSPTSESRDCGVSHTSIPPIQIIPH---------------------THRSKRDILSEIKYIELVLVADHKE---------YLNYQKNNKTIIYRMLDVANQVDWFYRPL------NVRVALLGLEIWSDQDK----IKVDKSPTETLNRFLDWRTRELLPRLRHDNAQLIM---GESFDGTTVGMASQSSMCSKDRSGG--------------------------VNVDHLVSVLGVASTVAHELGHNLGMSHDTADRRCHCQNEGGCIMEPST---GFMPGQLFSSCSERDLSLSLLHGGGMCLFNVPQPESLLG-----------GPRCGNLYVEKGEECDCGLLDE----CNDPCC---------NASTCKLVPGAQCS-SDGICC--ENCKLRVAGSVCR-EPLGECDLPEHCTGSSPYCPPNVFLQNGEPCKGGSSYCYSGVCASLD------DQCQMLWGQNSTRAPPICFSSVNKQGNKYGNCGQMPNGSYIPCLKWDVHCGRIQCGTACGPNKA--CVDQKCRDVSMFGVDE-CRSKCHGHGVCNSNKNCHCDEGWAPPDCRYSGNGGSVD................................................................................................................................................................ 685
119 0.000e+00UniRef50_A0A1U7S4J8 disintegrin and metalloproteinase domain-containing protein 15 n=6 Tax=Sauria TaxID=32561 RepID=A0A1U7S4J8_ALLSI  ali  15  5.......................TRRLDDELIHYWHVMPSIQQGSRMLSLAE-AMQHWQKGFPGQLRVTLELEGAWLELELEQNRELTPGTRALLYYLPNGMRAMQDNCCYQGRVWGHPGSRASICACAG-LSGLITVSQNMSYGLEPS---------------------------------------PGGPHGTHLAYRTQDIRLVPQACGVGTPNPEQPLPDTEQPLLQRGKRAAVPEQRFVELVMVLDQAEFRLY----------PDLKRIQTRALEITNQVDVFFQPL------GIRVALLAVEVWNQGN----PIAIGPSARATLERFLQWRQTDLLPRLPHDNAQ---LLTGTAFAGTAMGMASQGSMCSAARSGGVS--------------------------VDHSISVLAVASTVAHQLGHSLGMGHDGPAQGCECPGDRSCIMDL---PTGLMPGLSFSSCSKQDLEHGLRQGRGWCLFNVPEPRSLVG-----------RPRCGNRFVEEGEECDCGLQEE----CTDPCCN---------ASTCQLLPGAQCATGA-ACCQ--DCQLRPAGTTCR-EPRGECDLPEFCDGLLGHCPPNAHMQDGQLCAGGQAYCYGGVCTT------YAGQCQQLWGTGSVPAPAACLASLNAQGSEHGHCGQHPNGTYIPCAPRDVGCGRLQCGTACGSGK--ICLESRCQDVSVLRVSAC---QCHEHGVCNNLGHCHCERGWAPPSCESPGPGGSVDSGPLSMEEXXXXXXXXXXXXXXXXXXXXXXXXXXKRAGLHKRSKGTSCQYSTEAETRVRFLGAGVSADQSRISQPETQCPSQTPPERPRPPQWHQSTELQVMHSSTPAPLGAARPDPPSKPLPPDPVPKASQARGSDRPPPPTRPLPADPVVRG...... 812
120 0.000e+00UniRef50_G4VEJ8 Dihydroceramide desaturase n=3 Tax=Schistosoma TaxID=6181 RepID=G4VEJ8_SCHMA  ali  34  1MFSKVRLCLPFIILEIFVICVQSYNPESPFFSRYDGLDYSPDSFSHQHKRTRRSTSKTN------IILPINAFGKFFQLVLSPDYDVVHPNAKLIVGGREGGLPAVSDHVVRGYVDGFTHSVVFGSVIDGVFRGTVSLNSYDTYFIEPSGYYFNK---DFPFHSVIYNSSRMRRAVQEMDLKFCGLSYPNIVQEMSKTNIEDREKHGNTVFRSNSSFVKSPFSRNRGSNNSLSYKDGGPNTRVCNLYLQSDTYLWDHINKRHIQGNRELAVKEITSIFTQHVQTAQLIYQDAIFRDFRGVSFRVDRVLINVTEDHLGFSGAYTDENPFCAPNIDVTNYLNLHSYNKYDDFCLAYIFTYRDFSGGTIGLAWVAEV--GGAGGVCEKHRKMLEGNQN-VFKSLNTGIVTLLNYGSKVATKVSQLTFAHELGHNFGAKHDNSYGCLPSIDDGNYIMFASAISGDKENNNKFSDCSLDSIAKLLDH---------------VLRGENNCFLTSDGPFCGNQLTEKGEECDCGFT---RANCHDKCCHPRDSASPCKLVNNVFIDHAQCSPTAGVCCT-ENCQYRPETHMCRPA--GECHRSSNCSGTMSKCPPVDILPDGTLCQDGTRVCKQGQCIGSICERIGWHECSFTRDKPELMCFVGCKQNISCISSFQLETELDLRAKYPQEILRNGRGIKLPPGAPCDNYRGYCDVSMRCLLVDAEGPLSRLRNLVFSP.............................................................................................................................................................................................. 813
121 0.000e+00UniRef50_E7AIM5 Disintegrin and metalloproteinase domain 9,transcript variant 3 n=5 Tax=Mammalia TaxID=40674 RepID=E7AIM5_CANLF  ali  21  14....LQWLLLFGTVGPVLGGARPGFQQTSHLSSYEIITP---------WRLTRERREAPRPYSEQVSYIIQAEGKEHIIHLERNNDFLPRDFVVYTYNKEGHPDVQNHCHYRGYVEGISNSSIALSDCFG-LRGLLH--------IENVSYGIEPLQNSSHFEHIFYRMDDVHKEPLKC--------------GVSNKDMEK------------ETTNYEEEEPLSVTQLLRRRRAVLPQTRYVELFIVVDKERYDMMGRNQT---------AVREEMIRLANYLDSMY------IMLNIRIVLVGLEIWTNGNL----INIIGGAGDVLGNFVQWREKFLITRRRHDSAQLVLKKGF----GGTAGMAFVGTVCSRSHAGGI--------------------------NVFGQITVETFASIVAHELGHNLGMNHDDGRDCFCGAKS--CIMN-----SGASGSRNFSSCSAEDFEKLTLNKGGNCLLNIPKPDEAY-----------SAPFCGNKLVDPGEECDCGTPKE---CESDPCCE---------GTTCKLKSSAECAY--GDCCK--DCWFLPGGTLCR-GKTNECDVPEYCNGSSQFCQPDVFIQNGYPCQNNKAYCYNGMCQYYD------AQCQVIFGS................................................................................................................................................................................................................................................................................ 530
122 0.000e+00UniRef50_B4LXB2 Uncharacterized protein n=17 Tax=Schizophora TaxID=43738 RepID=B4LXB2_DROVI  ali  15  61..................................EFSTHTVIRPQVQHGRTKRSLQSSDGLHAPHFTLSYTHQGQRIQIELQRNDRLLPDAHFLRYQNRNFTKTDVDLCHYQGHIHGKPDSTVALSTCDGGLNGVVFDGQHTYFIHPHSDGSGRLQDD----HYLLRHADMLQQNATCGYDSRTDNHNEPEQDLAENEEEQEQELEPPALPQRLDGGEFHRMLIRKRRQADRGPYNANKYSSYVELVIVVDNKVYKHFGENNKRVHQHCKNLANXXXXXXXXXXXXXXXXXXXXXNESN-------------------EIEFSSDGDVTLRNFLNYRSTKLVVDHPNDNAQ---LLTKETFAGGVVGKALKGPICTYEYSGGVS--------------------------MQHSQVLAVVATTMAHEMGHNFGMEHDSND---CHCPDEKCVMAASST---AVVPVHWSSCSIDQLTIAFSRGMNYCLRNKPT-------------RLFDSPQCGNGFVEPGEQCDCGLP----AHCENSCCN---------AHTCMLHSNASCA--TGECCDLKTCRPKLAGSACRP-EENECDLPEYCTGESEYCPTDVFRRDTEPCDNNQAYCFLGTCRSH------ANQCRILWGPTGENS-VHCYGKNVEGTRLGNCGYNRLNKTFVKCTPQHANCGMLHCGAKCGDQS--MCVNQQCERVRQMGMGSPCPENCNDNGICNSRGHCHCDVGFGGEACSKPGHGGSVDSGPATDSSALSFQXXXXXXXXXXXXXXXXXXXXXXXXXRNNKLFAGGKLAENILKTASNQKQPTTRSNQNGTGPPAGGANGLPKSTPSSTDDMNSALLKSPSDSSDAAPAGNTP.............................................. 882
123 0.000e+00UniRef50_A0A1J1IKC7 CLUMA_CG013286, isoform B n=1 Tax=Clunio marinus TaxID=568069 RepID=A0A1J1IKC7_9DIPT  ali  16  97...............................HFYQIIYPVQLRHHEKMGISTREVRSRTGKHFHRTSLLIKAFNHKFRLDLELNTQLLAPNIQQKHILPSGYPHDSHHCYYHGTVKDYPGASAAFHTCNGV-SGVIHVGN-ETFVIHP----FYGGDLSQKHPHVIFEARTKQNKGCANSGN------------------------LEWRNPRRQQHLTGFVEKQDANGAGRYKRDVRDATKYIETAIIIDKAMFDKRN--------GSTRAEVVHDAIQVANIADLYFRTLN--------TRVSVVYIETWQGQNQAQIDSGKDISKAISSFNDYTSRKLFK----IDKDTTQLLTGENFSGGEAGMSVPETVCTAKAVGISVDINTYE--------------------------PHLLAGTMAHMIGHNIGMGHDDTGEECYCRDWHGCIMAQSIIGLENVQPYKFSECSRSDYIDALRIGHGLCLLNKPNE-------------LEVRRNCGNGIVEDGEECDCGSFEECS--KKDPCC---------DPITCKLIKEAECA--SGACC--DNCQLRQPGYICRD-AFNECDLPEVCTGESGQCPTDVYKKNGSPCGVGTGYCFNGVCPT------LNAQCEKIWGYGGSAADKQCYEQFNSKGSMNGHCGMDNAGHYIKCDPENVQCGSLQCGTPCGEN--LVCVNQTCVSLFPYDTSKCPTNHCTGNGVCTNMNKCHCNFGWTGSDC.......................................................................................................................................................................... 807
124 0.000e+00UniRef50_UPI000C04F2AF disintegrin and metalloproteinase domain-containing protein 10-like n=1 Tax=Stylophora pistillata TaxID=50429 RepID=UPI000C04F  ali  35  3.TSWLRTMAALHVCLAFLLLLTSSRPLGDFINHYETLNYDTARVVRQHSRVRRSSPNS--------------------------------DHVVELHLKTEQSKPRH-----------KNSLVHGFIDDGVFEGKIHVGNDKYFVESAKEYFKDEPN---DFHSVIYESRDVNYPHAYGPGCGVSEKTKKWMDKVKRIKIK---------------------ISILSYSNKEKNLSLQLSLKNVCLALQADH--------LFTANMADGNKERAMLLMADHVKAANSIFKNTDFDKADGIQFQIQRML------ANGTAEANDGRNPYRDSNIGVEKLLELNSEEIHDDVCLSYIFTYRDFADGVLGLAWVGEA-GGAAGGICETATSFRD----GKTKSLNTGVVTFVNYNKKVLRKVSEITFAHEAGHNFGSPHDNSPECAPGGTDGNYIMFARATSGDQKNNRLFSPCSRTKMNEVMDVK-GRCTSNSC------------CFRDAQGAICGNMVTEAGEECDCGYKTDES-CKKDTCCV--GRDVNSEGSGCKRRYNATCSPSQGLCCSYD---CVPHQQSVLCLNETECANTSYCNGINATCPVPAPKANFTSCNEGRQVCIQGECSGSICLKFNKLECQCAQEN--HLCDLCCKD---------GEEGKCLPASEIKEMKEE-KNLKQFPGAPCNDFNGYCDVFLKCRAVDADGPLSRLKNKFFSKEAIKGYLEWIKXXXXXXXXXXXXXXXXXXXXXXXCSVHTPSSNPNRKPARQL--TLRRQPARGRPNQRGRQMQQGNRGNPQYDDPPPYPGAPMQMHGR............................................................................................ 721
125 0.000e+00UniRef50_E6ZI48 Disintegrin and metalloproteinase domain-containing protein 8 n=7 Tax=Percomorphaceae TaxID=1489872 RepID=E6ZI48_DICLA  ali  14  6...........VSVWLMWVCLVQCSGMLSHVERYEVVRPQRLA-----GRLKRSLRDNQ-LYPDTVRYELAVEGKKHTIHLEKNRNLFGKGYTETHYSEDGKRVTQEHCYYHGHIEGMKDSSVSVGICSGV------------------RQFIVDKTIPIYKSNHIYEHIQFALSGFVRARQQLYLIEPLGQSEDDDHAVYRQEHLKFNSRPGSSSNYDRDQDQPSTRRTLQKSKTITGPQKFVELFVVVDNAEYNRYGS------------QTKSRILGVINHVDKLYRSL------NIRVMLVGLEIWTYED----HFNVHLNSETALDNFLLWRQASLLPKTKHDNAQFV---TGKDFDGDTVGLANKFAMCSENSGGVNQVRVTSSTNPTNGRRW-----------KDHHDNPIGLASTIAHEMGHNFGLSHDATGCVCGPSYSGNCVMADKLRTGTQAFPEFFSDCSIEQLAEFMERAQPSCLSKPSSVKTIAIAPAAATP------------------CWTPERSVTVALWRNPCC---------DASTCRLTEGSQCA--HGQCC--DNCQVTAAGSVCR-KAASGCDLPEYCTGVSEDCPEDSFEMNGKPCYNAQGYCYNGRCPTHE------QQCWRLFGPGTRVGSDVCFNLNKRGEKGANCGKTQSN--YAPCTESNLKCGSIFCGTKCGPNK--VCFDNRCVDLSVYGKTEDCAKKCNNNGVCNHKNECHCNPGWAPPYCDI........................................................................................................................................................................ 708
126 0.000e+00UniRef50_UPI000819D7E3 uncharacterized protein LOC108505613 n=1 Tax=Lepidothrix coronata TaxID=321398 RepID=UPI000819D7E3  ali  18  42....................................LSPLGWQVPSQITIPQRNVTGVTRLQQDTVSYVLRIEGRPYTIHLQQ-HAFLSDDFQIYVSDEEGSLPPDSACHYWGYIDGFPSSAVTLSTCSG-LRGLLQFEN--------VSYGIEPLDDSPEFEHLVYRVSEEDTAGSFLAHSPPGRGLGGLVAEETSAKAHGDDELLW---------------------------AAARSPKYLTVYVVLDSALYNYMGSDP---------NAVTQKIIQAFNLVNNMFSPL------NVTIVLSSLELWAEGDKIPTA----GDTDDLLQRFLQWKQLTLALQ----AHDIAFLLGYRD-QGAPVGTAALGKACQRDAAAAVALYHG-------------------------KATLESFSVLLAQVLGRSLGVSSDSPRAC--GCAGRGCIMSPAALHFS--GAKAFSNCSVRDFETFLKQGRGVCLFNRPRLRPLSP---------RSGAFCGNGVVEPGEQCDCGAPQ---QCLHDKCCT----------WRCQLMPKARCA--SGSCCK--NCQFRKKNSLCRPTSDSQCDLPEFCSGSSGSCPPDVYVQDGHSCERGTGYCYQGRCQSLD------LQCQRLYGKDSKSAPVACYEEINSQRDRFGHCGFKRGRGYQGCSWRNLRCGKLVCGTKCGSER--VCIN-TCHPRSVLGFRCDSQVMCHGHGVCNNKGNCHCYPGWRPPSCQRRGSGGSVDSG.............................................................................................................................................................. 696
127 0.000e+00UniRef50_O43506 Disintegrin and metalloproteinase domain-containing protein 20 n=102 Tax=Eutheria TaxID=9347 RepID=ADA20_HUMAN  ali  18  13......TLLLLWFGMFLSISGHSQARPSQYFTSPEVVIPLKVISR-----------GRGAKAPGWLSYSLRFGGQRYIVHMRVNKLLFAAHLPVFTYTEQDQPFIQDDCYYHGYVEGVPESLVALSTCSGGFLGMLQINDLVYEIKPIS--------VSATFEHLVY------------KIDSDDTQFPPMRCGLTEEKIAHQMELQLSYNFTLKQS---------------SFVGWWTHQRFVELVVVVDN---------IRYLFSQSNATTVQHEVFNVVNIVDSFYHPLEVD------VILTGIDIWTASN----PLPTSGDLDNVLEDFSIWKNYNLNNRLQHDVAHLFIKDT----QGMKLGVAYVKGICQNP--------------------------FNTGVDVFEDNRLVVFAITLGHELGHNLGMQHDT---QWCVCELQWCIMHAYRKVTT-----KFSNCSYAQYWD-STISSGLCIQPPPYPGNIFRL-----------KYCGNLVVEEGEECDCGTI---RQCAKDPCCLLN----------CTLHPGAACAF--GICCK--DCKFLPSGTLCR-QQVGECDLPEWCNGTSHQCPDDVYVQDGISCNVN-AFCYEKTCNNHD------IQCKEIFGQDARSASQSCYQEINTQGNRFGHCGIVGT-TYVKCWTPDIMCGRVQCGTVCGPEK--ICIRKKCASMVHLS-QACQPKTCNMRGICNNKQHCHCNHEWAPPYCKDKGYGGSADSGP............................................................................................................................................................. 676
128 0.000e+00UniRef50_UPI0007BA5229 zinc metalloproteinase-disintegrin-like crotastatin n=9 Tax=Sinocyclocheilus TaxID=75365 RepID=UPI0007BA5229  ali  16  10..........VLCCLCLWGCVAESIHTLPHVERFDVVRPKRQSVRKVHSDK---SPQSHETYPDRLTYKLFFGGKNHVIHLEKNRQLIGHNYTEICYQDDGNPNLKDNCYYHGHIQDLEDSSVSVGICSG-IRGFVRVKQQVYLIEPLTNHSDGDHAL---------------------------------------YKHEHLRWKRSSCGEPSSTVYDHEKPVAVPLKSTRWKTKRFHTPRYVELFLVVDNTEYRNFGS---------NMDIIRPRMLEVANHVDKLYRPL------NIRVMLVGLEVWM----KRDQIVVSVSSDDTLSRFIEWRKSNLLKRVKHDNAQFV---TGIDFLNDTVGLANKFAMCAESSAG---------------------------VNQDHNQNSLGLASTIAHEMGHNMGMSHDENHCTCGSSNNSICIMTERV---GTLFPELFSDCSLEQLSVFLDNANPSCLLDTPSSSRLY-----------SGSICGNAFLDPGEECDCGTVEE----CENPCCDPM---------TCRLTEGSQC--VHGDCC--ENCQIKDAESLCR-APENECDIPEYCTGLSEHCPENDFKMNGIPCSSGQGYCYNGQCPTH------LQHCQRLWGTGAKVAAEACFFLNTFGKNDSHCG--KTKGGYRACTKENMFCGKIFCGTKCRHNK--VCYDYMCQDLNVYGSNDDCSLQCNGRGICNHKKQCHCEPGWAPPYC.......................................................................................................................................................................... 662
129 0.000e+00UniRef50_A0A0P5TVI4 Disintegrin and metalloproteinase domain-containing protein n=19 Tax=Daphnia magna TaxID=35525 RepID=A0A0P5TVI4_9CRUS  ali  18  64...............................SHYQIVFPVQLRHREKMGISTREIGAATGKHYHRTSLLIKAFSHKFRLDLELNSQLLAPNLIQKHFLPGGVEQEIEHCYYHGTVKDYPGAVAAFRTCSGV-SGIIHIGN-ETFVIHP----FYGGDLSRKHPHVIFEARTKVKQMCANTGMLEWGLRSGNYRG-------------------------GKNQKNSPKSNERQKRDVREVTKYVETALVLDKAMFEKRNGSR--------RIEVVQDAIQIANIADLYFRTLN--------TRVSVVYIETWASENQALIDRSQDIHRALLNFNDY----ISRKHYNFEKDTTQLLSGETFAG-VSGMAAPDTICTVKSVGLSVDINPYE--------------------------PHLVAGTMAHMIGHNIGMGHDDGRDECHCGDWHGCIMSHSIMGLDNVQPYKFSECSLSDYIDTLRIGHGLCLFNRPNQLGDF-------------RTCGNGVVEVGEECDCGTIEECHE--SDPCC---------DPITCKLTAEAECA--SGPCC--DDCKLRPKGYLCRDAT-NECDLPEICDGRSGQCPLDIFKKNGNQCEINKGYCFNGVCPTLD------SQCRLIWGDGGLSADRKCFEQFNSQGSINGHCGLDSHNNYIRCDAEHVMCGSLQCGTPCGNN--LICMNKTCSSIYPYCPSNNVALDCSGHGVCSNVNSCFCDAGWTGHDC.......................................................................................................................................................................... 731
130 0.000e+00UniRef50_A0A0P8XLG6 Uncharacterized protein n=4 Tax=Neoptera TaxID=33340 RepID=A0A0P8XLG6_DROAN  ali  17  63...............................HYYQIIYPVQLRHHEKMGISTREISSAK-KHFHRTSLLIKAFNHKFRLDLELNSQLLSPNIQQKHYHVDGNRHDIEHCYYHGTVKDYPGASAAFHTCNGV-SGVIHIGN-ETFVIHPFYGGDLSKHPHVIFEA---------------------RTKANKGCANSGNLDSWRLSRRTKHLPAGVAGIVDDIFDGDGGRMRRDVREA---TKYIETAIVVDKAMFDKRN--------GSTRAEVIHDAIQVANIADLYFRTLN--------TRVSVVYIETW-GKNQAIIDGSKDISKAISNFNDYTSRNLFQVER----DTTQLLSGEIFAGGEAGMAVPETVCTPRAVGISVDVNVYE--------------------------PHLLAGTMAHMIGHNIGMGHDDGREECFCRDWHGCIMAQSIVGQESVQPYKFSECSKKDYIDSLRTGHGLCLLNKPNEIELRRN-------------CGNKVIEEDEECDCGTFEECAL---DPCC---------DGITCKLKSEAQCA--SGACC--DQCRLRPKDYICRDSH-NECDLPEYCDGEVGQCPSDEYKKNGSPCGINSGYCFQGNCPTLS------LQCEAIWGYGGSAADRQCYEQFNSKGSINGHCGRDANDHYIKCEPENVQCGTLQCGTPCGDN--LICLNQTCISLFPYCPTNSRGQECSERGVCTNTNRCFCDMGWGGTDC.......................................................................................................................................................................... 735
131 0.000e+00UniRef50_A0A1W0WI83 Disintegrin and metalloproteinase domain-containing protein 12 n=1 Tax=Hypsibius dujardini TaxID=232323 RepID=A0A1W0WI83_HYPDU :_  ali  18  2...FWRFLCVVCVLAAGALAETRQGDVFDEFYTFDVTIPKTTIPSD--ARSKRDVVSQRQGTSHRRRLQFDAFGQSFDLDLKLNPDLVPDGFQVAVHSRGGIRTFRPPCHYRGTLNNAPESNVAVSLCNGGVSGFIQDGHGETF----------------------YLTTDSAQPGKMMVMRESDKIPVMEICGVDLDGVEPDRNLTRITGSIKPHHHS------RTRRSLDQPSSSDRNSLYVELVMVGDTKLFEKYKKNETL---------VINRFVEIASIVNALYTPLD------IFVVLAGVEIWTDTDK----IAVSNDSETTLKNFLRYRKRDLIPRMPNDNA---YLISFSNFEGSVVGKALKGQMCTYEYSGGIAK--------------------------DHSSLSGPVGATVAHELGHNFGMEHDFTD---CKCPEDRCIMTPASVGETPSN---WSSCSKKYLEDHLARGIGTCLKRAPKTVP--------------HSYCGNGFLEEGEECDCGPKE----FCRNRCCL---------AETCTLSINSTC--GHGSCCDLHTCSPKPAATTCRESS-GECDLPEYCDGHTGACPRDFWTADGVPCRNGDAYCYDGSCKTHD------DQCQFLWGSTGREADNKCFLLNAKGNANGNCGHDRITDNYTKCASADNRCGLLHCGAKCGTD--MMCLNQICTPIA--HLPHYCPNNCGSTGVCNNAGHCHCHDGYSPPDCLGSGYGGSIDSNP............................................................................................................................................................. 700
132 0.000e+00UniRef50_UPI0009071C93 disintegrin and metalloproteinase domain-containing protein 15 n=11 Tax=Amniota TaxID=32524 RepID=UPI0009071C93  ali  15  225............LTVLHSPQAGDTRRLEDELIHYWHVMPSIQQGSRMLSLAE-AMQHWQKEFPDQLRVTLELEGAWLELELEQNRELTPGTRALLYYLPNGMRTMQDNCCYQGRVRGHPGSRASICACAG-LSGLIAVSQNMSYGLEPSPRG---------------------------------------PHGTHLAYRTQDIRLVSQACGVGTPSPEQPLPDTEQPLLQRGKRAAVPEQRFVELVMVLDQAEFRLY----------PDLKRIQTRALEITNQVDVFFQPL------GIRVALLAVEVWNQGN----PIAVGPSARATLERFLQWRQTDLLPRLPHDNAQ---LLTGTAFAGTAMGMTSQGSMCSAARSGGVS--------------------------VDHSISVLAVASTVAHQLGHSLGMGHDPARGCECPGPDRSCIMD---IPTGLMPGLSFSSCSKQDLEHGLRQGRGWCLFNVPEPRSLVG-----------RPRCGNRFVEEGEECDCGLQEE----CADPCCN---------ASTCQLLPGARCATGA-ACCQ--DCQLRPAGTTCR-EPRGECDLPEFCDGLLGHCPPNAHMQDGQLCAGGQAYCYGGVCTT------YAGQCQQLWGTGSVPAPAACLASLNAQGSEHGHCGQHLNGTYIPCAPRDVGCGRLQCGTACGSGK--VCLETRCQDVSVLRVSAC---QCHEHGVCNNLGHCHCERGWAPPSCESPGPGGSVDSGPLSMEEXXXXXXXXXXXXXXXXXXXXXXXXXXKRAGLHKRSKGTSCQYSTEAETRVRFLGAGVSADQSRISQPETQCPSQAPPERPQPPQWRQSTELQVMHSSTPAPLGAARPDPPSKPLPPDPVPKASQARGSDRPPPPTRPLPADPVVRG...... 1043
133 0.000e+00UniRef50_UPI000BAEED97 disintegrin and metalloproteinase domain-containing protein 12-like isoform X1 n=4 Tax=Crassostrea virginica TaxID=6565 RepID=  ali  18  35......................................FQVIKPVFYHNRLPRDTTHKNGSHLQDVTLYFKAFDRNFFIDLNVNKYLFSKNFIEIHFDNGSSIHKPSHCFYHGSLRGFQHSVVAVSTCDG-IRGLISDGRVSYHI--------DPSPEHGLGQHKLYIEPDDRPIPVQRRGGH--------------------LKHSSLHANATLNYLHTRDVLHRVRRELRGPYDGNNNARFVELYIVTDQSLYRKYGYQ---------DDVVKQRSKDIVNIVSKLYNPL------NIYIALVGIEIWS-----QDKIRVRSQANDTLEEFLNYRRQSINPKYENDNAQLI---TGLQFSDNILGKALVNTICT------------------------FSSSGGVSSDSDSNNRLIQVATTMAHELGHNLGMAHDNYSFCQCPDD--KCIMAPT-QGGVNAPPTKWSSCSKIALSENFEIGMDYCLKNKPD-------------KLYEGPVCGNGFVEEGEECDCGLPED----CKTKCC---------DARTCKLTTGAVCA--TGKCCDTQSCMLRPRATLCR-GAYEECDLPEFCNGESEYCPSDVYRKNGIECANGQSYCLNGKCKTH------TGQCRLLWGATGRVSDPICFQHLNNGSSTGNCGYNLYTQRYNRCDDSDVMCGLLHCGAKCGHEK--ICYNHKCTSL-ARIPTKDCPD-CNSNGVCNSIGQCHCDEGFGPPFCNEPGYGGSLHSGP............................................................................................................................................................. 704
134 0.000e+00UniRef50_UPI000A2C08D3 disintegrin and metalloproteinase domain-containing protein 11 n=1 Tax=Parasteatoda tepidariorum TaxID=114398 RepID=UPI000A2C0  ali  19  67.................................YEVIYPVQIRQHVKLGISTRETGANTGEHYHQTSLLIKAFNYKFRIDLELNTHLLAPNLIQKHFLPEGSTQEIEHCYYHGTTKDYPGAIAAFRTCNGV-SGILHVGND-TFVIHP----FYGGDQSKKHPHVIYRYFSESKDKHTCGNTGMHE--------------------------------WGFKMFRMRPTQTRLKKDVRQVNKFVELALVLDQAMFD---------NRNASRNEVVNDAIQIVNCVDMYFRT--------VNTRVSVVYVETWAHKDQMEF--NSDVRQTLLNFMEYASRKLYK----VAKDATHLLTGRRFRGHEVGMAVPDSICTAKAVGVNEDSNIYE--------------------------PHLIASTVTHMLGHNIGMSHDHNGTDCKCDDWWGCIMAQTILGVNKIQPYHFSTCSLQDYINALRIGHGICLFNKPN-------------QLEDFRTCGNNVVEKGEECDCGSIEECMQ--ADPCC---------DPITCKLRVEAECSM--GPCC--EDCKLRGSNHMCRLSI-TECDIPEYCDGKDGQCPNDLFRKNGAPCKNGAGYCFHGSCPTPE------DQCEFLWGVGAMQSELQCYRQFNTQGTLSGNCGSDGQGGFIKCTEDNMKCGSLQCGTKCAEDK--ICMNQTCISIDVFCPTNNIALPCSGHGVCSNINTCHCDASWTSFDC.......................................................................................................................................................................... 721
135 0.000e+00UniRef50_G7Y4H2 Disintegrin and metalloproteinase domain-containing protein 10 n=2 Tax=Opisthorchiidae TaxID=6196 RepID=G7Y4H2_CLOSI  ali  31  1MHSSTVYLCELVVWLVISICCSLEPRLGDLFVEYELLSYPTAPLVAQHKRVRRNAKTVSAA----VRLPLLTSKQNLTLVLFPDVDLIGASARLTVGGVDHPKGLSADYIYRGYVDSYPNSIVFGSIIQGVFRGTVSLDKDTFYIEPAANYF----DYKTNFHSIMYHEQHVKFDGNMRRKRSTPDTATFNFCGLSNPDIARRMAELRSPISGVDVNTIPRRSRRASSPLPLNVEIGASNTRVCNLYLQSDTFLWDRIGMQHIRGNRELAVQEITSIFTQHVQGAQAIYQHTLFRDYPGISFRVDHVLINTEEDCKPRPVWRDLHNPFCAENIDVTNYLNLHSYTPHDDFCLAYVFTYRDFSGGTLGLAWVAEP--NGSGGVCEKHRLMREGSHN-VYKSLNTGVVTLLNYGSQVALKVSQLTFAHEMGHNFGAKHDDDHKCLPSDPRGNYIMFASATSGDKDNNNKFSLCSLDSIARLLGR---------------VLSDDSNCFLKSDGPFCGNQLTEEGEQCDCGFTKSS---CRDQCCHPKESSSPCKLRDTVWVNDSQCSPTAGECCT-HNCQFR--GTSHLCRGADECYRSAYCNGVEAKCPTSEHLPDGTPCQDHTRICKQGQCIGSICERIGWHECSLVRNKPEMMCFVSCRENRTCISTFQLEQDSNLRNKYVNELLRDGRGTKLKPGAPCDNYRGYCDVFHRCRSVEAEGPLARLRNLLFSPQVLEQVKXXXXXXXXXXXXXXXXXXXXXXXXXXXCAVSTPPSRYYSIPVRHTRSSVQT-SSHPSRDWSAPYPPPSFHMPSPWAWPRRTRPADRNGKRGSRTPRSKSLPFNPSSSLATESRRVIPSAPFLDPMDFPPPNA------RPTPIHCAISNSRKPNAERG......................... 962
136 0.000e+00UniRef50_Q923W9 Disintegrin and metalloproteinase domain-containing protein 33 n=111 Tax=Eutheria TaxID=9347 RepID=ADA33_MOUSE  ali  18  64..............................................................PDSVLVALEAEGQDLLLELEKKHKLLAPGYTETHYRPDGSPNHTDHCQYHGRVRGFRESWVVLSTCSGM-SGLIVLSSKVSYYLQPR---TPGDTKDFPTHEIFRMEQLFTWRGVQRDKNSQYKAGMASLPHV---------------------------------PQSRVRREARRSPRYLELYIVADHTLF---------LLQHQNLNHTRQRLLEVANCVDQILRTLD------IQLVLTGLEVWTEQDLSRI----TQDANETLWAFLQWRRGVWARR----PHDSTQLLTGRTFQGTTVGLAPVEGICRAESSGGVST--------------------------DHSELPIGTAATMAHEIGHSLGLHHDPEGCCVQADEQGGCVMEA---ATGHPFPRVFSACSRRQLRTFFRKGGGPCLSNTSAPGLLVLP-----------SRCGNGFLEAGEECDCGSGQ----KCPDPCCFAHN---------CSLRAGAQCA--HGDCC--ARCLLKSAGTPCRPAA-TDCDLPEFCTGTSPYCPADVYLLDGSPCAEGRGYCLDGWCPTLE------QQCQQLWGPGSKPAPEPCFQQMNSMGNSQGNCGQDHKGSFLPCAQRDALCGKLLCGTGCGP--RMVCQDRHCQNATSQE-LERCLTACHNGGVCNSNRNCHCAAGWAPPFCDKPGLGGSVDSGPA............................................................................................................................................................ 695
137 0.000e+00UniRef50_A0A0R3VTZ9 Uncharacterized protein n=1 Tax=Taenia asiatica TaxID=60517 RepID=A0A0R3VTZ9_TAEAS  ali  37  1MIVCGAPCLLPLILITSPLLAEQA--FAPQIGQYEELSYPALQPPPR--RSKRSMDRPSS------SFFFHAFGQNFSLVIYRDEGVLSPTAIVVAGGQIRPLSSDNNFAYRGFLKSHPKSLVYGSVVNGVFRGTIDVIDD-----------------------------ALVRRKRSPDIDGGDDALEPAFCGHSNPEIVRRLKELSQPASGAEGSSSLSGM-----RPPTRSYDAGPNSRVCNLYLQSDTFLWDHIKLPHIRFNRDLAVKEITSIFTQHVQGAQAIYQYTNFKDSSVSEVVVSL--------RPFDGFDLLILNPFCSENVDVTNFLNLNSYINHDDFCLAYVFTYRDFTGGTLGLAWVAEL--GGSGGVCEKHRLMREGSH-TVKKSLNTGVVTLLNYGTRVSMKISQLTFAHEMGHNLGAKHDDDFKCLPSDPKGNYIMFASATGGDKENNNKFSVCSVNSIARLLHQVLKVSTWNSSELSLMFYGES-NCFFTSNGSFCGNRLTEEGEQCDCGFTRED---CDDVCCYPKDSKE-----PCKLKKFANCSPTAGECCTSG-CQYRDSKHLCR--SAGECHKASYCSGNSAQCPPPVNIPDGTPCMNHTRICKLGECLGSVCERIGWQECSLSRGEPEMMCYVACRNIHNDTPCIS---TIQLETNLRKAYP-----LRLQPGTPCDNYRGYCDVFFVCRSVEVEGPLARLHKLLFSPQMLSKVKTWI.................................................................................................................................................................................... 683
138 0.000e+00UniRef50_T1J8C7 Uncharacterized protein n=1 Tax=Strigamia maritima TaxID=126957 RepID=T1J8C7_STRMM  ali  19  56...............................RYYEIIYPVQLRHHEKVGISTRDVSANTGKHFHHTALLIKAFSHKFRLDLELNTNLLAPNLIQKHFAQQITSQEIEHCYYHGMIKDVPEASAALRTCSGV-SGVIHFHNETF-----AIHPFYGGDLSKRHPHVIY---------------------------------EVKNKVKHSCGNSKMHEWGFIHFRKPLNTKQRTKRDVREVTKYVELALILDKAVFDKRN--------GSSRTEVIQDAIQITNIVDLYFRT--------VKTRISIVYLETWANGNQIIISD--DLRQTVLNFMDYSSRKLYK----VAKDSAQLLTGQTFRGEEGGMASPDTICTHRAVGVSEDINIYE--------------------------PHLAAVTLAHMIGHNMGMAHDDNHEDCVCTDWHGCIMAQSIVGLDNVWPYKFSQCSLKDYINILRIGHGICLFNKPNQLGDFYS-------------CGNGIVEEGEDCDCGIMEECSH--IDPCC---------DPITCKLLKEAECS--TGPCC--DKCKLRPPGFVCRPAQ-TECDIVEFCDGRMGQCPTDLHKKNGNKCDNGGGYCFYGSCPS------MNTQCKFIWGYDGEVADRQCFEEFNNEGSFNGNCGTDINGSFRKCSKENIMCGTLQCGTRCADDK--VCINQTCLSVGGRCPTNNIGLDCSGHGACSNINTCHCDEGW............................................................................................................................................................................... 708
139 0.000e+00UniRef50_A0A1L8DU35 Putative adam metalloprotease (Fragment) n=4 Tax=Nyssomyia neivai TaxID=330878 RepID=A0A1L8DU35_9DIPT  ali  16  91...IIIYIALLNVLFVDFGDAHGIHISNDRIHPAQFSSHTLIRPQVIHGRHKRAISTTLEEHVTHITLSFKASGESIVLDLQLNEDLLPHGHYLHYQDGLGRREDSDHCHYLGRIRGKKDSRAAISTCDG-IRGVIFDGQETFYVE-------SKPDSQLHSDHFLYSHADIEWDGKCGYEGTDESHNSTNELKYS-----------------EFNRILRYKRAMEDSERIRGPYNANRDSSFVELLLVVDSKVYNGLGQSLKKVHNHCKTIANXXXXXXXXXXXXXXXXXXXXXTDSN-------------------EVELSSDGDKTLKNFLYYRKKVLVQKFPNDNAQ---LLTREQFDGGVVGKALKGPICTYEFSGGVS--------------------------MDHSQIIGVVATTVAHEMGHNFGMEHDSAD---CKCEDERCIMSASS---SSVAPRHWSSCSIDQLNLAFHHGMNHCLKNRP-------------IRLFDSPQCGNGFVEKGEQCDCGLP----DYCENSCCDPF---------TCMLHANASCA--TGECCDLSTCRPRTAGTECR-SADGECDLPEFCTGESEYCPDNVFKRDTEECDRGKAYCYQGSCRSR------ADQCKVLWGPSGNSSDE-CYSKNIDGTRHGNCGFERFSNQYINCDREDIFCGMLHCGSKCGDEK--MCVKQKCRPIESEGTGIACPDDCNGNGVCNSLGHCHCEKGFAPPFCDAPGPGGSLDSGPASNPNAGAGTXXXXXXXXXXXXXXXXXXXXXXXXRQNRTMIKRTPQVPKQLIKQSPSKSLSPSSGGQPKSTPSSPDDMNSALLRSSRQDQESSLLNNNMFGKFKGFTLKPLPDATSTNIDAPNVAFVTPVTKHVEEDVSTVPNRVAPPVPKVP.... 955
140 0.000e+00UniRef50_A0A067R253 Disintegrin and metalloproteinase domain-containing protein 10 n=2 Tax=Zootermopsis nevadensis TaxID=136037 RepID=A0A067R253_ZOON  ali  38  10......................................................................................................................................................YSQSNKVNDPGFDAVIRSHRRKRWPSDEVPLSAGSSNPSTPPRHTSRLDTYYYNPNVFYDFPNESLSSTGSPDEVISVRHVHKRATVDPKKTTCMLYLQADHLFYQKYG----------TEEACIEVMTRHVQRVNSIYKTTDFNQDGNISFMVKRIKVYSMDALKDTTYRFPLNYG-------VEKFLELFSEEDYDQFCLAYMFTYRDFEMGTLGLAWTGDL--KNAGGVCEKNGHYR-----GSMKSLNTGIVTLLNYGKHVPPAVSHVTLAHEIGHNFGSPHDPD-LCTPGGDDGNFIMFARATSGDKRNNNKFSPCSLNSINPVLNAKARS---------------PKGCFTEPQAAICGNGVVEVGEECDCGWEED----CRDECCFPQRRYPPPEEPPCKLTPHSICSPSQGPCCT-SSCELK---YGDKCRDDNGCRDASFCDGRGPHCPPSINKPNKTIC-NEEFVCFMGECTGSICLAFGLESCQCIPGPHDKACELCCKLPGDNQPC--LSSFDWNTTPY------DMPDLFSKPGTPCNDYNGYCDVFQKCREVDPSGPLATLRKLLLSDESIASFK....................................................................................................................................................................................... 550
141 0.000e+00UniRef50_A0A210PPS2 Disintegrin and metalloproteinase domain-containing protein 12 n=3 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=A0A210PPS2_MIZYE  ali  18  2..................................................PTRSAEKYWGRHLDDVTLVFQAHQRKFTVDLTLNKHLFSKAYIEKTIKDSGSHHISNHCFYHGGLRDTPNSMAALSTC-GGINGFVTVDHETYHVEP--------VDEAVPGSIKVYKEVSLGPNPG------------------SHTHCESDDKQSIFFVNGTVNNLHRKEFSQRVRRSIRGPYDGNENARFVELFIVNDHRTFERQGR---------NKQTLIRRSQDIANIVSRLYRPL------NIYIALVGVEIWSDSD----QVTISPYANSSLEKFLLYRKQRINPYHQNDNAQLI---TGQTFNDGVVGKAIKSSICTHQYSGGVDMDRTRITH---------------------------VATTVAHELGHNFGMDHDNYSVCRCKQE--KCIMAPTS--GGSPSPSQWSTCSRVAIIEAFELGMDYCLKNMPEN-------------LYEGPVCGNTFVEDGEECDCGLAED----CTSKCCN---------ASTCRLKRGAECA--TGSCCNQDTCKPKPAATLCRAAME-ECDLAEFCNGESEYCPSDVYLQNGLPCKDKQSYCYQGLCKTH------TDQCSMLWGSTGRVSDPICFKHLNNGSKHGNCGYDWKREKYIRCDKDDVMCGLLHCGARCGDKK--ICLSNKCTPLSMLQILPCP--NCHGNGVCNSMGQCHCNEGFGPPYCNSPGHGGSTHSGP............................................................................................................................................................. 655
142 0.000e+00UniRef50_A0A2M4CUT7 Putative tumor necrosis factor-alpha-converting enzyme tace/adam17 (Fragment) n=2 Tax=Anopheles TaxID=44484 RepID=A0A2M4CUT7_ANOD  ali  43  304................................................................................................................................................................................................................................................KSTCMLYLQADHTFFQKMG----------SDETSIEAITRHVQRANYIYSKTDFNGDGNITFMIKRIKVHNLNAVKDPSYRFPGSYG-------VEKFLELFSEEDYDAFCLAYMFTYRDFEMGTLGLAWTGDL--KNAGGVCEKNGHYR-----GSLKSLNTGIVTLLNYGKHVPPAVSHVTLAHEIGHNFGSPHD-PEQCTPGGEDGNFIMFARATSGDKRNNNRFSPCSLKAIEPVLNAKARS---------------AKGCFTEPQEAICGNGVVEPGEQCDCGWEED----CKDSCCYPMSRHPRFDQKPCTLTPKAQCSPSQGPCCTLE-CTLK---YGDKCRDDNGCRDPAYCDGTMPVCPPSINKPNKTIC-NKEYVCYMGECTGSICLAYGLESCQCSVGPADKACELCCKQPGEDKPCLSSFDWNDP--------PFDVPDMYAKPGTPCNDYNGYCDVAQKCREVDPSGPLATLRKLLLSEESIASFKK...................................................................................................................................................................................... 752
143 0.000e+00UniRef50_H2LZT1 ADAM metallopeptidase domain 8a n=1 Tax=Oryzias latipes TaxID=8090 RepID=H2LZT1_ORYLA  ali  17  5.............WIFVLSLGIVDVRTLPHVSKYQTVVPQRLKDL-----STIKDTAPHEKYPDVLQYSLSIDRGKYTLHLEKNRYLVGKNFTVTSYSDDGTPDLRVHCYYHGHIVGVEESSASIELCSGM-KGFVTLRNRMYLIEPLASEEAEMLDNRGNPKAHSDEGPHAVYNYKHLRRKRSSCSHGNTTTFYDHGAR------------------PSGVFQLGSLKSRAQTKQQADKPRTVELVVVVDNSEYKKYG----------SKKTIESRVLEIANHVDKLYRP------VGVRVMLVGLIIWS----NRDQIEVSSNSDTTLIRFIEWRQRNLVQKIKHDNAQLI---TGIDFEGTTVGLANTNAMCTSNSGAI---------------------------NEDHNTNAIGVASTIAHEMGHNLGLTHDTENCCGSYTSKRGCIMAESL---GIVYPEQFSSCSKLQLRRFLEEYNPACLLDTPSTSRIFG-----------GPVCGNAFLEPGEECDCGSAKE----CTNPCC---------NATTCKLNAGAQCA--EGECC--HNCQLKPTGIICRPKA-GDCDLAEYCTGFSAACPADTFAQNGLRCNSGKGYCYNGNCPSRQEHCRRLDECFSRHGSCRKFSQRCAAKDQFCGTLFCGNGVTCNEATMKPEDNYPSDLGMVPTGTKCGNN--MVCYNNRCRNIKAYG-KNDCSSKCNNHGVCNHESKCHCDPGWAPPFC.......................................................................................................................................................................... 669
144 0.000e+00UniRef50_A0A1U8BWV0 disintegrin and metalloproteinase domain-containing protein 33 n=44 Tax=Boreoeutheria TaxID=1437010 RepID=A0A1U8BWV0_MESAU  ali  17  64..............................................................PDVLLVALVAEGQDLLLELEKNHRLLAPGYTETHYSPDGQPVHTDHCHYHGRVRGFPESWVVLSTCSGM-SGLIVLSSNISYYLHP------------------------------------------WASGDKDFSSHKIFRTEQLFTWRENSRYKAGMASLPHVPQSRVRREVRRSPRYLELYIVADHTLF---------LVRHQNLNHTRQRLLEVANCVDQILRSLD------IQVVLTGLEVWTQQD----HSRITQDANATLWAFLQWRRGLWARR----PHDSTQLLTGRTFQGTTVGLAPVEGMCRAESSGGVS--------------------------MDHSELPIGTAATMAHEIGHSLGLRHDPDGCCVEADEQGGCVMEAAT---GHPFPRIFSACSRRQLRTFFRKGGGACLSDNPGPGFLVLPT-----------RCGNGFVEAGEECDCGSDQR----CPDPCCFAHN---------CSLRAGAQCA--HGDCC--AQCQLKPAGTPCRPAV-NDCDLPEFCTGASPHCPPDIYLLDGSPCAKGRGYCLDGWCPTLE------QQCQQLWGPGSQPAPEPCFQEMNSVGNSQGNCGQDSEGSFLPCAQRDAQCGKLLCGTRCGPE--MVCQHRQCQNA-TFRELERCLTACNDHGVCNSNHNCHCAVGWDPPFCDKPGFGGSMDSGPA............................................................................................................................................................ 690
145 0.000e+00UniRef50_A0A1B6IV99 Uncharacterized protein (Fragment) n=3 Tax=Cicadellinae TaxID=33370 RepID=A0A1B6IV99_9HEMI  ali  37  1.......................................................................................................................................................................................................................................................LQADHLFFQRYG----------TEEACIEVMTRHVQRVNAIYRVTDFNQDGNISFMIKRIKVHSTEALQDSKYRFPGNYG-------VEKFLELFSEENYDAFCLAYMFTYRDFEMGTLGLAWTGDL--KNAGGVCEKNGHYR-----GSMKSLNTGIVTLLNYGKHVPPAVSHVTLAHEIGHNFGSPHDPDS-CTPGGEDGNYIMFARATSGDKKNNNQFSPCSLNSINPVLNAKARS---------------PKGCFTEPQAAICGNGVVEEGEQCDCGWEDD----CRDSCCYPQRGYPPPDEPPCHLTPNSLCSPSQGPCCTSE-CQLKF---GDKCRDDNGCRDSSFCDGRGPYCPPSINKPNKTVC-NDEFVCFMGECTGSICLAYGLESCQCIPQPPTKACELCCKMPGEDQPCLSSFVWNS--------APYDIPDMFSKPGTPCNDYNGYCDVFQKCREVDPSGPLATLRKLLLSEESIASFKRWILDRWYYAALICASVILILVLSTRLLGKTTDLKKAITIIHSSTTETVRLPLDSDGTNVVVHPAAVRSKLPLKQRVHEANHRRR.................................................................................................. 527
146 0.000e+00UniRef50_O43184-2 Isoform 2 of Disintegrin and metalloproteinase domain-containing protein 12 n=48 Tax=Euteleostomi TaxID=117571 RepID=O43184-2  ali  16  58.......................................................SFDSKNHPEVLNIRLQRESKELIINLERNEGLIASSFTETHYLQDGTDVSLAHCYYHGHVRGYSDSAVSLSTCSG-LRGLIVFENESYVLEPMKSATNRYKLFPAKKLKSVRGS-----------------------CGSHHNTPNLAAKNVFPPPSQTW--------------ARRHKRETLKATKYVELVIVADNREFQRQGKD---------LEKVKQRLIEIANHVDKFYRPL------NIRIVLVGVEVWNDMDKC----SVSQDPFTSLHEFLDWRKMKLLPRKSHDNAQLV---SGVYFQGTTIGMAPIMSMCTADQSGGIV--------------------------MDHSDNPLGAAVTLAHELGHNFGMNHDTLDRGCSCQEKGGCIMNAST---GYPFPMVFSSCSRKDLETSLEKGMGVCLFNLPEVRESFGGQK-----------CGNRFVEEG----EECDCGEPEECMNRCCN---------ATTCTLKPDAVCA--HGLCC--EDCQLKPAGTACRDSSNS-CDLPEFCTGASPHCPANVYLHDGHSCQDVDGYCYNGICQTHE------QQCVTLWGPGAKPAPGICFERVNSAGDPYGNCGKVSKSSFAKCEMRDAKCGKIQCGTKCADGK--ICLNRQCQNISVFGVHECAM-QCHGRGVCNNRKNCHCEAHWAPPFCDKFGFGGSTDSGP............................................................................................................................................................. 700
147 0.000e+00UniRef50_G1SF13 ADAM metallopeptidase domain 19 n=82 Tax=Euteleostomi TaxID=117571 RepID=G1SF13_RABIT  ali  16  33........................................RLQHELIIPQWKTSERFMREKHPLKAELRVMAEGQELIMDLEKNEHLFAPAYTETHYTPSGDPQTTDHCFYHGMVRKAEQSSVTLSTCRG-IRGLIVVSSNLSYIIEPL--------PDSEGQHLIYRSEHLKLPPGNCGSEHSKLTTRDWVLQFTQQT---------------------------KKRPRRMKREDLHSMKYVELYLVADFAEFRK---------NRLDQEATKHKLIEIANYVDKFYRSL------NIRIALVGLEVWTHGDMC----EVSENPYSTLWSFLSWRRK-LLAQKNHDNAQLI---TGRSFQGTTIGLAPLMAMCSVYQSGG--------------------------VNMDHSENAIGVAATMAHEMGHNFGMSHDSADCCSASAADGGCIMAAAT---GHPFPRVFNGCNRKELDRYLQSGGGMCLSNMPDTRTLYG-----------GRRCGNGYLEDG----EECDCGEEEECNNPCC---------NASNCTLREGAECA--HGSCC--HQCKLLAPGTPCREQAR-QCDLPEFCTGKSPHCPTNFYQMDGTPCEGGQAYCYNGMCLTYQ------EQCQQLWGPGAQPAPDVCFEQVNVAGDTFGNCGKDMNGEHRKCDKRDAKCGKIQCGTKCGFNH--ICFEGQCRNTSFFET-EGCGRKCSGHGVCNNNQNCHCFRGWAPPFCNTPGQGGSIDSGPMPPEXXXXXXXXXXXXXXXXXXXXXXXXXXKQNHKLGQLKPSA----LPSKLRQQFSCPFRVSQNGGTGHANPTFKLQTPQGRRKVTSTPETLRKPSHPPPRPPPDYLHGGTPPAPLPAHVSKAARNSP............................ 812
148 0.000e+00UniRef50_A0A2H8TXB6 Disintegrin and metalloproteinase domain-containing protein 12 n=4 Tax=Aphididae TaxID=27482 RepID=A0A2H8TXB6_9HEMI  ali  15  21....VLIIIFLTLVQIQYVCCGITDQIDNQFNNYAFIEPKLFNTRHKREIQSTKINPNGLEHAHDITLTFVDNGQDYIIDLSLNRGLIPVNYFEKHQKDGAHVDELEFCNYNGKIRNLPNSWAAISTCDG-IRGMFFDEISYHYIE-------NAEREPGNKFHILYKHKDLRANFTCGFPS-----------------------------TPEFTPNKIIKRNKRNTNSLKGPYHQNDKSRFIELVLVVDQEEYLSFNSE---------LSKVYQHAKNIANIINSLY------IPLNIFITLVGVVVWTEYN----EIALVSNGDTTLTNFLHYRRDHLVKDHPNDNAQ---LLTKIQFENGVVGKALKGPICTYEFSGG--------------------------VNNDHSIVQGLVASTIAHEIGHNLGMEHDTAE---CDCPSERCIMASSS---GTPGPTHWSLCSMEYLALAFEHGMDYCLRNKPN-------------RLFESPVCGNSFVEEGEQCDCG----VKDMCTNPCCNPD---------TCMFYKNATCA--TGECCDINTCHFKLAGVECR-SALHECDLPEYCTGDSEYCPDNVFKFDGSTCEANKAYCFNGSCRTH------ADQCRLLWGPTGESSENMCYLGNTKGSPQGNCGYNRLNKTYVKCTQKNIKCGMLQCKHKNERLHTFIDVNGSCRTAIVDLGLNDVGAKCGENMMCVNKGNCHCKIGYAPPYCDYPGPGGSDDSGPASSPNTLKGXXXXXXXXXXXXXXXXXXXXXXXXXSKNHR-----TPSDWNKTNRLKLSNDSEIGNKPNGIVSPSSTLLIDNQKPPSLHADLVGNYKGFSIKPLVQSEQPVVCRTPIRPAPSAPA................................. 829
149 0.000e+00UniRef50_A0A2G9SC07 Uncharacterized protein (Fragment) n=1 Tax=Lithobates catesbeiana TaxID=8400 RepID=A0A2G9SC07_LITCT  ali  20  14...............................QKYEVVYPRKL-----HTQHKRDTQS---KYPDLVNYGIELNGQPLELHLEKTEDLLTTNYTETHYLDDGTPVTTDNCYYQGRVKNDNNSQVSLSVCHG-LSGFIMTQEQQLLIEPLKTENGAHAVYS------------------------YQALEAPKTCGVDHTMYNDSIKTKI-----------------SFSTSNNEKRAFLKARKYIELYMVADNSMYLKYNR---------NKKELRERIFGIVNFVNSVYKPL------NIFVALTGLEIWDLKDQFIVVSSANIN----LDRFSGWRK---------------------NFDGATVGLAWVSTLCSDTHS--------------------------TGVIQDHSKEYVPIGATLAHEMGHNLGMDHDGGS---CFCSSESCIMAPSL---SFNTPQEFSSCSHQNYQDFILKNMPLCMKNMPDKNEIV-----------SNAVCGNQFTEAGEECDCGTEAE----CTNNCC---------DAKTCKLKEGAKCA--EGECC--SNCQMKTAGSLCRDDKD-DCDLAEMCDGKSGMCPSDRFRVNGFPCRNGEGYCYIGRCST------LQSQCQMYWGEGHVAGSDSCF----ALNTRGSPGFCRQSGINVPCPAKDVKCGVLFCGTRCAEE--YVCQGGRCTNIEAAYKSQNCSAKCPKNAVCDHELKCQCEKGWAPPNCDTXXXXXXXXXXXXXXXXXXQKKKQRRAANGSSGVANPTFRIDNQRRQANGYPSTPQPPASSQKPQTSAMYPPRTPAPSQKPQAPAMYPPQPPANSQRPQIPHAYQKPTNVVPARPSVPPQAYQKPRPAYPSVPPQAMKPNYRR.......................... 763
150 0.000e+00UniRef50_A0A1B0D0W8 Uncharacterized protein n=1 Tax=Phlebotomus papatasi TaxID=29031 RepID=A0A1B0D0W8_PHLPP  ali  26  463.......MVWVVSKFFWFLGALQIAQLHKNLHHYETLHVDDLN----HKIVKRGTKPSSHPYNTIKEVEFKVLGRNFRLILHPHKDVLHSNFRAYAIDGDGQVHMDHDAFYTGRVFGEAESSVRAHIEDNGIMTASVVLPDETYHIEPSWRHLPDSKGS---HMIAYRASDVKLSWNDKHKPGEMGAPITC-----GYVKEGSELEDEEDEEENAESVWTEESHKSREKRQADQYEYTPTKTRCPLLLVADYRFFQEMGGSNTKT--------TINYLISLIDRVHKIYNDTVWQGFKGMGFVIKKIVVHSEPTRVRGGEA---HYNMVREKWDVRNLLEVFSRESHKDFCLAHLFTDLKFEGGILGLAYVGSPRRNSVGGIC-----TPEYFKNGYTLYLNSGLSSSRNYGQRVITREADLVTAHEFGHNWGSEHDPDPECSPSASQGGFLMYTYSVSGYDVNNKKFSPCSLRSIRKVLQAKSGRC------------------FSEPEESFCGNLRVEGDEQCDAGLLGTEDN---DGCCD----------KNCKLRQGAVCSDKNSPCCQ--NCQYMPVGVKCREAQYSTCEQEARCTGNHAECPKSPAMADGTICQERGQ-CRGGKCV-PYCETQGLQSCMCDIIQDA--CKRCCRMSINETC------------------FPVEPPDVLPDGTPC--IQGFCNK-GICEKT-IQDVVERFWDII-EEININKVLRFLRDN................................................................................................................................................................................. 1128
151 0.000e+00UniRef50_Q7QI04 AGAP000974-PA n=16 Tax=Culicidae TaxID=7157 RepID=Q7QI04_ANOGA  ali  17  63...............................SYYQIIYPVQLRHHEKMGISTREVQPKTGKHFHRTSLLIKAFNHKFRLDLELNTQLLAPNIVQKHYLPSGSHREIEHCYYHGTVKDYPGASAAFHTCNGV-SGVIHVGN-ETFVIHPFYGGDLSKHPHVIFEARTKSNKGCANSGNLEWRTRSIRRGSSHHAGL--------------------------VELIDRNGAGRYRRDVRETTKYIETALIIDKAMFQKRN--------GSTRTEVVHDAIQVANIADLYFRTLN--------TRVSVVYIETWQGQNQAQIDGGKDISKAISNFNDYTSRNLYK----IDKDTTQLLTGETFAGGEVGMSVPETVCTPKAVGISVDMNPYE--------------------------PHLLAGTMAHMIGHNIGMGHDDNRDECICRDWHGCIMSQSIVGLENVQPYKFSECSRLDYIDALRIGHGLCLLNKPNEVEL-------------RKNCGNGIVEDDEECDCGSALDCD--KTDPCC---------DGITCKLKKESQCA--TGPCC--DKCILKPPGVICRDAH-NECDLPEYCNGESGQCPPDVHKKNGNPCGMNTGYCFNGVCPT------QAAQCERIWGYSGTGADRVCYEQFNSKGSINGHCGKDANGNYIKCEPENIQCGSLQCGTPCGDN--LICVNQTCVSIFPYCPTNHNNLECSGNGDCTNNNKCFCKFGWTGPDC.......................................................................................................................................................................... 737
152 0.000e+00UniRef50_Q9P2N4-2 Isoform 3 of A disintegrin and metalloproteinase with thrombospondin motifs 9 n=8 Tax=Euteleostomi TaxID=117571 RepID=Q9P2N4-2  ali  13  34...................LHPRQVKLLETLSEYEIVSPIRVNALGHFKRTRRSINSATDPWPAQAHYRLSAFGQQFLFNLTANAGFIAPLFTVTLLGTSEEEAELKHCFYKGYVNTNSEHTAVISLCSGML-GTFRSHDGDYFIEPLQSMDEQEDEEEQNKPHIIYRRSAPQREPSTGRHACDTSEHKNRHSKDKKKTRARKWGERINLATEAFSAYGNKTDNTREKRTHRRTKRFLSYPRFVEVLVVADNRMVSYHG------------ENLQHYILTLMSIVASIYKDPSIGNLINIVIVNLIV-IHNEQDGPSISF----NAQTTLKNFCQWQHSKNSPGGIH--HDTAVLLTRQDICCDTLGLAELGTICDPYRSCSISED-----------------------------SGLSTAFTIAHELGHVFNMPHDDNNKCKEEGKSPQHVMAPTLNF--YTNPWMWSKCSRKYITEFLDTGYGECLLNEPESRPYPLPVQLPGILYNVNKQCELIFGPGSQVC-PYMMQCRRLWCNNVNGVHKGCRTQHTPWADGTECEPGKHCKYGFCVPKEMDVPVTDGSWGSWSPFGTCSRTCGGGIKTAIRECNRPEP-----KNGGKYCVGRRMKFKSCNTE-----PCLKQKRDFRDEQCAHFDGKHFNINGLLPNVRWVPKYSGILMKDRCKLFCRDGTPCGQDTNDICVQGLCRQAGCDHVLNSKRDKC---GVC........................................................................................................................................................................................... 745
153 0.000e+00UniRef50_A0A087XBZ2 ADAM metallopeptidase domain 15 n=25 Tax=Percomorphaceae TaxID=1489872 RepID=A0A087XBZ2_POEFO  ali  17  57.....................................FLEKTRPFVLVDGQRRSLEAVQDGHPDKLLCELEVGGQRLLLDLEKNHNLLPRPPNIFFYLPNGTGVSVPHCYYHGSIRGFPHSRAALSTCSG-LRGVIVLNSSVTLELQPEVRER--------------------------------LEEPGGGEEEDIHLLFSAGPLEGAAAVGCAVAHTPGPPSSSRTASQRTKRDILSETKHVELVLVADHQEFLNYQR---------NNQTIVYRLLDVANQVDWFYRPLK------VRVALTGLEVWSDRNKIRVERS----ATDTLNNFLEWRSRELLPRLRHDNAQLIM---GESFDGTTVGMASQSSMCSRDRSGG--------------------------VNVDHLVSVLGVASTVAHELGHNLGMRHDTAERRCSCDNEGGCIMEPST---GFMPGQQFSSCSAADLSVSLLHGGGMCLFNVPQPDRLLG-----------GPRCGNLYVEKGEECDCGLLEE----CDDPCCN---------ASTCQLVPGAQCS-SDGICC--EDCKLRAAGSVCR-EPLGECDLPEYCTGSAPHCPPNVFLQNGEACRSGASYCYGGVCADMD------SQCQMLWGTNASSAPAMCFSSVNKQGNKYGNCGQLANGSYIPCASRDVLCGRIQCGTACGPGKA--CLNQKCEDASVFGV-EECRRKCSGHGVCNSNRKCHCDAGWAPPDCRFSGRGGSVDSGP............................................................................................................................................................. 718
154 0.000e+00UniRef50_A0A1W5A0B8 zinc metalloproteinase-disintegrin-like ohanin isoform X1 n=53 Tax=Osteoglossocephalai TaxID=1489341 RepID=A0A1W5A0B8_9TELE  ali  19  25......................RRPSLPRHVRDFGVVRPVRVSI-----RAKRSLAEHQ-EYPEEVKYALTIEGKNYTLHLEKNRLLIGKQYTETHYLDNGTPNYEDHCYYHGHVQDIKDSSVSVGICSG-IRGFVRAK-RSVYLIEPLAGSVDGDHAIYRHENLRSRRAT-------------------------------------CGNTNDTYYDHEPRVSRVYKASGWKSKPMVHEQRFVEMFLVVDNAEYRHYMRDMH---------VIKARMLEIANHVDKLYRP------MNIRVMLVGLEIWS----YMDMFDVSADPDDTLTRFIQWRKNTLLKNTKHDNAQFI---TGVDFQGDTVGLANKFAMCRDESGA---------------------------VNQDHNENPFGVASTIAHEMGHNLGLSHDATYCDCRTSYSKNCIMADRV---GKNYPETFSSCSQEELKNFLEKINPQCLLDKPSPDKLYG-----------GPVCGNAFLEPGEECDCGTVEE----CTNPCCN---------ATTCRLTKGSRCA--QGECC--ESCQFKQAGSLCR-SPAHDCDLAEYCTGSRAECPSNAFKMNGLPCNHNQGYCYNGQCPTLE------QHCEKLWGSGARLAPTTCFNQNMHGTKDAYC--VKTRNLYQGCAQKDIKCGKLFCGVQCNPTGTKCDHNKVCYENVCQDVTEGCSAKCHNHGVCNHQRQCHCDPGWAPPYC.......................................................................................................................................................................... 662
155 0.000e+00UniRef50_H3B7U0 ADAM metallopeptidase domain 28 n=2 Tax=Latimeria chalumnae TaxID=7897 RepID=H3B7U0_LATCH  ali  19  22...........................LPGVHRYEVVKPHKL-----HSYHKRDLPDQKMQYCTELSYGLTVEGKSLVLNLEKNKNLIAKGYSETHYLPNGQPQYEDHCYYHGYVQNVDDSSVSISTCDGV-RGYFRVRTRRYLIEPLLSSDTDD----------------------HALYRYESLQEQPKTCGVTNTTWEDGNEPRV-----------------AKSSTDEEKKNFISSRKFVELYLVADNSEYKK---------QDGNIMKVKKRLFEIVNFINMVYK------AINTHVALVGIEIWSDEDK----IEVSSVSGTTLDRFISWRNSKLNRQKQHDNAQ---LLTNVDFDGSTVGLAFVGTLCGSHSGGI---------------------------NQDHSSNAIAVGATVAHEMGHNLGMSHDKSSCKCSSGSC---IMQPSL---SYNYPKEFSICSLQNFQNFIVTKMPQCMRNMPSAEDIV-----------ADPVCGNNFQEQGEECDCGTPEE----CKNPCC---------DAQTCKMKESAQCA--QGECC--ENCKIMTVGAKCRNRKD-ECDLPEFCTGQSAQCPRDKFRVNGYPCQNGQGYCNNGKCP------LLEDQCHDLYGSGAKVGENNCYQKNSHGKYYGYC--KKISGTLVGCKQKDIKCGKLYCGTKCGN--GLVCRDGECLDLETVYKSTNCSSKCRGHAVCDHELQCQCEEGWLSPNCD......................................................................................................................................................................... 650
156 0.000e+00UniRef50_G5BYB3 Disintegrin and metalloproteinase domain-containing protein 28 n=1 Tax=Heterocephalus glaber TaxID=10181 RepID=G5BYB3_HETGA  ali  18  14.................SPAPVSALKELPQVKKYEVVYPIRLHPLHKREVKE---PEKQKVFETELKYKMTVNGKIAVLYLKKNKNLLASNYTETHYKSSGSPQVMDDCYYQGHIVNEKVSDASISTCRG-LRGYFSQGDQRYFIEPLSSAQHDEQE----------------------------------HALFRDEPSHSQADHSCGMDDILWAQGSQNVLSSATRQLKLDGRKNKNHSNYIEYYLVLDN---------------------------------GELYKKFNA------HVALVGMEIWTDDDKIKI----TPNISSTLENFSRWRGSNLLRRKHHDIAQLI---TKTDFSGATVGLAFLSSMCTPYHSVG--------------------------VIQDHSSNHLRVAGTMAHEMGHNLGMIHDSSY---CQCPATVCVMNKTVSFSI---PTDFSSCSHVNYDRFLEDKLSNCLFNIPLPRDI-----------ISTPSCGNQLVEVGEDCDCGTPEE----CTNICC---------DPKTCKIKAGFQCA--SEECC--EKCQLKKAGTVCR-SAKHECDLPEMCDGKSSHCPEDRFRVNGFPCQNGEGYCLMGRCPT------LAEQCTDMWGPGTKVADKSCYKKNEGGSKYGYCHVV--NGTHIACKAEDIMCGKLFCGTKCGHNK--VCINAECVDMERIYKSANCSSKCKGHAVCDHKLQCQCKEGWAPPDC.......................................................................................................................................................................... 634
157 0.000e+00UniRef50_T1HLM7 Uncharacterized protein (Fragment) (Fragment) n=1 Tax=Rhodnius prolixus TaxID=13249 RepID=T1HLM7_RHOPR  ali  17  10...............................................................................................HVVHRRDPSEIELCQYQGNIRGIPTSWAALSTCSG-IRGVIHDGETLHYIEKSDTNLS---------EHFVYKHDDLLTNNTCGYEGT------------------------PHDVMESVHRLNTANRVKRSPQNIRGPYNANRRSRFVELILVVDHRLYENMNKD---------LNEVKQRCKDIANIINALYTPL------NIFIALVGVVVWTELD----EITLSTKGDTTLTNFLHYRREKLVKEHPNDNAQ---LLTKIQFDGGVVGKALKGPMCTYEFSGGVS--------------------------MDHSTVVGLVATTVTHEMGHNFGMEHDTQS---CDCPDDRCIMAPSSSTTS---PTHWSSCSLEYLAVAFDHGMDYCLKNKPE-------------RLFDSPVCGNGFVEAGEQCDCGLEDR----CNNPCCN---------ATRCMLYSNASCA--TGECCDLSTCHPKNAGSLCR-SADHECDLPEYCTGESEYCPGDVFKMDGETCDWGKAFCYKGTCRSHS------DQCRLLWGPSGKSSDFLCYRMNTKGSRHGNCGYNRLNQSYVKCYDENIFCGMLHCGAKCAEGK--MCVGQKCLSVDALTAGTACKDNCNGNGVCNSLGHCHCNTGFAPPTCHHPGTGGSEDSGPASQPNARR..................................................................................................................................................... 612
158 0.000e+00UniRef50_A0A1J1IE80 CLUMA_CG011979, isoform A n=1 Tax=Clunio marinus TaxID=568069 RepID=A0A1J1IE80_9DIPT  ali  16  1.......MLEIISTFFSHHFLSESINFN---------HHSVIEPKIIHGRDKRALENTNGLHATHIHLIYEHNNKDVILDLHLNDNLIPVEHFISYQQPNGTKTEIDLCNYQGKIRHNQHSTVAISTCNG-IRGVVFDGYDTYYIE-------NDSNGSDRKHFLIQHSDLKNDHKCGYEGG-----------------INRTHDVTLHDTTEFNRIMRYKRMADGSQSQIRGPYNANKGSSYVELVLVVDNKVFKSLDKNFT---------KVHQHCKDIANIINALYNPL------NIFVALLGVVIWSEQNL----ADLSSDGDKTLRSFLNYRKKYLVKEHPNDNAQ---LLTGEVFEGGVVGKALKGPICTFEFSGGVS--------------------------MDHSKIVAIVATTIAHEMGHNFGMEH---DTDDCTCPDDRCIMSSSSSS---VAPTHWSSCSIDQLNLAFHHGMDYCLKNKPT-------------KIFESPICGNGFVESGEECDCGLPQ----FCNNSCCNPY---------TCMLYSNATCA--TGSCCDLTTCKPHTAGTICR-EAFGECDLPEYCTGDHEFCPNDVFKRDTEKCED--AFCYQGSCRSH------KHQCKVLWGPSGASSDQ-CYEKNTNGSRHGNCGYDRLKQEYIPCKHDDALCGMLQCGAECGDNK--MCVKQKCLSIEANGKVLDCPD-CNGNGVCNSKGHCHCFDGWAPPFCSGPGFGGSVDSGP--ASDPDSGRLFNKLMYIFFIGVVPCCTLFAWRQNNFQLKRKSPSLPRPNIKHHITKGSGSPQSPTFAPSSPNTPDDISSSLLRPTTDVENNYIFGKFKGFTLKPLPNANKVASKTPKVAYVHPVTKNDADLHIVPVREAPPPPVPKHGINA..... 847
159 0.000e+00UniRef50_UPI000BBEBC71 disintegrin and metalloproteinase domain-containing protein 19 n=5 Tax=Euteleostomi TaxID=117571 RepID=UPI000BBEBC71  ali  16  14.....RSSLCVCLLVVFLQCVEAAGSILDHVQSYEITYPIWLHPH----RHRRSAN---KEHPAETQVLISAEGQQLRIHLEKNEQLLAPGYQEIWYSPDGARKFSSHCFYHGTVQGIEGSSVAVSTCLG-LRGLISLNTSVSYLIEPL-----PVSMDAQQHAVFRAESLHLPGGSC---------------------------LHHHGNKGDEEQLNDFIHGMMSPRSAREKRDLSKNMKYVELLMVADKAEFENHGS---------SLENTKVKLLEAANLVDKYYK------ALNIRVALIGLELWTSQDM----ISVSDNPHGTLAAFLSWRRRQL-GVLPNDNAQLI---TGKSFQGTTIGLAPLKAMCSDYQSGG--------------------------VNTDHSESAVGVAATMAHEMGHNFGMSHDSTGCCQARAEDGGCIMAAAT---GHPFPRVFNGCNEKELKSYLSSGGGKCLFNLPNTRAIYG-----------GQRCGNGYLEDG----EECDCGEEEECTSPCCNANN---------CTLKAGAECA--HGICC--DKCKLKSPGVLCR-APSGPCDLPEYCDGKAESCPANFYLVDGTSCAGGQAYCYTGMCLT------LQQQCLSLWGRDGRPAPDLCFKKVNEAGDMYGNCGKDLFGKYRSCKDRDAKCGKIQCLTQCKPGQGKCGDDSICFNGECRNASDECNAKCHGHGLCNNNHNCHCDPGWAPPLCDQKGSGGSKDSGP-VNSHXXXXXXXXXXXXXXXXXXXXXXXXXXXRHKLHPLKTLASPPLPNCSAR--AEGKPMYADDHVNGHTNPTFLLKKQQSDHLVKSSPRPSPSCSARPRHGIVRPAVKPPPIPAYAALKKTPQPQPQIQPVASPQRQYSPQAYTTPPFKS..... 867
160 0.000e+00UniRef50_A0A151NYS3 DC-STAMP domain-containing protein 1 isoform C n=3 Tax=Alligator mississippiensis TaxID=8496 RepID=A0A151NYS3_ALLMI  ali  15  605.......................................................QHWQKEFPDQLRVTLELEGAWLELELEQNRELTPGTRALLYYLPNGMRTMQDNCCYQGRVRGHPGSRASICACAG-LSGLIAVSQNMSYGLEPSPRG---------------------------------------PHGTHLAYRTQDIRLVSQACGVGTPSPEQPLPDTEQPLLQRGKRAAVPEQRFVELVMVLDQAEFRLY----------PDLKRIQTRALEITNQVDVFFQPL------GIRVALLAVEVWNQGN----PIAVGPSARATLERFLQWRQTDLLPRLPHDNAQ---LLTGTAFAGTAMGMTSQGSMCSAARSGGVS--------------------------VDHSISVLAVASTVAHQLGHSLGMGHDPARGCECPGPDRSCIMD---IPTGLMPGLSFSSCSKQDLEHGLRQGRGWCLFNVPEPRSLVG-----------RPRCGNRFVEEGEECDCGLQEE----CADPCC---------NASTCQLLPGARCATGA-ACCQ--DCQLRPAGTTCR-EPRGECDLPEFCDGLLGHCPPNAHMQDGQLCAGGQAYCYGGVCTT------YAGQCQQLWGTGSVPAPAACLASLNAQGSEHGHCGQHLNGTYIPCAPRDVGCGRLQCGTACGSGK--VCLETRCQDVSVLRVSAC---QCHEHGVCNNLGHCHCERGWAPPSCESPGPGGSVDSGPLSMEEXXXXXXXXXXXXXXXXXXXXXXXXXXKRAGLHKRSKGTSCQYSTEAETRVRFLGAGVSADQSRISQPETQCPSQAPPERPQPPQWRQSTELQVMHSSTPAPLGAARPDPPSKPLPPDPVPKASQARGSDRPPPPTRPLPADPVVRG...... 1381
161 0.000e+00UniRef50_B4KA39 Uncharacterized protein, isoform B n=11 Tax=Drosophila TaxID=2081351 RepID=B4KA39_DROMO  ali  15  45.............................HIGDYEFSTHTVIRPQVHHGRTKRALQSSDGLHAPQLTLKYTHQGQRIQIELQRNDRLLPDAHFLRYQNRNFTKTDVDLCHYQGHIRGQPDSSVALSTCHGGLNGVVFDGQ-HTYFIHPHGKASGRLQDD---HYLLRHADMLQQNATCGYDSHKGSYENWPGENLEEDEVEQPTVPQRLDGGEFQRMLRRKRRQTDESQLIRGPYNANKYSSYVELVIVVDNKVYKHFGENAKRVHQHCKDLANXXXXXXXXXXXXXXXXXXXXXNESN-------------------EIEFSSDGDVTLHNFLNYRRSKLVVDHPNDNAQ---LLTKETFNGSVVGKALKGPICTYEFSGGVS--------------------------VQHSQVLAVVATTMAHEMGHNFGMEHDSND---CHCPDEKCVMASSS---SAVVPVHWSSCSIDQLTIAFSRGMNYCLRNKPT-------------RLFDSPQCGNGFVEPGEQCDCGLP----AHCENSCCNP---------ITCMLHTNASCA--TGECCDLNTCRPKMAGSTCRP-AENECDLPEFCTGESEYCPTDVFRRDTEPCDGNQAYCFLGTCRSH------TNQCRILWGPTGDNS-VHCYEKNLEGTRLGNCGYNLLNQTFVKCAPQHIHCGMLHCGAKCGDQS--MCVNQQCERVRKMGMGARCPEDCNDNGICNSRGHCHCDVGFGGEACNKVGHGGSVDSGPATDPSSALS--LQRXXXXXXXXXXXXXXXXXXXXRFAIRNKLFASGKLTENILKSGHKQPSTRANQNGAGPPAGGANGLPKSTPSSTDDMNSALLKSPSDSSDAAAVGNAT.............................................. 868
162 0.000e+00UniRef50_UPI00081123CE uncharacterized protein LOC108358114 isoform X1 n=2 Tax=Rhagoletis zephyria TaxID=28612 RepID=UPI00081123CE  ali  16  15MKLLVAICCKESFAIASENMPTKAHSSLPQTGDFEFSSHSTIRPEILHGRHKRALRSTQGQHVPHITLTYQHEGQRVHIDLHRNDDLLPTEHFLRYQNSNSTKTEMELCHYQGTIRGKPHSNAAISTCNGGVNGVIFDGTDTYFIHSGSDGRLQDEHFLFRHSDLLDKNSTCGYNSATDHHKHLQHLKSENLLQKDD----DLPQVPTHLDGSEFNRILRYKRSYENNDVIRGPYNADKHSSYVELVIVVDNKVYKSFGESPRKVHQHCKDLANXXXXXXXXXXXXXXXXXXXXXNEYN-------------------EIEFSSDGDLTLRNFLNYRSTKLVLDHPNDNAQ---LLTKEQFSGGVVGKALKGPICTHEYSGGVSNE--------------------------HSQIVAVVATTMAHEMGHNFGMEHDSSD---CKCQDEKCIMSASSTS---VVPVHWSSCSIDQLNIAFSRGMNYCLRNKPT-------------KLFESPQCGNGFVEPGEQCDCGLP----NYCENTCCDPH---------TCMLHTNASCA--TGECCDLSTCRPKAAGQACRV-AENECDLPEYCTGESEYCPADVFKRDTEDCDGGQAYCFQGNCRSH------TQQCRILWGPTGESSE-HCYGKNTEGKRGGNCGYDRINNTFIPCEKEHVACGMLHCGAKCGEGK--MCVDQKCERVRATGLGKQCPENCNSNGVCNSLGNCHCHVGYTGATCRLPGPGGSINSGPA............................................................................................................................................................ 756
163 0.000e+00UniRef50_A0A147BMU7 Putative disintegrin and metalloproteinase domain-containing protein 12 isoform x8 n=2 Tax=Ixodes ricinus TaxID=34613 RepID=A0A14  ali  19  70.................................YEVIYPVQVRHHEKLGISTRDATANKTNHFHQTSLLIKAFHYKFRLELELNDYLLAPKMLQKHLHPDGSSQEVEHCYYHGTIKDYPGAVAAFRTCSG-ISGIIHIRN-ETFVIHP----FYGGDLSRLHPHVIYKYFNVNKNPYICGNSRM----------------------HEWGFKHFRKTLPVPPRFKTRIHPRADKRDVREVYKFIELALVLDQAMFD---------ARNSTKSEVMSDAIQIVNCVDMYFRT--------VNTRVSIVYLETWATGDQVEH--TNDIRQALLNFVDYSSKNLYKQ----AVDATHLLTGRHFPSREVGMAIPDTVCTAKAVGISQDTNVYE--------------------------PHLVASTVTHMLGHNLGMSHDDGGNCQCQDSWG-CIMAPGILGTNHIQPYHFSSCSLEEYINALRIGHGICLFNKP-------------GQLEDFRTCGNGIKEQDEDCDCGTMEECA--KGDPCC---------DPITCKLRVEANCS--AGPCC--ENCKLRSAGQLCR-TPESECDIPEFCDGRSGECPGNIYKKNGQECKKGSGFCYRGKCQTSD------EQCEYIWGFGAKRSDEKCFGEFNVQGSVSGNCGQDGRGGYLKCSREHMLCGTLQCGTKCGPAK--ICVNKSCLPVEHFRPSNNLQLACSGHGVCSNVNTCYCDEGYLGPDC.......................................................................................................................................................................... 732
164 0.000e+00UniRef50_H3BF63 Si:ch1073-396h14.1 n=7 Tax=Gnathostomata TaxID=35060 RepID=H3BF63_LATCH  ali  35  1.............................FVKYYERLSYDRQDLHQRHQRAIVS----SREEDKLIPLEFHAYQRSFKFRLKRDVSVFTEDFKLVGNGRTVSAVTDVSHIYSGTLHGEEGSLCHGSIIDGHFEGFIQTQNGTYYLEPIRRLGAEE----SPFHSVIYRDSDIGKSPFHSDYSGFNSKGVSCGTQRLCHYLQNLTREQNPQEE----------------SLRRSQRSLDYSQTTCLLHIQADNLYYKRFG----------SMEVVLAQVANYIKAVNEIFGRTNFDGIRHINFKVKSVDV---------SQEADHSSPTYSLYIGPEKLLALHSENNWNEYCLSYLLTDRDYSG-VLGLAFEGRI--GNAGGICSKYQFLRDNSK----ATLNTGVVTLQNYGRYLPTRLVHLTLAHELGHSLGAPHDGDKECKTAFSHGNFLMFPRASSGEQYNNDRFSPCSIEFIARLLKAKKDQC------------------FVESNRPICGNQILNEEEECDVGYND------TDPCCY---SADQPVDRRCKLKPGKQCSPSQGGCCNHG-CVFSS--QERQCEEETECAFESHCSGMSAVCPTAPPKANYTLCNLGTWICLNGVCARSVCVKYGLEPCDCVTESMMEKCKLCCRHRGEPETCASTPAWRQYFGGSS---------ILLPPGSPCVEQQGYCDKFHICRLVDADGPIARLKNSFFNFEEYKDVADWMK................................................................................................................................................................................... 627
165 0.000e+00UniRef50_UPI000A28A876 disintegrin and metalloproteinase domain-containing protein 8 isoform X3 n=1 Tax=Phascolarctos cinereus TaxID=38626 RepID=UPI0  ali  19  1MCSSRLCCCLFVLILVLVMSLPSSLGLLTHVEQYEVVYPLKVPIP----RARRDLSSPPSLYPENLRYVLGMKGSNFTLHLRRNRDLMGASYTETYTLANGTEVTQDHCFYQGHVEGHQDSAASISACHG-IRGFFQTGSTV---------------------HLIEPLQGAGHEGRHAVYRAEHLIQKLVTCGVSNTTLEEDLEPRMAAAQKPRNWY-----------------------------------------------MKFRSREDIRSRVKEIVNHVDKLYQQLNF------RVVLIGLEIWDQGDKAQI----SSNPDSTLDSFLQWRIQKLVPRKKHDNAQLI---TGVDFEKTTVGLAKVASMCTSGSGA---------------------------VNQDHHANPIGVASTIAHEMGHNLGMDHDENCYCHEQKQNGGCIMAASIS--STVFPKTFSTCSRSNLENFVGNDITSCLTNFPKLDEIYG-----------GPMCGNRFVERGEECDCGVPEE----CTNHCC---------NATTCRLVTGAMCA--HGECC--HECQVVPLGQICREAQDV-CDLPEYCDGQRGECPENVFQENGTPCQDG--YCYNGACPTHQ------QQCQALWGEGASVASDSCFRLDIQAGCSGSSRQSLNKCGVLHCNGKDEPFEMVATGTKCGEQ--MVCYNGRCQDLHVYGA-ENCSSQCNGHGVCNHKRECHCQPGWAPPYCQQKVAAIT--------SXXXXXXXXXXXXXXXXXXXXXXXXXXXKRRMLPPLQKRKIATETPSGLSNPLFHEGGCRAPGLVSTASAAQHPK---SRSALVVPGQPPPAPPAAAGPQAPFRVPVYTRQAPQQSKPAPPSKPLPELKPKQVVKPTS................ 787
166 0.000e+00UniRef50_Q9H013-2 Isoform B of Disintegrin and metalloproteinase domain-containing protein 19 n=53 Tax=Euteleostomi TaxID=117571 RepID=Q9H013-2  ali  15  40........................................KLQHELIIPQWKTSESPVREKHPLKAELRVMAEGRELILDLEKNEQLFAPSYTETHYTSSGNPQTTDHCFYHGTVRETELSSVTLSTCRG-IRGLITVSSNLSYVIEPL--------PDSKGQHLIYRSEHLKPPPGNCGFEH---------------------------SKPTTRDWALQFTQQTKKRPRRMKREDLNSMKYVELYLVADYLEFQKNRRDQ---------DATKHKLIEIANYVDKFYRSL------NIRIALVGLEVWTHGNMC----EVSENPYSTLWSFLSWRRK-LLAQKYHDNAQLI---TGMSFHGTTIGLAPLMAMCSVYQSGG--------------------------VNMDHSENAIGVAATMAHEMGHNFGMTHDSADCCSASAADGGCIMAAAT---GHPFPKVFNGCNRRELDRYLQSGGGMCLSNMPDTRMLYG-----------GRRCGNGYLEDG----EECDCGEEEECNNPCC---------NASNCTLRPGAECA--HGSCC--HQCKLLAPGTLCREQAR-QCDLPEFCTGKSPHCPTNFYQMDGTPCEGGQAYCYNGMCLTYQ------EQCQQLWGPGARPAPDLCFEKVNVAGDTFGNCGKDMNGEHRKCNMRDAKCGKIQCGTKCGYNH--ICFEGQCRNTSFFET-EGCGKKCNGHGVCNNNQNCHCLPGWAPPFCNTPGHGGSIDSGPMPPXXXXXXXXXXXXXXXXXXXXXXXXXXCRQNNKLGQLKPSALPSKLRQQFSCPFRVSQNSGTGHANPTFKLQTPQGKRKVLRGGSPPAPLPAHLSRAARNSPGPGSQIERRPRPPQKALPANPVPGRRSLPRPGGASPLRPPGAGPQQSRPLAA. 897
167 0.000e+00UniRef50_V9KHK4 Disintegrin and metalloproteinase domain-containing protein 8 (Fragment) n=3 Tax=Chondrichthyes TaxID=7777 RepID=V9KHK4_CALMI  ali  18  1........................SNQLPEVERYEIVKPRKLDIVLR----KRALSSSEIVYPEKVSYSLNLEGNETIVHLEKNKGLLGKWYSETRYTENGTPQLKDHCYYHGIIDGVNDSSVSMSTCSG-LRGVLMAG-ARVYLIEPLEGAEAGEH---------------------ALYREEHLRVKRGTCGTSNYTIYDNEPKVAAIYQTFGQRLPQDFR----------------NTKYVELYLVVDNAEYQKYDRDFL---------KVRKRMIEIVNHVDQLYRTLNA------RIALVGLEVWSQSDK----FTVSTNPDVTLDRFLIWRE---NLKKKHDNAQFV---TGKNFDGSTVGLATKHSMCGYHSAG---------------------------VNEDHSKNAIGLASTIAHEMGHNFGMLHDEDCKCYKSKQEGGCVMD---GQTGTIFPKVFSSCSSEDMKNFLISRRPNCLLNAPGVDRLY-----------ESPACGNRFLDPGEQCDCGTAEE----CTNPCCN---------FTTCRFNDGMECSD--GECCQ--NCKIKPLGQLCR-AARHDCDLNEYCDGVNTQCPEDVFRMNGFPCKNGEGYCYKGRCPTH------KQHCVDLWGKGTMVAEDVCFELNRNGNAHFHCR--KTARGFVACQEKDMKCGKMHCGTKCGDE--MVCYNSQCQSLLLYGSP-NCSAKCHNRGVCNHKAECHCDPGWAPPYCDT........................................................................................................................................................................ 643
168 0.000e+00UniRef50_A0A146S8R0 Disintegrin and metalloproteinase domain-containing protein 12 n=78 Tax=Osteoglossocephalai TaxID=1489341 RepID=A0A146S8R0_FUNHE  ali  17  60..........................................RPFILVDGQRRSVQAVQDGHPDRLEAGLEVGGRLLLLDLEKNRDLLPRPPNIFFYLPNGTADPVAHCYYHGSVRGFPQSRTALSTCSG-LRGIILLNSSLSFELQPQDEQRLHQQD------------------------------------AVHLLFSTRPLGGAATAGCGVSHTSAPPPVSNRTHSGRAKRDILSETKYVELVLVADHQEFLNYQRNNK---------TIIYRLLDVANQVDWFYRPL------NVRVALTGMEVWSDRDKIRVEKS----ATDTLNNFLEWRTNELLPRLRHDNAQLIM---GESFDGTTVGMASQASMCSRDRSGG--------------------------VNVDHLVSVLGVASTVAHELGHNLGMRHDTAERRCSCENEGGCIMEPST---GFMPGQQFSSCSATDLSVSLLHGGGMCLFNVPQPDRLLG-----------GPRCGNLYVEKGEQCDCGLLEE----CDDPCC---------NASTCQLVPGAQCS-SDGICC--EDCKLRAAGSVCR-EPLGECDLAEYCTGSSPYCPPNVFLQNGEACQNGASYCYGGVCADMD------TQCQMLWGANASSAPAVCFSSVNKQGNKYGNCGQLTNGSYVPCANSDVLCGRIQCGTACGPGKA--CLNQKCQDVSAFGVDE-CRRKCSGHGVCNSNKNCHCEPGWAPPDCRYSGRGGSVDSGPA............................................................................................................................................................ 713
169 0.000e+00UniRef50_B7PB66 uncharacterized protein n=4 Tax=Arthropoda TaxID=6656 RepID=B7PB66_IXOSC  ali  29  39...................APRVSVVLSNHIRHFEPLFFNHHSFRDQHHRSKRS-------PKLDIRLEFAAHNRLFKLRMKRDTSVFSPD-VAFESSSKGPISYDISNVLKGYIEDDEESSVEGLITDGLFDGVITVRRGEEFFIEPASRYFDTLR---DFHSVMYKLSDVEFPKNRTCQSHRPLCQRKDTPGVDEEPFEASIWREGDAVHYGRKEPLEPQAEQDSAAAALGIRSVQPKKTTCMLYLQADHLFYQKMG----------SEEACIETMTRHVQKVNSIYRTTDFDQDGNISFLIKRIKVHTMDALREQEYRFPGNYG-------VEKFLELFSEEDYDAFCLAYMFTYRDFEGGTLGLAWTGDL--KNAGGVCEKNGHYR-----GSLKSLNTGIVTLLNYGKHVPPIVSHVTLAHEIGHNFGSPHDDDSMCTPGGENGNYIMFAHATSGDKRNNNRFSPCSLKSINAVLNSKARN---------------TKGCFSEPQDAICGNEVVEAGEECDCGWEDD----CMEPCCFPMRSNPPRDEPPCRLRPNVVCSPSQGPCCTQD-CVLK-LGEKCR--DDNGCRSASYC-----EYPCQLPKPLLTREYLHAQSLGRAECTGSICIAYGLQSCQCPRDPVTKACELCCRLPGDDSTCKSSFEWNHP--------PYDVPDLYAKPGTPCDNYNGYCDVFQKCREVDPYGPLATLRKLLLSTESMVSLRRWVLDXX----XXXXXXXXXXXXXXXXXXKFFGRKTETAKLVAGQTPCGPGPGNSVPYRSSTNQAMAKAVIASNPGIVSHGTQSGTASNFVKTTLSLPARVRAPPAVVGPSPCCNASCYAVYGLHEATLQRTRVGAFPRPPATEHPAEQFVGADP............................ 908
170 0.000e+00UniRef50_P78325-3 Isoform 3 of Disintegrin and metalloproteinase domain-containing protein 8 n=34 Tax=Boreoeutheria TaxID=1437010 RepID=P78325-3  ali  17  1.....MRGLGLWLLGAMMLPAIAPSRPWALMEQYEVVLPWRLPGP----RVRRALPSHLGLHPERVSYVLGATGHNFTLHLRKNRDLLGSGYTETYTAANGSEVTQDHCFYQGHVEGYPDSAASLSTCAG-LRGFFQVGSDLHLIEPLDEGGEGGRHAVYQAEHLL---------------------QTAGTCGVSDDSLGSLLGPRTAAVF----------------RPRPGDSLPSRETRYVELYVVVDNAEFQMLG----------SEAAVRHRVLEVVNHVDKLYQKLNF------RVVLVGLEIWNSQDR----FHVSPDPSVTLENLLTWQARQRTRRHLHDNVQLI---TGVDFTGTTVGFARVSAMCSHSSGA---------------------------VNQDHSKNPVGVACTMAHEMGHNLGMDHDENCRCQERFEAGRCIMAGSI---GSSFPRMFSDCSQAYLESFLERPQSVCLANAPDLSHLVG-----------GPVCGNLFVERGEQCDCGPPEDCRNRCCNS-------------TTCQLAEGAQCA--HGTCCQ--ECKVKPAGELCRPKKD-MCDLEEFCDGRHPECPEDAFQENGTPCS--GGYCYNGACPT------LAQQCQAFWGPGGQAAEESCFSYDILPGCKA-SRYRADMCGVLQCKGGQQPLGRAICGTRCGPEK--VCWKGRCQDLHVYR-SSNCSAQCHNHGVCNHKQECHCHAGWAPPHCAKLLTEVHA----GCQPRAGQGRGSSPIQGPPRAGPHHPPGPARPTPGLLGGSEEAAPCSSGHCVQPTLPSSCLHPAGTKAGHQANVRTPSAPSQTRGWCGQP................................................................... 739
171 0.000e+00UniRef50_UPI000719DA0F disintegrin and metalloproteinase domain-containing protein 12-like n=1 Tax=Priapulus caudatus TaxID=37621 RepID=UPI000719DA0F  ali  17  16LTILLSNFAIFKLAYATDEIGTHIQRIHGSLPSQEFQQHDITVPFQLVSRQKRHVDTTESGHLPETSFVFEAFQKTFTVDLSLNRDLFTSNYIEKHVIRNDINHTKEHCYYHGQVRGIPKSAAAISTCSG-ISGFVDDGEEAYHIEP-------VKDSSHGHHFVYRTSDLIPQIKITGYNDTV-------------------------DAMLLNLPTDRSQLLRRRKRYVQGPDESNQYSKYVELYIVNDKREFESWDRDLK---------KVITRSKEIANVVNALYKPLNT------YIALTGVEVWTHED----EIKLSVDGDETLFSFLTYRQERLIPKHPNDNAQLI---SGMVFNGGVVGKAYRGLICSFEYSAG--------------------------VTMDHSRLVLPVATTLAHELGHNFGMEHDIDS---CECPEKKCIMSPSS---GSFIPRHWSACSYRYWKKSLRRELDYCLHNKP-------------YHIFESPMCGNGYVEEGETCDCGLPE----FCDSPCCN---------ATSCQIYPNATCA--TGMCCDLTTCKHKPPATLCR-QAVSECDLPEFCRGDSLNCPDDVHVQDGEGCAAGKAYCYDGTCSSHE------SQCKRIWGPTGRVSASECFDHNLRGTERGNCGYFRNNKTFTACMQENIMCGLLHCGAKCGDN--MMCINESCQSVE-DIKIFQCPEQCHNKGVCNNRGHCHCIEGYSPPLCDVPGLGGSIDSGPPLTSIRPSRXXXXXXXXXXXXXXXXXXXXXXXXKHKGLR----DWMVLNSAKKTKKQAFMSSSSVVKTPRKTPSMTSKPIASVPSFKMNNGVTSPTCDVPVRPAPAVPLPSRP............................................ 823
172 0.000e+00UniRef50_A0A146ZQV4 Disintegrin and metalloproteinase domain-containing protein 8 n=1 Tax=Fundulus heteroclitus TaxID=8078 RepID=A0A146ZQV4_FUNHE  ali  17  1..........MLSLCLVLSLFTSSSGLLSHVQQYEVVHPQR-----RQERRTRSLQHNQ-LYPDTVQYDLIIEGRNHTVHLEKNRNLLGESYTETYYAEDGKRVTQEHCFYHGHVRGEPDSSVSVGICSG-ISGVLRIQQQVYLIEPLGQTVDDEHA--------VYRREHLKMPEPPGRASSTNTTL---------------------LFDQDQNQEPGPQTEGLFKPRSWKTKPPAGPQKFVELFVVVDNAEYQRYGK------------DTRSRILGVVNHIDKLYRS------VNIRVMLVGLEIWTDRD----YIDLDGNSDRTLDRFLVWRQ-QLLQRAKHDNAQLXXXVTGKDFDRDTVGLANKFAMCTVNSGG---------------------------VNQDHHDNPLGLASTIAHEMGHNFGLSHDAAGCVCGPAYSSSCVMTEKLDTGGQAYPDFFSDCSIRQLAQFMERALPSCLHSPGRISTIT-----------MGPRCGNALLDPGEECDCGTAQE----CNNPCC---------DASTCRLTEGSRCA--HGECC--ESCQLKASGSICR-SSAGDCDLPEYCSGAEPDCPEDSFEMNGKPCYNHRGYCYNGRCPT------AAQQCWRLFGEGAKEAPDVCFNLNRQGKEGANCG--RDGLGFIPCSSEDLKCGTMFCGTTCGHNK--VCLSSRCVDVSVFGKREECAEKCNNNGVCNHKKECHCNPEWAPPHCDIKYADMPQGQXXXXXXXXXXXXXXXXXXXXXXXXXCCRKGSARDRYTYKRKTQSCAAQLKPMSPENGLKDRPQISQPTLMASTSQACSPLVVSATPRRPPPQAKPAPPSIPLSPLINPKIHGTKPSPPPVPAVKPSPPPVARF---KPPPPPQPPAKPRLTRPV..... 846
173 0.000e+00UniRef50_Q9H013 Disintegrin and metalloproteinase domain-containing protein 19 n=140 Tax=Euteleostomi TaxID=117571 RepID=ADA19_HUMAN  ali  15  40........................................KLQHELIIPQWKTSESPVREKHPLKAELRVMAEGRELILDLEKNEQLFAPSYTETHYTSSGNPQTTDHCFYHGTVRETELSSVTLSTCRG-IRGLITVSSNLSYVIEPL--------PDSKGQHLIYRSEHLKPPPGNCGFEH---------------------------SKPTTRDWALQFTQQTKKRPRRMKREDLNSMKYVELYLVADYLEFQKNRRDQ---------DATKHKLIEIANYVDKFYRSL------NIRIALVGLEVWTHGNMC----EVSENPYSTLWSFLSWRRK-LLAQKYHDNAQLI---TGMSFHGTTIGLAPLMAMCSVYQSGG--------------------------VNMDHSENAIGVAATMAHEMGHNFGMTHDSADCCSASAADGGCIMAAAT---GHPFPKVFNGCNRRELDRYLQSGGGMCLSNMPDTRMLYG-----------GRRCGNGYLEDG----EECDCGEEEECNNPCCN---------ASNCTLRPGAECA--HGSCC--HQCKLLAPGTLCREQAR-QCDLPEFCTGKSPHCPTNFYQMDGTPCEGGQAYCYNGMCLTYQ------EQCQQLWGPGARPAPDLCFEKVNVAGDTFGNCGKDMNGEHRKCNMRDAKCGKIQCGTKCGYNH--ICFEGQCRNTSFFET-EGCGKKCNGHGVCNNNQNCHCLPGWAPPFCNTPGHGGSIDSGPMPPXXXXXXXXXXXXXXXXXXXXXXXXXXCRQNNKLGQLKPSALPSKLRQQFSCPFRVSQNSGTGHANPTFKLQTPQGKRKVLRGGSPPAPLPAHLSRAARNSPGPGSQIERRPRPPQKALPANPVPGRRSLPRPGGASPLRPPGAGPQQSRPLAA. 897
174 0.000e+00UniRef50_A0A182KX92 Uncharacterized protein n=2 Tax=Cellia TaxID=44534 RepID=A0A182KX92_9DIPT  ali  15  4........................................................STNGLHASHLTLSYTLNEADVILDLQLNKRLIPDGHFLSYQLPNGTPEEVDLCHYQGKIRGKPDSSAAISTCGEGIRGIIIDTDDTYYIESPLTSANAAQGNGETASINLGEHFIYRHADLVPAGPNGDGHRCGYEGGHINATHDPELYQQHMAA---PRREKRATSSGSSSPKIRGPYNANKYSSYVELVIVVDNKMFKTMRE---------NFKTVQQYCKDITNIINALYEPL------NIFVGLVGVVVWNEGD----EIELSKDGEVTLKNFLHYRKKTLIKDHPNDNAQ---LFTKEHFDGGVVGKALKGPICTYEFSGGVEMY--------------------------HSEIIGVQATTVAHEMGHNFGMEHDTAD---CECPEERCIM---SASSSSIAPKHWSRCSIDQLSLAFHHGMNYCLMNKPES-------------LFDSPVCGNGFVEAGEQCDCGLP----DYCDNSCCDPR---------TCMLHSNASCA--TGECCDLRTCKPMIGGTVCR-QADGECDLPEYCSGESEYCPGDVFKRDTEVCDGGKAFCYRGTCRS------QNDQCRLLWGPTGKSSEQ-CYVKNEDGSRHGNCGYNRVKNEYVKCDGADVHCGMLHCGAKCGEGK--MCLNQMCMSVEASGSGAACPENCNGNGVCNSEGHCHCDLGFAPPLCNLDGFGGSLDSGPA............................................................................................................................................................ 682
175 0.000e+00UniRef50_UPI0009752AA3 disintegrin and metalloproteinase domain-containing protein 12-like isoform X1 n=4 Tax=Crassostrea gigas TaxID=29159 RepID=UPI  ali  17  5...........VFFISFVGFLHLISVLGDNLIHQNVLHFQVIKPVFYHNRQARGTTHRNGTHLQDVTLYFKAFNRDFFIDLSVNKYLFSKNFIEIHRNNGFSIHKPSHCFYHGSLRGFQHSIVALSTCDG-IRGLISDGRVSYHI--------DPSPEHGPGHHKLYIEPDDPVQRR-----------------------DEKLVHSSLHANATLNYLHTRDFLHRVRRELRGPYDGNSNARFIEMYIVNDQRMYERYMRQDR---------QVIQRSKDIVNIVSKLYNPL------NIYIALVGIEIWEQDN-----FQIQPQANDTLERFLNYRKYSINPKHENDNAQLI---TGQQFNNNVLGKAYVNTICTFSSSGGVSSDP------------------------DSRNQLIQVATTVAHELGHNLGMAHDNYSYCQCPDD--KCIMAPT--QGGIAPPTKWSTCSKISLAENFEIGMDYCLRNKPE-------------KLYDGPVCGNGFVEIGEECDCGLPEDCKTRCCD-------------ARTCRLTTGAVCA--TGKCCDTQACVLKPRATLCR-GSYEECDLPEFCNGESEYCPADVYRKNGIECGNGQSYCLNGKCKTH------TGQCRLLWGPTGRVSDPICFQHLNNGSSTGNCGYNLPTRRYTRCDDSDVMCGLLHCGAKCGHEK--ICYNHSCTSL-ARIPTKECPD-CNNNGVCNSIGQCHCNEGFGPPFCNEPGYGGSIHSGP............................................................................................................................................................. 700
176 0.000e+00UniRef50_UPI000B92D16D disintegrin and metalloproteinase domain-containing protein 12 n=1 Tax=Pieris rapae TaxID=64459 RepID=UPI000B92D16D  ali  16  37..................................EFRRHTLVRPLLHHARTKRQITSTKDTHHPELTLNIAKGEEDYVLDLRLNDHVVAGDHVVSYQKDGETILHKPSCQYRGTVRGREGSSVAISTCHG-FSGIIFDGKKLMYIEPAEDNNLDSQHY-------IYDHSDLKSNFKCGYEGGVTSNKS---------YDPELMEKYNSEQNINKIRASRYKRETFEDTQVRGPFNANKLSRYVELVLVADNREFKVNGESLELVHHRFKDVANXXXXXXXXXXXXXXXXXXXXXSEGD--------EIKLEEDGDK-----------TLTAFLHYRRDRLLRDIPNDNA---HLLTQQKFKDGVVGKALKGPICTYNFSGGVAT--------------------------NHSNVIGLVATTIAHEMGHNFGMEHDTEADCKCPDE--KCIMSPSSTS---VTPTHWSSCSLRSLALSFERGMDYCLRNKPKS-------------LYDSPTCGNGFLEPGEECDCGLIP---LAACTSCCDHY---------TCTLRANATCAV--GECCNTETCRPKSAGTVCR-SADKECDLPEFCSGTSEFCPKDVYKMDATPCSDNRAYCVRGSCRTH------TDQCKLLWGSTGESSDQRCYQSMNIKGDKNGNCGRESTSSFSPCDPQNALCGLLQCGAKCG--HNMMCLNTKCVSVEAKKKTADCPSNCSGHGVCNSEGHCHCEPGFAPPLCALPGPGGSYDSGPATDSSLQRXXXXXXXXXXXXXXXXXXXXXXXXXXXRQPRKTIPSPKKSSLQRRLSRSASKFASNFQNNTPNNAQAVSVHTVSNPDDMSSSLLRSDSDHSPAGNVNPSV................................................. 844
177 0.000e+00UniRef50_G3NNC9 ADAM metallopeptidase domain 28 n=4 Tax=Clupeocephala TaxID=186625 RepID=G3NNC9_GASAC  ali  17  3...MWSQMNSLTISYLHSFPLESRGHDLEDVKDYEVVRPVRL-----HSVRRRHAEHLR---PETVRYAMTLGGRDIEMRLKRNHELLTKDYTETYYQADGTPDDIDHCYYHGSIVNDSQSSVSISTCDG-LRGYFRTS-AQRYLIEPLSGGDGGDHAVMTFE---------------------EKNSPPAVCGVTNTSWSDDYEPP-----------------TSQSRSKSRTISITQKQKYIELFIVADNRAYVKMERDQTR---------LRKRIFEIVNFINMAYKPLRTF------IALVGLEIWSERDL----FTVTPPAGANLNAFMMWRNSELLKRKQHDNAQFI---SGIDFEGATVGLAYIGTLCSGHSVGVIQ---------------------------DHNDRAIAVGATMAHEMGHNLGMDHDDSITCACSADS--CIMAAAL---SWNIPRTFSSCSGNEYEKYLLGRNPECLLDKPDFSDLLPP-----------SVCGNGFLEKGEQCDCGSETECTNLCCN-------------ATICTLKEGAQCA--EGECC--EDCKVSPRSTECRRKQD-ECDLAEYCDGQSPICPEDVFGVNGLPCGADLGYCFDGRCPQRV------NQCGKMFGGDATEGESFCY-NQNTRGTYFAFCKRPEKETYIPCQKEDVLCGKLFCGTKCGDGK--VCSQNECVQLETAYRNVNCSAKCPGHAVCNHRSECQCEPGWLPPQCD......................................................................................................................................................................... 652
178 0.000e+00UniRef50_W8AKD0 Disintegrin and metalloproteinase domain-containing protein 10 (Fragment) n=1 Tax=Ceratitis capitata TaxID=7213 RepID=W8AKD0_CERCA :_  ali  43  84..................................................................................................................................................................................................................................................TCMLYLQADHTFFQKMG----------SDEASIEAITRHVQRANSIYKNTDFNNDGNITFMIKRIKVHNMNSVRDPTYRFPGNYG-------VEKFLELFSEEDYDAFCLAYMFTYRDFEMGTLGLAWTGDL--KNAGGVCEKNGHYR-----GSLKSLNTGIVTLLNYGKHVPPAVSHVTLAHEIGHNFGSPHD-PEQCTPGGEDGNFIMFARATSGDKKNNNKFSPCSLKSIEPVLNAKARS---------------AKGCFTEPQASICGNGVVEGDEQCDCGWEED----CKDTCCFPMSRHPRIDEKPCTLTPRAMCSPSQGPCCT-GDCKLKF---GDKCRDDNGCRDPSFCNGLGPECPPSVNKPNKTIC-NKEFVCYMGECTGSICLAYGLESCQCIPGPTDKSCELCCKLPGEGNACRSSFEWNEP--------PFDVPDMYAKPGTPCNDYNGYCDVFQKCREVDPSGPLATLRKLLLSEESIATFKKWVQHNWY............................................................................................................................................................................... 537
179 0.000e+00UniRef50_A0A1S3RWC4 disintegrin and metalloproteinase domain-containing protein 15-like isoform X1 n=85 Tax=Neopterygii TaxID=41665 RepID=A0A1S3RWC4_  ali  18  103.......................................ERTRPFVVVDGHTRSLSEAQNGHPDKLQCGLHFGGSIYLLDLEKNHDLLPKPPNVFYYLPNGTGVSLEHCYYHGSVRGFPQSRVALSTCSG-LRGVVAINSTLSFELQP--------EEDHEDEEGAEESGGEEEGMHLLYSTRPLERGSVGGCGVSHTPVPPIHIPPQV--------------------PHRSKRDILSETKYIELVLVADHEEYVNYQKINK---------TIIYRMLDVANQVDWFYRPLS------VRVALTGLEIWSDQDK----IQVDKSPSNTLNRFLEWRTRELLPRLRHDNAQLIM---GESFDGTTVGMASQSSMCSKDRSGG--------------------------VNVDHLVSVLGVASTIAHELGHNLGMNHDTADRHCQCQNEGGCIMEPST---GFMPGQLFSSCSARDLSLSLLHGGGMCLFNMPQPEKLLG-----------GPRCGNLYVEKGEECDCGLLDE----CNDPCC---------NATTCKLVPGAQCS-SDGICC--DNCKLRTGGWMCR-QPLGECDLPEHCTGTSPYCPPNVFLQNGEPCEEGSSYCYSGVCAS------FNTQCQMLWGPNSTRAPPVCFSSVNKQGNKYGNCGQMPNGTYIPCSNKDVHCGRLQCGTACGLDKA--CWNQRCQDVSLFGV-DDCQSKCNGHGVCNSNKNCHCDVGWAPPDCRYTGHGGSVDSGPARA.......................................................................................................................................................... 771
180 0.000e+00UniRef50_C3Z0K2 Uncharacterized protein (Fragment) n=1 Tax=Branchiostoma floridae TaxID=7739 RepID=C3Z0K2_BRAFL  ali  35  2.................FVLLLPGEQLNQFVTHFEGLRYDTDRLHAKHQRARRAV----LPEESRVHLAFFAHGRDFHLQMSKDNSMFSRDFQLETT--GGIQQMDLSHIYSGHVVGDPKSVCHGSIIAGRFEGFVYTSDDDYYIEPAERYFNSTQD----FHSVMYKAQDVIDPAPHGHKARCGVHEDHVVIEPHDQSEEVGIKSICFSCKKKY------------SPPHQRHRRAPGDKNTCPIFIMADHKFFEKYR----------TWEATVAQIAAHVKAANLIYRPLELDGRTGYGVTVSRLKINTTEDKVY------PDNPFREDFIGAEAYLDHISNMNHNDYCLAYGFTDRDFEG-TLGIAWTGAICSSHLS-------------YAGIFQSRNTGLVTVQLFGNHIPTKVSHITFAHEIGHSWGSPHDPP-MCTPGGFDGNYIMFAQATSGDRPNNSKMSRCSVDRMS------------------LTVAARAFRCFEVEQATLCGNGIVEEGEECDCGF-QDVCDRIGDRCC--NGATPGVIGVGCTRKQGATCSPSEGPCCNPETCSYRSASEVCT--KETECALSASCSGISADCPKPANK--SGSCAEGSNTCVGGECVGSICDLDNMESCQCTLKADGDLCQVCCQQPGQPGS----------------CKPYTARTILKPVGSPCDNNKGYCDALRKCREVDIDGPLARIKRLL................................................................................................................................................................................................. 623
181 0.000e+00UniRef50_F7CRK3 Uncharacterized protein n=10 Tax=Tetrapoda TaxID=32523 RepID=F7CRK3_XENTR  ali  32  1MFSFQHFNFYMVAAFLLVSAGSSCVTKKSFLKYYENLSFDNHDLDQKHKRSKR----ASEEEKEPIYLDFFAYKRKFALILRRDLNVFADDFQV--VSNNRTLSVDISFVYSGALKDEFGSFCHGSIIDGHFEGFIQTKNGTFYVEYEKNSNGTEESYIYHEEDIDYSILKDIKSFELTLKKYQFLEKMKWKAKEEDLT--------------------------------RKKRSLDLSRTTCLLYLKADYLFYKRFN----------SIEQVISQISSYMTSVNAIYEQANFNGIKDINFKIKTLNV---------TISAHRNAALNQVRICLFKKSLIFAYSEISKTAGKLLATGRSFQFT--------SMFNGNSGGICSKYSQYGENPN--TFVTLNTGIVTIQKYGQYLPPRLIHITLAHELGHSLGAPHDESEECARTSPNGNYLMFPYAMDGNQYNNDKFSSCSIYYIGNLLRVKKDQC------------------FVESDRPTCGNQIVEEGEQCDVGYND------NDPCCY-----GAESALQCTLKPGKQCSPSQGLCC-SHLCSYMPKSQ--RCQDEAECTLENNCTGDSAKCPKPLPKSNYTLCNLGTRICINGMCRQSVCAKFGLEQCDCDSESMLEKCQLCCQEPDNVYS-------CKSTKSVELEHFFKRALLQLPPGSPCGNRQGYCDKFHICRLVDADGPIARLKNSFLNLIELEDPATWMK................................................................................................................................................................................... 649
182 0.000e+00UniRef50_A0A1Y1NH48 Uncharacterized protein n=4 Tax=Neoptera TaxID=33340 RepID=A0A1Y1NH48_PHOPY  ali  16  5...FCRRTLGLLLLFVFIHRADFHLPVTKAEPHPDFSRHTLVKPRIYHGREKRQISTTKEEHLHHLTISYNAEGKEYVLDLQLNRNLIPKGYFRRHQENGKKVVNIDLCHYHGTIKGIPNSWAAISTCDDGISGMVFDGTEVHYIEKPSDGNVQFESD----HYFYKHSDLVPNNKSCGYGDHDHLATRLPVN----------------------NRILRYKRGTDSQSTLKGPYNANRQSRYVELILVVDNAEFKEMGENHRRVEHHCQQIANXXXXXXXXXXXXXXXXXXXXXS-------------------EQDELTFSTNGDTTLTNFLHYRKDQLIKEHPNDNAQLLTKFS---FEHGVVGKALKGPICTIEYSGG--------------------------VNTDHSPIIGLVATTVAHEMGHNFGMEHDTNE---CVCPEERCIMAPSS---SSTPPTHWSSCSLEYLALAFEHGMDYCLRNKPQA-------------LFASPVCGNGFVEPGEQCDCGLP----NRCDNTCCN---------ATTCMLYSNATCA--TGECCDLKTCRPKSASTLCR-SADYECDLPEYCTGQSEYCPADIYKMDTETCDGGKAYCYQGFCRTRS------DQCKLLWGETGKSSDDQCYLLNTKGSRHGNCGYNKLNQSYFKCKDEDIFCGMLHCGAKCGESK--MCVNQKCMSIESLRMAATCPNDCNGNGICNSLGHCHCRDGFAPPFCDLPGFGGSEDSGP............................................................................................................................................................. 712
183 0.000e+00UniRef50_A0A2A3EDZ1 Disintegrin and metalloproteinase domain-containing protein n=1 Tax=Apis cerana cerana TaxID=94128 RepID=A0A2A3EDZ1_APICC  ali  15  110............................................................EHADVLVVGLELDGVKRTLDLRLNSDLIPVGYQQRHQHQGTTPSKVELCHYQGSVRDLPGSWVALSTCRG-LRGVVFDGESLHHIQP--------EQESLDSRHYVYKHSDLVANHTCGYEGTSHHVLDREQRGIVSRIARRLEMEIEVFVHFQHKRAAE---------AIRGPYNANRHSRYVELVLVIDKKEYIALDENLDKVHQHCKD------IANIINAVSRIFTNLRIGIPLNIFIALVGVQVWSDAD----EIALSPNGDTTLSNFLRYRREKLVQDMPNDNAQ---LLTRITFEGGVVGKALKGPICTYEFSGGVS--------------------------MDHSNVVGLVAATVAHEMGHNFGMEHDSADCDCPEENGPRCIMASSS---GSSGPTHWSTCSLEHLALAFEHGMDYCLRNKP-------------QKLFDSPICGNGFVEPGEQCDCGLKE----NCDNPCCN---------VTTCMLHGNASCA--TGECCDLKTCRPKTAGTECR-SAEHECDLPEYCTGQSEYCPVDVFKMDGEACSMGKAFCYQGSCRTH------NDQCKLLWGPTGTSSDAQCYEMNTKGTKHGNCGYNRIESSYVKCTGENLLCGMLHCGAKCAPGK--MCVNQKCMPVADLRASVSCPNNCGGNGVCNSLGHCHCNRGFRPPDCTQPGVGGSEDSGPA............................................................................................................................................................ 819
184 0.000e+00UniRef50_A0A1B6EJE6 Uncharacterized protein n=4 Tax=Cicadomorpha TaxID=33365 RepID=A0A1B6EJE6_9HEMI  ali  16  1MAVSLQWVLCVIFWMISGFQTESVFTGKSGLAPPDFSRQSVTKPRIYHGREKRQISSTRAHHIHDVTVALDMNGRDQLLDLRLNRELIPKGYFEKHQKDGSYVIRVELCHYQGKLRGVPDSWAAVSTCNG-LRGVVYDGQELHYLERATNS-----------------SQIHDIDHYLYSHSNLVSNFTCGFEGTDHEHISDFHKNHRISK-----------RFKRSDEMIRGPYNANASSSYVELVLVLDNKEYKALGENMNNVNSHCKDIANXXXXXXXXXXXXXX-------------------XXXXXXXTDYDEIALSSNGDTTLTNFLHYRRERLVKEHPNDNAQ---LLTKMQFEGGVVGKALKGPICTFEFSGGVS--------------------------MDHSSVVGLVATTVAHEMGHNFGMEHDSSD---CQCPDDRCIMAPSSSAMS---PTHWSVCSLEYLALAFEHGMDYCLRNKPT-------------KLFDSPVCGNGFVEAGEQCDCGLK----DHCDNPCCNAN---------TCMLFSNASCA--TGECCDLKTCRPKTVGTLCR-EAYQECDLAEYCTGHSEFCPEDVFKMDGSKCNKGKAYCYKGSCRTHS------DQCKLLWGPSGKSSDTQCYTMNKKGSRHGNCGYNRLNQSYIKCRDEDLQCGMLHCGARCGEGK--MCVNQKCMAVEAAAKVAQCPNNCNNNGVCNSRGHCHCNMGFAPPHCDYPGPGGSQDSGPASDPNARRXXXXXXXXXXXXXXXXXXXXXXXKRNPTFWRKKPRIPNADKKMASAGNRGLPPTVPDTSRASLLPSADNAGASAHPFSGSQLQNNLVGQYKGFSIVPTPTRTAPSIAPVQKVSPPKVPDNAINQHLIPYPIRPAPKVPPTSVG...... 876
185 0.000e+00UniRef50_A0A2T7P3Z8 Uncharacterized protein n=2 Tax=Pomacea canaliculata TaxID=400727 RepID=A0A2T7P3Z8_POMCA  ali  33  6.......................SAKLNDYILDFRPLTYDRVAVHNNHHRVRRSLDS-------DLHIRFNAYERDFQLRLQPAEGIFSNDHKV-YRDGVGIHTADTSFIYQGTVQGDPHSSVHLSVHNGSIEGHIKVDGSLFHIEPASKYL-----NSPIFHTVIYPDTHLDKDPYRARREAEVGSCALDHLQEWMAASSQLEEPAHMTEDEQLNQPYHMYSADNNAAANIRVKRADDTKKTCSLHMIADPLLFDFFKNKRRGVTDDLAEEDIIGFFSAHVKAISDIYSTTFFENYTGIRFQIHRTTIMN-PTKSSTSTCGTYRTEYCANNLDVSNFLDLTSLDNHDNFCLAFTFTYRDFSGGTLGLAWVAT-EQSIQSGVCGRHSTF----TGGKEKSLNTGIVTIINFGKTVPNRVSQLTFAHEAGHNFGSPHDIGSDECAPASDGNYIMFPSATGGDQPHNDDFSRCSKDNMTRILKQ-------------VFQGYALHASLVTSDEAFCGNKITEPGEQCDCGFENECNTATS--CCVPRK-EGQNDGNMCKLNSGAECSPDSGPCCKEG-CKLIQPNETVECQAETNCSYASQC--KYPFLGTPRHKPDGNFCNTFTKVCSKGECIAPLCKRISWEECFLTSGNAADFCYVACKNNVSGVCVSSSNSFKRLLEEAAKNRGSDKPQLTLPPGSACDNYRGYCDAFHKCQRVDAQGPFNQLTNLIFNPVTLGRVKDXXXXXXXXXXXXXXXXXXXXXXXXKLFGYNTPSEDPKYKPSR----------EQRARAQGNARGNAKQSSHPQCISSQSVTEGPPAYHTNVDMAHYGPHGRQNPYDRMS......................................................................... 824
186 0.000e+00UniRef50_A0A2D0RUS0 disintegrin and metalloproteinase domain-containing protein 10-like isoform X1 n=21 Tax=Clupeocephala TaxID=186625 RepID=A0A2D0RU  ali  31  27....LKICMLIICLALTGHCAENFRDIRQFLRYYESLSYDRTMLLQQHQRVRRHLDPET----QVLCLDFEAFQKVFHLRLKPDFEGFAEDFKV--LSSNQSWRGDLSHIYSGVLEDEVGSSCQGSVLNGQFEGSIKTSNGTFYIESMQRYTSE----STDNHSVIYHEDDIDDFPVEGSRAGFCGTG---------------------------RLQSLIQSLRQDEPVSRSKRTVDQSKTSCLLHLHVDYLFYQRFG----------SIEAVVAQVASYMKAVNNIFHKAEFDGIEVIDFKVKSMSFVSEKN---------PADPMQETFIGPEKLLSLYSEMNWGNYCLSYLLTSRDFSG-VLGLAWEGKPD--NWGGICSKPIHTMD----GQTSSLNTGMITLKNFGRYLLPKFVQLTFAHELGHSVGAPHDEGADCGDLGGKGHFLMFPHAADEVKENSERFSPCSLQHMSRLLKINKDKC------------------FVVSDQPICGNRIVEKGEECDVG------LNASDPCCYSSR---EPIGVQCRLKPNKQCSPSQGLCCSSG-CVFKTSGLLC--EEDSECRMKSVCTGTSATCPQPAAKPNMTVCSLGTRVCLNGECSGSLCVLHGLEQCDCPGENKKERCHLCCQQ-------TGNPNTCASTTSSVLSMYFKGQRVTLVPGSPCYKNQGYCDHFQTCRVLDADGPIARLKNSFLNLREFDDVADWMK................................................................................................................................................................................... 668
187 0.000e+00UniRef50_A0A2I3RDU2 ADAM metallopeptidase domain 8 n=18 Tax=Boreoeutheria TaxID=1437010 RepID=A0A2I3RDU2_PANTR  ali  18  1.....MRGLGLWLLGAMMLPAIAPSRPWALVEQYEVVLPRRLPGP----RVRRALPSHLGLHPERVSYVLGATGHNFTLHLRKNRDLLGSGYTETYTAANGSEVTQDHCFYQGHVEGYPDSAASLSTCAG-LRGFFQVGSDLHLIEPLDEGGEGGRHAVYQAEHLL---------------------QTAGTCGVSDDSLGSLLGPRTAAVFRPWPGDSLPSR----------------ETRYVELYVVVDNAEFQMLG----------SEAAVRHRVLEVVNHVDKLYQKLNF------RVVLVGLEIWNSQDR----FHVSPDPSVTLENLLTWQARQRTRRHLHDNIQLI---TGVDFTGTTVGFARVSAMCSRSSGA---------------------------VNQDHSKNPVGVACTMAHEMGHNLGMDHDENCRCRERFEAGRCIMAGSI---GSSFPRMFSDCSQAYLESFLEQPQSACLANAPDLSHLVG-----------GPVCGNLFVERGEQCDCGPPEDCRNRCCNS-------------TTCQLAEGAQCA--HGTCCQ--ECKVKPAGELCRPKKD-MCDLEEFCDGRHPECPEDAFQENGTPCS--GGYCYNGACPT------LAQQCQAFWGPGGQAAEESCFSYDILPGCKA-SRYRADMCGTLQCKGGQQPLGRAICGTRCGPEK--VCWKGRCQDLHVYR-SSNCSAQCHNHGVCNHKQECHCHAGWAPPHCAKLLTEVHA----GCQPHAGQGRGSSPIQGPPRAGPHHPPRPARRTPGLLGGSEEAAPCSSGHCVQPTLPSSCLHPAGTKAGHQADVRAPSAPSQTRGWCGQP................................................................... 739
188 0.000e+00UniRef50_UPI000BAE790F disintegrin and metalloproteinase domain-containing protein 10-like n=2 Tax=Crassostrea virginica TaxID=6565 RepID=UPI000BAE79  ali  32  1MDSGIRGSCYHVIFTTFVLQLVSGLAIDHILHDYRPLFYDHHKLKQQHERMRRST-------IDKMDFEFHTQYRHFKVRLKRDNHVFNPD--VIIETSDGPVDIDTSFLYSGALEGEK-SRVFGHINEGHFQGQIQTKDATFFMEPSSLYFKQPQD----FHSIIYTSNDVIFNSTSFCNA-------------DGIRHSMMNSIPSMNNEQEINQWQHRYSFDANLPEHRRKRAIDPTKTVCSIYMQADHTFYQKY---------SSNIDTVVAQLGVYVQAVNNIFQRIDFDGDDNIGFLVKRLKVHTDPNASGYKLNGH---------YSVEKFLDLHSSDNYDGYCLSYMFTDRDFDGGVLGLAWVASL--TKAGGICEAYRSY-----SGEYKSLNTGIVTVKNYGAAVASVVTQVTFAHEIGHNFGSEHDTDSGCAPGGSDGNYIMYAHATSGYLPNNDKFSNCSINQVAPIIENKGRS---------------SSGCFIAPVSHVCGNKIVEPDEECDCGWDDECSETCCHAAGTPNGCTYNNTGGLSLF-----CSPSEGPCCDT-NCQRKTSGV---CRGNTSCLAAAQCDGSGVSCPSSTPEPNGTACANG-QVCFLGECSASVCLAKGYQSCQCPGSKDSDLCRLCCQVNDTCSFAGDIPDLTEANA---------------FTGAPCNNFKGYCDVFHVCREVDPTGPLSNIRKLLLSGDIINKVKQFLTD.................................................................................................................................................................................. 660
189 0.000e+00UniRef50_B7QKW5 Disintegrin-metalloprotease, putative n=7 Tax=Parasitiformes TaxID=6934 RepID=B7QKW5_IXOSC  ali  38  11.................................................................................................................HTTGDPSSHVFGALHGGVFEGRIETPTGHFYVERSEKYF----DDVKPYHSIMYAASDVELPGSDNDTHPGCGVVDGVKQWMEKVSTSAVPEQSVHTPKPRSPRTPHAKYLRSPSGALASPANYLPNRRVCNLFVQTDTFLWDHI--TNTGKDEIKAREEISSLIAQHVEAASRIYRSTNFGGIRDIKFAVQRIRINDSTACSGERNRRI--NPFCAGNLDASNFLNLNSLSNHDDFCLAYVWTFRDFQHGTLGLAWVASV-NGASGGICEKYKTYSENINGKSKRSLNTGIITFLNHNAKIPLKVSEITFAHEIGHNFGSPHDYPPECVPGGSFGNFIMYASATQGHQSNNQKFSPCSVRNISHVLHA-------------IFRGEQKENCFQDYEGPFCGNKIVEGNEECDCGYEE---QECMENCCYARENSEGK--KGCTRKPHAICSPSQGPCCTKLCGYEKVN---KLCKLESDCTEQSFCKYPFTICPNPVHKRNKTECNNGTQVCWSGECSGSICEKYGMDECFLTADSPDKMCEVACQEKDRPETC---------KSTYDIERMREIRGIKLRPGSPCNSFQGYCDVFQKCRNVDAEGPLARLKRLLFDKQSLHTVKXXXXXXXXXXXXXXXXXXXXXXXXXXXCAVHTPSSNPRRAPALRIADTLRRPGDTFRRKRRLPPEAAVPGGPPPPYPGPRPTA-------PPAGPSHGYGQGRGHYSRGVASSSSSGPSSSRQPGHLPPEAVELRPAKR............................................ 749
190 0.000e+00UniRef50_G3N7Y7 ADAM metallopeptidase domain 9 n=11 Tax=Euteleostomi TaxID=117571 RepID=G3N7Y7_GASAC  ali  18  1.........................QQTEHLSSYQLTVPRPM-----GGRLRRDTAGR---LPNQVSYSISVDGNDHIVHLERNEWLLPADFTVFSYSQNGSPPVQDHCHYLGSVQDMEGSAVAMSICNG-LRSLIHLPTNSLVCFPPADSQQTEHLSSYQ--------LTVPRPMGGRLRRDTAGRLPNQPPGV--------------------------------RLVLQMKRAVLHQTHYVELLLVVDNDRYNYLNKNET---------AVRDEMVHLANFVDSIYKQL------NVRVVLVGLEIWTQQN----QISTDGGAGEVLSRFTQWREKELVPRRRHDSAQLILKKSF----GATAGMAFVSTVCSRSHGGGI--------------------------NVFIGNNIASFASIVAHELGHNLGMNHDDGRSCSSSVEA--CIMNSGATGSIN-----FSKCSADDFEKMMLLTGGSCLLNVPRPDEAY-----------SAPSCGNRLVDVGEECDCGT-QKVRLCTSNPCCEYH---------TCKLRPGAQCAY--GECCY--KCQIIITGNVLRASTD-ECDLPEYCNGSSSLCQIDVFIQNGHPCRTHQAFCYNGKCQ------HYDGQCQAIFGSKAKAAPEICFKDVNSKGDRFGNCGYHNYG-YKKCESRNALCGKLQCGSKCGDNQ--VCVNFECSSVDALNYDCDVEKKCHGHGVCNSNRNCHCDDGWAAPFCEVKGYGGSVDSGP............................................................................................................................................................. 649
191 0.000e+00UniRef50_UPI0009B3ED4D LOW QUALITY PROTEIN: zinc metalloproteinase-disintegrin-like 2d n=4 Tax=Percomorphaceae TaxID=1489872 RepID=UPI0009B3ED4D  ali  17  17..........LFLLWLIWVCFVQSSGMSSHVNRYEVVRPQRVQ-----ERQKRSLQENQ-LYPDTVRYKLDIEGENHTIYLEKNRNLIGRGYTETHYSEDGKRVTEEHCYYHGHIEGMAESSVSVGICSG-ISGFVRAQQQVYLIEPLGQSEDGEHALYRQENLRTSGSPSCGSTSNATTLYDQDQDQGPRVAGLFGSSPWKMELTAGP-------------------------------QRFVELFVVVDNTEYKQYGS------------ETRARILGVINHVDKLYRPL------NIRIMLVGLEIWTYKD----YIDVDVNSSRTLDNFLLWRQTDLLQRMKHDNAQFV---TGKDFDKDTVGLANKFAMCTGNSGG---------------------------VNQDHHDNPIGLASTIAHEMGHNFGLSHDAAVCCGPSYSSGVCVMAEKLRTGSQMFPEFFSSCSVEQLAEFMARAQPSCLHRPSSVRTIT-----------VGPHCGNALLDPGEECDCGTVEE----CKNPCC---------DASTCRLTEGSQCAD--GQCC--DKCQVKAAGSVCRKSA-SECDLPEYCTGKSEDCPVDEFEMNGKPCYNKQGYCYNGQCPTHE------HHCWRLFGLGAKVGPDRCFNLNTRGEEGANCG--RNKFGYTPCTTQNLKCGSIFCGTKCGPDK--VCLNNRCVETSVYGKQEECAKKCNNNGVCNHKEECHCNPGWAPPHC.......................................................................................................................................................................... 672
192 0.000e+00UniRef50_UPI00065BB20E uncharacterized protein LOC101860130 n=3 Tax=Aplysia californica TaxID=6500 RepID=UPI00065BB20E  ali  16  45.....................................HHDCVVTYFHNGLVVNSTLDSQGEHYHRVTARLQAFGRLFVLDLTLNRQLFSGSYIERVFHSHGQSSERSHCYYHGTLRHQPQSEAAVSTCHG-LSGFVSDRRDTFHIEPVSERVVR----------------------------------------VYRDRDQRQLSFRCGTENHDARLQAHKMVIGRHKRSVQPPYDSNRNTRYVELYLVNDYRTYERHGK---------SSAVIIRRSQDIANIVSSLYRKL------NIYVALVGVEVWGSGDL----ISITTSPDRTMENFLRYRKERINPYHHNDNAQLI---TGVFFDHGVIGKAINGPICTHKFSGG--------------------------VNMDYGGLVTQVATTVAHEMGHNFGMEHDNDTSCDCGDD--KCIMAATS---GRISPRRWSSCSHSALAEAFDLGMDYCLKNIPTS-------------IYAGPICGNGFKEDGEECDCGLPQD----CTNRCCN---------ASSCKLYPRAQCA--TGRCCDLNQCKPKGASTLCR-EPMGECDLPEFCNGTSEYCPGNVFVQNGQHCKGGESYCYKGQCRTH------TDQCKLLWGETGRSSDPICYQQLNMNDNKGNCGYNWTTDRYKRCEREDVMCGLLHCGAKCEDNK--ICIDHKCVALAKLRVKQCPGN-CDGHGKCNSRGNCHCDIGYRPPLCDRPGFGGSLDSGPATNEYDHRPTRRPPYRPTRRPTRPTVRPTRRPTYRPTRRPTRPTVRPTHRPTYRPTRRPVVRPTWPSWPTQRPTPTPRRPVSGRGSGGSGSTGFDPPRVTVPSTNSTTHTETRP........................................... 814
193 0.000e+00UniRef50_UPI000614A9EA disintegrin and metalloproteinase domain-containing protein 10-like isoform X2 n=3 Tax=Megachile rotundata TaxID=143995 RepID=  ali  33  20..........................................................................RVFKMRLTRDTSLFHED-VVFEGSNGREIAFDPLHAYSGIVDEDENSSVHGVTEEGLFDGTIFTASDEIYIEPASRYEHQDTTDTMHHHTIAYRSMDVNVSHHSGYPCANELRTNRTWSGYLGDTMRPFYQHLNEGKSRAKPGFYPKDARKKDPRVLRKRTSVDPKKTTCMLYLQADHTFFDHYK----------SEEACIEVMTRHVQRVNSIYRYTDFNQDGNISFMIKRVKVHGEGALNDPTYRFTGTYG-------VEEFLELFSEEDYDAFCLSYMFTYRDFEKGTLGLAWTGDL--KNAGGVCEKNGHYR-----GSMKSLNTGIITLLNYGKHVPPTVSHVTLAHEIGHNFGSPHDPD-ECSPGGEDGNFIMFARATSGDKRNNNRFSPCSLLSINPVLNAKARS---------------SKGCFAEPQNAICGNGVVEDGEECDCGWEED----CNDPCCHPQRLHHAPHEIPCRLADGAVCSPSQGPCCTSG-CTLR-NGDKCR--DDNGCRDASFCDGRGPQCPPSINKPNKTIC-NEEFVCYMGECTGSICLAYGLESCQCIAGPEDKSCELCCKLPGEDQPCLSSFAWNS--------APYDIPDMLSKPGTPCNDYNGYCDVFQRCREVDPSGPLATLRRLLLSDASLASFQRW..................................................................................................................................................................................... 694
194 0.000e+00UniRef50_A0A2U4A9X4 LOW QUALITY PROTEIN: disintegrin and metalloproteinase domain-containing protein 20-like n=1 Tax=Tursiops truncatus TaxID=9739 Re  ali  18  307......TLLLLSFGVSLFISDHSQARASQHFSSPELVIPLKVTGR-----------GRNAKAPGWLSYSLRFGGQRHIAHMRVKKFLVSRYLPVFTYTDQRQPFVPDDCYYHGYVEGVPKSLVALSTCSGGFRGILQINDLAYEIEP--------VRFSATFEHWVY------------KIDSDDTQFPPMRCGLTEEDIARQLELQELHNFTLMQSSY---------------TGWWTHLRFLELVVVVDNLRFVH---------SESNVSVVQREILDVVNIIGSLYHSLE------LVVILTGLEVWTKGNPVPID-----NIDKLLEDFSVWKYFSLDHRLSHDAAHLFIKKSF----GITLGVAYVGGICQRP--------------------------LNSGVNVFEDESLYAFAIVVTHELGHNLGMRHDTE---WCVCELQWCIMFPAREVTN-----KFSNCSYAEYWDNLIS-NGLCLYSPPHPGNIFRL-----------KYCGNLVVEEGEECDCGTIE---QCKNDPCCLLN----------CTLKPGAACAF--GLCCK--DCKVMSSGTLCR-KQVSECDLPEWCNGTSHQCPEDVYVQDGIPCSDG-AYCYQKSCNNHD------EQCREIFGKDARSAPQSCYKEINTQGNRFGHCGIKDT-QYVKCASPDILCGRVQCGTMCGPGK--ICVRNKCVSM-VRVPQACQPETCHMKGICNNKQQCHCNPGWAPPYCEQQGNGGSNSSGPPF........................................................................................................................................................... 971
195 0.000e+00UniRef50_UPI000D0C73DF disintegrin and metalloproteinase domain-containing protein 10 n=2 Tax=Neoptera TaxID=33340 RepID=UPI000D0C73DF  ali  40  54...................................................................................................................................................................................................................................RAHVSKRAIIDPKKTTCMLYLQADHLFFQKYG----------TEEACIEVMTRHVQRVNSIYRNTDFNMDGNISFMIKRIKVHTTDSLNDPSYRFPGNYG-------VEKFLELFSEEDYDAFCLAYMFTYRDFEMGTLGLAWTGDL--KNAGGVCEKNGHYR-----GSMKSLNTGIVTLLNYGKHVPPAVSHVTLAHEIGHNFGSPHD-PEQCTPGGEDGNFIMFARATSGDKKNNNKFSPCSLNSINPVLNSKARS---------------SKGCFTEPQVAICGNGVVEAGEQCDCGWEED----CKEDCCYPQRRHPPPEQPPCHLTPHSICSPSQGPCCTPE-CSLKF---GDKCRDDNGCRDSSYCDGRGPHCPPSINKPNKTIC-NEEFVCFMGECTGSICLAYGLESCQCLPGPDDKACELCCKIPGENNPCLSSFLWNS--------APYDIPDMFSKPGTPCNDYNGYCDVFQKCREVDPSGPLATLRRLLLSEQSIESFKKWILDHWYYALLIVKGVLLILVLSTRLLGKTTNLKKGMTIIHSSTTETVRLPP.................................................................................................................................. 568
196 0.000e+00UniRef50_G3WG69 ADAM metallopeptidase domain 28 n=24 Tax=Theria TaxID=722675 RepID=G3WG69_SARHA  ali  17  5.........VLTLYLLFSAYEIRAVDESPQKKIFDIIYPRKQHSLHKRDVEENKKPQKQERYEDRVQYEINLKGKTLVLHLEKNKEFLSPDYVEVQYSSTGSPQIMENCYYQGHIINEEMSTASISTCQG-LRGFFEHQEQRYLIEPLG------------------LAEQEEQEHALYTYESQEQNLPETSCGVDTIEEDLVLEK------------------TVRSGNNAVKLEDMNQKKCIEYYLVLDNKVFRKYNR---------NPEEIRQRVFDMVNFVNMLYKKL------NIQVALVGMEIWTQGNKIKI----SPNANVTLENFSNWRGGILPKMKRHDVAQLI---TGIDLSGPIVGLAFMSTMCSPYHSVGI--------------------------IQDHSYDLLRVAGTMAHEMGHNFGMFHDTY---VCKCPSSICVMDRAL---SLYIPKDFSSCSRNSFEKFLRTASPSCLKNVPLPTDI-----------ISTPICGNLLIESGEECDCGSPEE----CTNVCC---------DAVTCKIKPNFKCAF--GECC--ENCQIKKAGTLCRPAKD-ECDLPEMCDGKSGSCPKDRFRVNGFPCQNGQGYCRMGQCPT------LQDQCVSLWGEGAQAAERSCFDINNVGSTYGYCRRVDDM--HIPCKAGSFLCGKLYCGTKCGDKS--VCINGDCIDIEDAYKSSNCSSKCKGHAVCDHELQCQCEEGWLPPNCDNSXXXXXXXXXXXXXXXXXSTAKRKKVQSQSCPTSGSKSRQWKSKRQRDLQSTHSHEMGPISSTMTTPSMESNTPPLSLLIIKPNLPPPLIPTTRSSFVP..................................................................... 772
197 0.000e+00UniRef50_UPI000C252F2E disintegrin and metalloproteinase domain-containing protein 28-like n=3 Tax=Polyphaga TaxID=41084 RepID=UPI000C252F2E  ali  16  49..................................EFSRHSLVKPKIYHGREKRQTREESGEHTNHLQITLEVDGKDVILDLTLNKHLLPKGFFHNYQQNGQYKIHQPSCEYNGKIRGVQNSWAAISTCDG-LSGVIFDGREIHYIEKGSDLEESDIESE---HFLYRHSDLAKHNKSCGYGGDAVDPEKGHI----------------------DNRILRYKRDTDQNELVRGPYNANKESKYVELVLVMDNLEYKELGE---------STSKVINHAKTIANXXXXXXXXXXXXXXXX----------XXXXXTEKDEIDFSSNGDTTLTNFLHYRREALIKIHPNDNAQ---LLTKVNFDNGVVGKALKGPICTYEFSGG--------------------------VNTDHSTVVGLVATTVAHEMGHNFGMEHDNNE---CKCPEDRCIMAPSSST---VAPTHWSSCSLNYLLQAFTQGMDYCLKNKPTS-------------LFDSPVCGNGFVEPGEQCDCGMPEHCDNFCCN-------------ATTCMLHSNASCA--TGECCDLTTCLPKGAGTLCR-SADYECDLPEYCTGQSEYCPADIFKLDTEVCDGGKAYCYHGFCRTR------TDQCKLLWGETGKSSDDQCYLMNTKGTQFGNCGYNRLTQSYYKCSNESVLCGMLHCGAICGEDK--MCVNQKCMSVSSLGPS--CPEDCNGNGWCNSKGHCHCKDGFAPPHCDYPGPGGSMDSGPASDPNARXXXXXXXXXXXXXXXXXXXXXXXXXXXXRHNFKFGWKKSSPTTTKSPNKSRGPSFPT............................................................................................. 786
198 0.000e+00UniRef50_UPI000BBF0504 disintegrin and metalloproteinase domain-containing protein 9-like isoform X1 n=6 Tax=Seriola TaxID=8160 RepID=UPI000BBF0504 :  ali  18  4.KHIIFAVFFLCYISGIYNKDLSFNGLTSKLSKYSIVNPQVI--HRRTRTVNRPPQSKEKYGEETISYALNINNRKHLLHLKANKDFLHPNFDQYSHDTAGNHIRHRHCYFHGEVEGYENSVVALSTCSG-LRGVIIFGNETYGLEPMPE--------SATNEHLLYVMKDIQSEPVTCGVVGEAESTQSH----------------------------EPFEPGHSLTSLLRRKRNLPQTSYVELVLVADH---------LRYEFKERNETAVREELVEMANLLDAYYKQL------NIRVVLVGLEIFKDGN----PFDVDGSAGDVLGRFVQWRKTTLIPKIRHDIGQLLVGQPN-PYNGGVLGMAFVGTVCSVATAGGI--------------------------NVFSNNNLPYVSTVVAHEMGHNLGMNHDNTR---CKCSGEACIMAASASGST-----TFSSCSATDFETLILRGGGVCLKNQPSPSDVVG-----------SAECGNGRLDQGEQCDCGKPEE----CNNRCC---------DAATCKFTRGAACA--QGSCC--EDCQIRVSGTPCRESV-NACDLPEYCDGNSGFCPDDFYVMDGLPCQNNAAYCFEGRCQTYD------FQCKHLFAPDATKAADVCFQHANTQGNLFGNCGITSKVDFIKCPVADAMCGKVQCGSPCGTGKA--CLDFKCVNATALLPVCDAQTTCNGRGVCNDQGNCHCENGWGPPQCARSGRGGSINSGPAQIDYSXXXXXXXXXXXXXRDTLNLCLKRRRKFSRPGNAQNGTPNGQPNTHVRTSTTTQPPAQTPPDRPGNLPATAAPISGFRYGELDYWNAETSAAPARPPAPRQGPGVPRPIPP......................................... 820
199 0.000e+00UniRef50_A0A1V4K995 A disintegrin and metalloproteinase with thrombospondin motifs 9 isoform A n=7 Tax=Euteleostomi TaxID=117571 RepID=A0A1V4K995_PAT  ali  13  27...................LHPRQAKLLEKLSEYEIVTPTRVNTDVHFRRRRRSTSSGPDAWSPKAHYRLSAFGQQFLFNLTASSAFIAPLFTVRRLYAEAADADVKHCFYRGHVNARPRHTAVISLCSGML-GTFKSDDGDYFVEPLLSLEEQEYEEEHNKPHLVYRHRTSPTNSSGDRQTCDTPDHEHSHKKNKRKHWRRQWAESSMLSDMEMLKHSLEVNSFSADRSHKRTKRFLSYPRFVEVMVVADSRMVAYHG------------ANLQHYVLTLMSIVASIYRDPSIGNLINIVI-VKLVVIHNEQDGPAISY----NAQTTLKNFCQWQQSQNHPEGSHLQHDTAVLVTRQDICCDTLGLAELGTVCDPYRSCSISED-----------------------------NGLSTAFTIAHELGHVFNMPHDDNHKCKEDGGKQQHVMAPTLNF--YTNPWMWSKCSRKYITEFLDTGYGECLLDEPSSRTYTLPQQLPGLIYDVNKQCELIFGPGSQVCPYMQMQCRRLWCINIDGAHKGCRTQHTPWADGTECEPGKHCRFGMCVPKEREAPVTDGAWGTWSPFGTCSRTCGGGIKTAIRECNRPEP-----KNGGKYCVGRRMKFKSCNTE-----PCSKLKKDFRDEQCADFDGKHFNINGLPTNVRWVPKYSGILMKDRCKLFCRDGTPCGPDTNDICVQGLCRQAGCDHVLNSKRDKC---GVC........................................................................................................................................................................................... 737
200 0.000e+00UniRef50_A0A2D0RAC7 disintegrin and metalloproteinase domain-containing protein 33-like n=32 Tax=Euteleostomi TaxID=117571 RepID=A0A2D0RAC7_ICTPU  ali  16  50.......................................VTAHWIPHTTVHKDTGATSQDQFPEKGEILVSAADLELILEVERNQELLAKDFTATHYEEDSRPHTDHHCFYHGSVKNHSSSWVALSTCSGV-RGLIVLNSSDTYYLEPVEGQEIL-------HHIFYHTDDLPIKGGTCGHGHETGHKGL-------------------------------LSGLLKPLHQRVKRNAWGTTKYMELYIVADNTLYRKQNKD---------LEKTQRRIMEIANYVDKFYR------ALNIRVPLIGLEVWTDRDQCII----NEEPNATLWSFLQWRQK-LKSRKKHDNAQ---LLTGVIFKGTTIGMAPLEGMCSHENSGGI--------------------------NVDHSDLPIGAAATMAHEIGHNFGMSHDHEGCCVETAEQGGCVMAAAT---GHPFPKVFSRCSKKDLDNYFQKGGGMCLFNMPNMKDLVG-----------GKRCGNGFVEEG----EECDCGEPEECTNDCCH---------ASNCTLKQDAQCA--HGVCC--EGCKLKQAGTMCR-SAAGSCDLPEYCTGGSPYCPSNVYLLDGSTCQYGHAYCYNGMCLTHE------QQCLQLWGYGARPAHDACFQDVNAAGNAFGNCGKDAYGNYVKCEKSDAKCGKIQCGTKCGEGK--VCKDRRCKNASFTE-LETCIARCNGHGVCNSNSNCHCNRGWAPPFCDKPGLGGSMDSGPTSYYHKWLSQRQKSKANNRHENSHLNPAFHLKVVGPSNKSANLKLPHTSKEVLPLRPGPASNGTQPVNIVHPLRPAPSPHFRDVKVPRPPPPTSKSLEEAKCSPTAAKLSPTRSPVMASVIQPKPSPTPPQRPLPMSPSRGAPAKPSSGAGG..... 904
201 0.000e+00UniRef50_A0A1W5AMA5 disintegrin and metalloproteinase domain-containing protein 9-like isoform X1 n=59 Tax=Neopterygii TaxID=41665 RepID=A0A1W5AMA5_9  ali  16  36..............................LSSYSVVRPLLVPHM-----WKRHVDGVEEPEQETVRYSLSINGKPHLLHLEKNKDFLAKGFVQYSYDDNGYPGVHRECHYHGYVEGHEDSLVALSTCKG-LRGVIFMGSDSYGIEPVIHSRTNEHFLFP----------------------LMRSEHEASICGVTNEMSHSDEHTLSMTKFF-------------------RKKRNLPQTRYIELALVVDK---------NRYDFKKGNMTAINEEMVTLANLMDGYYKEL------NIRVALVGLEVLSSGN----PFNVTGSAGSVLGNFVNWRKTSLSPRIRNDVAQLVVGLPS-SYPGGILGMAFVGTVCSASTSGGISVYSDN--------------------------SLSYYSTIMAHEMGHNLGMSHDDTR---CQCNGSACIMYSYASGST-----LFSQCSGNDFESLILQGGGICLNNMPTN-------------VISLPSCGNGIVESGEQCDCGTPQE----CTNKCCNPN---------TCQLTRGSTCAV--GSCC--SNCQVMVAGTPCRLSVDV-CDLPEFCTGQSGSCPSDYYLMDGTPCQNYSAYCYDGRCQTYD------FQCQYLFGNGAKKAADICFNVINANGDKFGNCGMQ-GSSYVKCSQANSMCGKVQCGSSCAPAKT--CINFQCVNATALAPTCNAQSTCNSNGVCNNLGNCYCNDGWAPPWCNKAGFGGSINGGPAQIDYSXXXXXXXXXXXXXXXXXXXXXXXXXXXXRDLMKQCFRRRLPRLRTPANNNANGNLQRNATPGPQTQDPERPQQTTPRYPAPVLDPLPRY--EEVNYGIRPDLERTTPKPAQNQ-GPGVPKPIPPRKDPP...................... 815
202 0.000e+00UniRef50_B3RJM6 Uncharacterized protein n=1 Tax=Trichoplax adhaerens TaxID=10228 RepID=B3RJM6_TRIAD  ali  33  27........................RPMLDQFKKYDVINYDAEEFAEHHERSRRSPSAHTM-------LEFHAYHRHFQLRLKRDTSLYTDDFMIESGNGQPVEFDMHNIV-SGHLVDDAKSLVHGTIVDGIFQGKIYTGEEHYYIEPSTRYFSKDQ----PFHSIVYRRSDVRVKKSYQVGTC----------GLDDKENIRMSDILQSWEHYGQDTKRIPSMFQNQPSHSKRNKRAPPTRNTCQLLVQADHTFTTYMG----------SKEQAIAALNGYLQAVNKIYEVIDFDGDDGIGFIVRRMKINTTSD------ASQPNNPFAPSNIGVSSYLDITSTANHDPYCLAYTFADRDFDNGVLGLAWVGSA--TGNAGICAKNSAYK-----GQKMSLNAGIVTILNYGTRVSTAVTEVTFAHELGHNFGSQHDPTTNCAPGSPQGNYIMYPQATTGRDPNNKQFSSCSKNYMQPVINAKG---------------ISSSGCFVNRATSICGNGVVEGNEQCDCGYRSDCQDNCCNAP-YDNPSQEPAGYQACTLKAGSVCGQSSGICCNPTNCRYYESSDNQLCTVSTECSQNAYCNGSRYQCPTPASKPDGTSCRKGSNVCSNGDCDGSICLAADLASCACT--TQADYCNTCCKSGNTCVSSKTISALANFSVQQA-------------PGSSCNNFQGYCDVFGKCRAVNENGPLTKLTNLLFSAEGIRNMLDWMK................................................................................................................................................................................... 681
203 0.000e+00UniRef50_UPI000B911A71 disintegrin and metalloproteinase domain-containing protein 10-like n=1 Tax=Acanthaster planci TaxID=133434 RepID=UPI000B911A7  ali  32  2..SRAKTIFALILLTSWESGASKAPTLSPFIRHYEMLNYDLEAVHQQHRRAVRSLEQSN------VELKFTAHSRDFHLRLKRDTSVFLPSVTLETSNGDEVPEV--NYFYSGELAGETGSYCHGSIVDGLFQGKIHVGEEVYSVEPAANYMKNPDS-----HSVIYEAKDVDYSSL----------------GSSGCGMVGQIQKRMEERLKEMQKEEKMEDRGDSSSYFARHKRQAPSAQTCTLFIRTDIEFFERFG----------SKLAVIRQIGDHVQAASQIYSRTTFGDYTDINFAVAKIRIYTEADRN------SPEYPFRDENLGVEKYLDYASNGDLSAYCLAYTFTNRDFANGVLGLAWIATDVAGSTGGLCA-------PKLSSRDTTLNTGIVTINNYGSYVPPLMSHNTLAHEIGHSFGSNHDPMDNCSPGGTSGNYLMFAHASSGVLANNDDFSICSIDEITRVLRS-------------VFMGVSKRNCFVEQSSTLCGNGILEENEMCDCGYE----GMCGDSCCIAQN-AENNRVNACQLTSTAMCSPQQGDCCDPMTCSYQPISHVCK--TEDECSLSANCTGNSVRCSNAVSRPDSTKCDNGRKVCSNGACSLSVCSIHNLEECQCS--TETEKCEICCQNPDQPASCVAASR--------INIRGPNEELLYKDAGSPCDDYMGYCDFFDSCRLANEDGPLAGIIRKIF................................................................................................................................................................................................ 650
204 0.000e+00UniRef50_UPI000719CB40 disintegrin and metalloproteinase domain-containing protein 10-like n=1 Tax=Priapulus caudatus TaxID=37621 RepID=UPI000719CB40  ali  29  6........FIVTLVIYFFYFVESANRLNEYISNYDVVRYDREELHRHHLRTKR----GAADYQPFLHLDFHALGRHFHVRLRRDTSIFSEDFVLENHEG-PLEDFDTSFFYVGDLWGVEGTKVDGSILKGVFDGKIYTPKGNYYIERAQKYLDDPVHPSIIYAERVYRHKRETEAPGCGLTSQVEEWMHQIQTSATDEKVKTNFGLVENKYSEEAQSDGYSNTHETQAGTGRRVKRERPATNTCSLFIQTDTLFWDWVGKRENH-DKERTRDEILSLIGGHVKAVNRVYEETRLGSYTGLRFVVQRTKIQ---------------LALLACHVLRINRDSAHLKKCHQALCKWYLIVRGARADAVL----VIVARIVRGSANVTKSTRRRSNGRRPHVQEPNTGIVTFVRLQQ---PAAGEGLTVSPIGTRIGSPHDYPLHCRPGGPEGNYLMYASATGGDRYNNDKFSECSVGNVSQVLDAVLNE------------KNGKNNCFSSDEGAFCGNNLVEEGEECDCGYEDE----CREDCCYPRTTHGKVQGTPCTLKAHARCSPSQGPCC-GHNCEYLPESRGYECQRASECHDVSFCNGLTAHCPTPDPKQNRTACNKNTQVCWGGECRGSICNIEDMEQCSLTTDDRSKLCHVACQLKDKPETCTSSFEISQLM------MLNNNTGISLQPGAPCNEFQGYCDVFLKCREVDADGPLARLKNLIFNQDTFNKXXXXXXXXXXXXXXXXXXXXXXXXXXXXCCAVHTPSSNPKQPPAKKFSDTLSHTLRRRPRQVHGQPTVHASAPPVEVRGSAPPGSSRQGGSEGKRNDGRSRGGNSRGGGEGGGGRGQPSGSSSSANVAKQTAGGGSEAVELPPPYEQVVSP-AQQGPHRGYGKGRGP.................. 895
205 0.000e+00UniRef50_A0A1S3KA99 disintegrin and metalloproteinase domain-containing protein 10 isoform X1 n=2 Tax=Lingula unguis TaxID=7574 RepID=A0A1S3KA99_LINU  ali  33  23..................CRVIAATPLTSAIRHYEPLYYDVESLHAEHHRVKRSSQKN-------IVWELSAHGKKMKIILKRDTSIFTNDLVVET--SEGPVHWDISRVYVGHVLDDDTSYVHGVITDGLFEGKITTKDDQ-YMIEQSKRFFKDPQ---KFHSVIYKAGDVKDFEQGCKSKALLQKIQSKL----KPEGVDRPQSEMSVEGNFHDHKDFDEKDKYTKVYQRFKRTIVPSKTECAIYMQADHLYYQKQNSD---------VHAVIEQITNHVQAVNQIYASIDFGSPDGINMKIKRIKVHTDPNAIGYKFDG---------NYGVEKFLQKFSEDNYTSYCLAYMMTHRDFNDGTLGLAWTGNL--TLAGGVCEKYAIFS-----GSYASLNTGIVTTLNMGSDVPPIVSHVTLAHEIGHNMGSDHDPNSSCVPGNPNGNFIMYARSTSGDKTNNNRFSPCSIAMMGPVMEKKAR---------------GTDGCFTAPTANICGNEIVETGEECDCGWDS----QCTDRCCNKQSDNPAAGETPCTLKKNATCSPSQGSCCSADTCDLVTAAENKTCRAAGECSEASYCNGSSFECPASVNKPNQLTCS--TGICSDGVCSADICPAWGLVGCQCSPTKDVKLCQLCCKQNVT---------GAECKSTFEITTMPNT---TLTSGKPCYNYNGYCDVFLKCRQVDPSGPLSMLRNLFSSDG............................................................................................................................................................................................. 681
206 0.000e+00UniRef50_UPI00073FEEDD disintegrin and metalloproteinase domain-containing protein 12 isoform X2 n=5 Tax=Neopterygii TaxID=41665 RepID=UPI00073FEEDD  ali  16  43....................PSRQQRTLKKLGNYETIVPFLIEDGDHKPISELHFKS----HPASVKLLIEAEGEQLLLALEKNEGLFASHYTETHYLEDGTAVTSTHCYYHGEVQGHAHSEVSLSTCSG-LRGFILLENKTFVLEPVFDPANRS--------HLIYRAENLNFSPGTCGHGFNISDFRV-----------------------------DDIARPFKTFNARHKRDTQKTTKYVELIIVADNREFQKQGKD---------VEKVKQRLAEIANYVDKFYR------ALNIRVALVGLEVWSDVDKC----SVTQDPFTTLHEFLDWRKTKLLPQRPHDNAQLV---SGVYFQGTTIGMAPIMSMCVAEQSGGIV--------------------------MDHADSPLGAAVTLAHELGHNFGMNHDTPERGCGCRDKGGCIMTPST---GYPFPTVFSSCSKKDLAASLEKGVGMCLFNMPETKVLYGGQK-----------CGNGYVEEG----EECDCGELDECMNPCC---------NATTCTLKGDAVCA--HGQCC--EDCKLKPAGTPCRDSS-NACDLPEFCTGASPHCPANVYLHDGHACHNVDGFCYNGICQTHE------QQCITLWGQGAKPAPGICFERVNSAGDPYGNCGKDSKGSFAKCEIRDAKCGKIQCGTKCGD--GMLCLNRQCQNITVFGVHE-CSGKCSGHGVCNNNKNCHCEAHWAPPFCDKAGFGGSVDSGP............................................................................................................................................................. 713
207 0.000e+00UniRef50_A0A1S3IW11 disintegrin and metalloproteinase domain-containing protein 9 isoform X1 n=2 Tax=Lingula unguis TaxID=7574 RepID=A0A1S3IW11_LINUN  ali  18  40..................................EFSYFEKVVPVIRTRRSARDVTWAENQHLDEVEVVVEAFNKTFTLDLKLNKNLFGDKFVEKHTTNGKPVVRRHHCFYHGKIRHEEESLIALSTCDG-LSGLFQDGTEQYYIQP--------VAGSTGFHHHVFRASDRHEQHLRCGTGDHAHDFPSFY-----------------------HSSLNSKHLHRLRRAIRGPYNSGKKTRYVELFLVSDHRQFDMHGK---------NVAKVIQRSKEIGNIVSALYNELD------IYVALVGVEVWDSGDK----IIVDQDADVTLNNFLSYRKTFLNPHFPNDNGQLI---TGQSFKDGIVGKALKRPICTYRYSGG--------------------------VNTDHSELPGPVGTTVAHEMGHNFGMTHDNLSVCKC--PEQRCIMAATTGSG---NPTKWSSCSKKELQEAFDIGMDYCLRNKPT-------------RLFGSPTCGNGFVEDGEQCDCGLPEE----CKNKCCN---------ASSCTLMTNATCA--TGTCCNLQTCQMKPMATECRP-VAGECDLPEFCSGNSEDCPADVFVQNGRSCKSGQSYCYQGKCTTHD------AQCKLLWGSTGQVSPPVCYTRLNRGSEFGNCGYSWIHDNYTACKQEDTMCGMLHCGAKCGEDKL--CVNQTCMSFDQLGV-APCPEDCNQNGICNSNNNCHCEVGLAPPLCNTPGYGGSVDSGPA............................................................................................................................................................ 707
208 0.000e+00UniRef50_A0A2I0U4D9 Disintegrin and metalloproteinase domain-containing protein 20-like n=1 Tax=Limosa lapponica baueri TaxID=1758121 RepID=A0A2I0U4D  ali  19  291....................................................RQLSPRASTTSPTISYWLEVEGRPRVLLLRPRQGLVSRPFTLVTYGKGGHPVVQDNCFYQGEVQGSPGSLVALSTCGRGLHGVVWVEDGTYEIEP--------IPNDPAFRHILYRMEEASNP-------------VGSTCGLTSEELQHQKALLPWFKAPQAAEEEEEM-----------VEGWWTHIRYVKIAVVVDNVRFVKTGS---------NESEVLRQVIEIINIADSLYEQLS------LRLFLVGLEIWTKGN----HINISNSINKALDDFNKWRKSNLFPRMRHDAAHLFAFQSF----GKSLGLAFLGSICDSH--------------------------WSSAVTSFTNRKLSSFVNTFVHELGHNLGMHHDKPG---CKCRRKKCIMHESSVDTDA-----FSDCSYQYYFDMLGQGA-NCLRQPP---------KPGTFYTMRREYCGNKIVEGGEQCDCGSASS---CRKDPCCHPN----------CTLTAASVCA--SGKCCK--RCRVLPAGTLCR-ASTGNCDLPEYCSGTSPLCPPDVYMQDGTPCKDG-AYCYRGKCSSRS------KQCQYLFGKKAKAAHLDCFKAVNTRGDRFGNCGIRNNIHFTKCSIENVLCGRIQCGTPCGSDKL--CINRTCTSISLLNYDCNL-TTCHNRGLCNNRKNCHCRYGWAPPYCEWKGFGGSIDSGP............................................................................................................................................................. 925
209 0.000e+00UniRef50_A0A147B5C9 Disintegrin and metalloproteinase domain-containing protein 28 n=8 Tax=Fundulus heteroclitus TaxID=8078 RepID=A0A147B5C9_FUNHE :_  ali  19  4.....TLLLWVLFLNASLKPSESHNPTFEVGKDYEVVRPVRL-----HALRKRSTEHLR---PESVKYAMTVGGKPLHLQLEKNNELLTQDYTETYYQEDGTPRDVDHCYYHGTIVNDSESSVSISTCDG-LRGYFRTS-AQRYLIEPLSGGDEGDHAVTP---------------------VNDKNFTPAVCGVTNTSWSDDMEPP-----------------TGRSRSRAGGISILQQEKYIELVLVADNRAFVKMNRDLT---------KTRRRIFEIVNFVNMAYKPLKTF------IALVGLEVWSNNDL----ISVTNPAGANLDAFMKWRNSDLVKRTKHDNA---HLISGIDFEGATVGLAFIGTLCSDHSVGVVQ---------------------------DHNDRAIAVGATLAHEMGHNLGMNHDDSSACACSGDS--CIMAAAL---SWNIPRTFSSCSTINYERYLTNRNPSCMFDKPDNKMIVAP-----------AVCGNGFLEEGEQCDCGSVQD----CTNPCCN---------ATTCTLSAGSQCA--EGECC--DNCKIQPRSKECR-SKRDDCDLAEYCDGKSATCPEDVFTVNGLPCNKGLGYCYNGQCPQRS------DQCIKLYGTTAVEAPRSCFNFNDKGSNFGYCR-RLSNDQFIPCQPQDVLCGKLYCGTVCADGK--VCSQNQCMELERAYRNTNCSAKCPGKAVCNHRSECQCEPGWLPPNC.......................................................................................................................................................................... 650
210 0.000e+00UniRef50_A0A0L7QKT2 Disintegrin and metalloproteinase domain-containing protein 12 n=5 Tax=Apocrita TaxID=7400 RepID=A0A0L7QKT2_9HYME  ali  16  46................................SPDFSRHTLVRPRVYHGRSKRQISSTKEEHADVLTVGFELDGVKRVLDLRLNTDLIPTGYQQRHQHLGTTPSKVELCHYQGSIRDVPGSWVALSTCRG-LRGVVFDGENLHHI--------HPEGESLDSDHYVYRQSDLVANHTCGNY------------------------------PRKKKRRGLLARFFLLLQVIRGPYNANRHSRYVELVLVIDKKE---------YVALDENLDKVYQHCKDIANIINALYMPL------NIFIALVGVQVWSDTD----EITLSPNGDTTLSNFLRYRREKLVQDMPNDNAQ---LLTRITFEGGVVGKALKGPICTYEFSGGVS--------------------------MDHSNVVGLVAATVAHEMGHNFGMEHDSAD---CLCPEEKCIMASSS---GSSGPTQWSTCSLEHLALAFEHGMDYCLRNKP-------------QKLFDSPICGNGFVESGEQCDCGLKE----NCDNPCC---------NVTTCMLHSNASCA--TGECCDLKTCRPKAAGTECR-SAEHECDLPEYCTGQSEYCPVDVFKMDGESCNMGKAFCYHGSCRTH------NDQCKLLWGATGTSSDAQCYEMNNRGTKHGNCGYNRVDSSYFKCTDENLLCGMLHCGAKCAPGK--MCVNQKCMPVADLRASVSCPNNCGGNGVCNSLGHCHCNHGFRPPDCTQPGVGGSEDSGPA............................................................................................................................................................ 710
211 0.000e+00UniRef50_B4NJU2 Uncharacterized protein n=3 Tax=Drosophila TaxID=2081351 RepID=B4NJU2_DROWI  ali  15  63..................................EFTTHTVIRPKVQHGRTKRSLQSTDGLHAQHITLSYLHQGQRIQIELLRNDRLLPDTHFLRYQNRNFTKTEVDLCHYQGHIHGQADSKVALSTCNGGLNGVVFDGRETYFIHPHIDGTGRLLDD----HFLLSHADMVQKNATCGYDSHKDNHNHDREWENEEPSIPQRLDGGEFQRMFLRRRRRDVEEVGH---LIRGPYNANKYSSYVELVIVVDNKVYKHFGE---------NTKKVHQHCKDLANIVNALYEPL------NIFVALVGVVIWNESN----EIEFSSDGDVTLRNFLNYRSTKLVLEHPNDNAQ---LLTKETFAGGVVGKALKGPICTYEYSGGVS--------------------------MQHSQILAVVATTMAHEMGHNFGMEHDSPD---CHCPDEKCVMAASST---AVVPVHWSSCSIDQLTIAFSRGMNYCLRNKPE-------------RLFDSPQCGNGFVEPGEQCDCGLP----NHCENTCC---------NAHTCMLHSNASCA--TGECCDLDTCRPKMAGKPCR-EAENECDLPEYCTGESEYCPKDVYRRDAEPCDGGQAYCFHGNCRSH------GNQCRVLWGPTGDNSE-HCYYKNKEGNRLGNCGYNRVNKTYVPCATEHVNCGMLHCGAKCGDNR--MCVDQRCVAVDVLAKGSDCPDNCKDLGVCNSRGHCHCELGFGGESCSRPGPGGSVDSGPAADSN---STVGFQRXXXXXXXXXXXXXXXXXXXXYCRNNKLFAGGKLADNILKTASGNKQPSMRSNQNGSGPPQGNGLPKSTPSSTDDMNSALLKTPIDTNDPNAVGMFGKTLRPLNDASPPSNYNGPNVAPTMQQDNNGVPQRLAPPPPGGKT.. 926
212 0.000e+00UniRef50_A0A212FIE4 Putative ADAM metalloprotease n=1 Tax=Danaus plexippus plexippus TaxID=278856 RepID=A0A212FIE4_DANPL  ali  16  9........................................................PREGIHHPELVMKMNFDGREHVLDLRLNEDLITKDHVIAYQKDGETVIHRDICQYSGKVRDKKESWVAVSTCDGV-RGIIHDGQTMRYIEPADRNEIDSQHY-------LYEHSDLNTDFHCGYSGGITTN---------DTYDPELMKRHMHSRNVEKSRISRYKRDAYEDTEVRGPFKVNKLSRFVELVLVADNREFRANGE---------SKETVHRQLKDVANIINSVYTPL------NIFIALVGVVVWNERD----EIRLEEDGDKTLTEFLHYRKR-LLPVMPNDNA---HLLTRQKFKDGVVGKALKGPICTYNFSGGVAT--------------------------NHSEVIGLVATTIAHEMGHNFGMEHDTEADCECPDE--KCIMSPSSTS---VTPTKWSSCSLRSLALAFERGMDYCLRNKPK-------------RLFEPSTCGNGFIEPGEQCDCGLAGDPA---CTACCDPR---------ACVLRSNATCA--AGECCDTTTCRPKPAGTVCR-AADKECDLAEYCSGHSEYCPRDVYKMDATPCGGGKAYCAGGSCRTH------TDQCRLLWGFSGENSDVQCYTNSNTKGDRKGNCGREDPPVYYKCSKEDSLCGLLQCGAKCGDDK--MCMKHRCVSIEVTSEIARCPSNCSGHGVCNSEGHCHCDSGFAPPLCELPGPGGSVDSGPA............................................................................................................................................................ 675
213 0.000e+00UniRef50_B0WZX2 ADAM metalloprotease n=3 Tax=Culicidae TaxID=7157 RepID=B0WZX2_CULQU  ali  15  2................................................GRYQSAIEWTNGLHASHLTLSYRLSDRDVILDLQLNERLIPRGHFLSYQLPSGRTVEVELCHYRGVIRDVPESSVALSTCHG-IRGVVFDGHDTYYIE--NDVKAEGLERIDLADHYIYRHSDLLTSPKCGYEGG----------------SNATHDPELHRESEFQRLSRHKRATAKSSSPIRGPYNANKHSSYVELVIVIDNKMFKSMKE---------NFKVVQQYCKDITNIINALYEPL------NIFIGLVGVVIWNEAN----EIELSTDGEVTLKNFLHYRKKVLSKDHPNDNAQ---LFTKEHFEGGVVGKALKGPICTYEFSGGVEMY--------------------------HSEIIGVQATTVAHEMGHNFGMEHDTPD---CKCKEDRCIMSASSSS---IAPRHWSSCSIDQLNLAFHHGMNYCLKNKPT-------------QLFDSPVCGNGFVEPGEQCDCGLPE----FCDNSCCNPR---------TCMLHSNASCA--TGQCCDLLTCKPKIGGTVCREG-EGECDLPEYCSGESEYCPNDVFKRDTETCDDGKAFCYKGSCRS------QNDQCRLLWGPTGKSSDQ-CYKKNEEGTRHGNCGYNRVKNEYVKCDDGDVFCGMLHCGAKCGEGK--MCLNQVCMAVEAQGSGVECPENCNGNGICNSEGHCHCSKGFAPPLCNSPGNGGSEDSGPASDPNAGSGFTRAIFSFFVYYLRRNGSGLLAAKKRKPPSASVSTGNMKTDSSRSTGSTHTMVPSSPNSPDDMNSALLRPSSDVDFKTNNHMFGKFKGFTLKPLPEPGSILKSPNVAFVHPVSKYSEDPASTVPNRPAPPAPKLANSNKP........ 832
214 0.000e+00UniRef50_B1H325 LOC100145537 protein n=15 Tax=Anura TaxID=8342 RepID=B1H325_XENTR  ali  19  30...............................QKYEVVFPKKL-----HFQQKRDTQS---KYPSTVHYEVQLEGEPLVLKLEKTEDLISEHYTETQYLPDGTPIEQDHCYYQGGVENDSSSLLSISACSG-LSGIIQT-RGRRYLIEPLKQTDSEEHAVFPYQA---------------------QESTPVTCGVTNTTY-----------------MEGNFSKTSLATSNAAKVEFLKSKKYIELYMVADKSMFNKYGR---------STENVKRRIFEIVNFVNVVYKQ------INIFVALTGIEVWDKSDG----FTVVSSADEDLKLFSDWRTKNLLPRKAHDNAQFI---THIDFDGSTVGLAYVGTMCSSTSS--------------------------TGVIQDHSQQSIAIGATVAHEMGHNLGINHDEA---HCTCSTGSCIMEPAL---SFNTPREFSLCSHQNYQDFILQKMPLCMKDVPKKTEIQTP-----------PVCGNKFTELGEECDCGSISE----CTNPCCN---------ATTCKLKAGAQCA--EGQCC--DSCKWTKAGTVCR-SKRHDCDLAEMCDGQSAECPSDRFRVNGFPCRNGEGYCYNGLCPTLQGL------CSALWGPSSVVADDSCFNYNLRGANNGYC--QDSKGNQVPCKQSDVKCGVLYCGTKCGDN--MVCFMGECTSIQTAFGPSDCDAKCPEHAVCDHENQCRCEEGWAPPDCANXXX---XXXXXXXXXXXXXXXXXXXXXXXXXXXSRRKQRTSRTRVTGAVNPAFNVREKPWGPAGSNAATPQLDSRFPHNPPKPPAQSQKPLATHPPTGRSWPQTQVGYPVRPVNAPPPLPTTK--PAYPRAPPQAWTPNYR........................... 782
215 0.000e+00UniRef50_A0A182U0Q2 Uncharacterized protein n=2 Tax=Anopheles melas TaxID=34690 RepID=A0A182U0Q2_9DIPT  ali  15  2.........................................................TNGLHASHLTLSYTLNEADVILDLQLNKRLIPDGHFLSYQLPNGTPEEVDLCHYQGKIRGKPDSSAAISTCGEGIRGIIIDTDDTYYIESPLTSTDDAAQGNDETASINLGEHFIYRHADLVPAGPNGDGHRCGYEG--GHINATHDPELYQQHMATPRREKRATSSGSSSPKIRGPYNANKYSSYVELVIVVDNKMFKTMRE---------NFKTVQQYCKDITNIINALYEPL------NIFVGLVGVVVWNEGD----EIELSKDGEVTLKNFLHYRKKTLIKDHPNDNAQ---LFTKEHFDGGVVGKALKGPICTYEFSGGVEMY--------------------------HSEIIGVQATTVAHEMGHNFGMEHDTAD---CECPEERCIM---SASSSSIAPKHWSRCSIDQLSLAFHHGMNYCLMNKPES-------------LFDSPVCGNGFVEAGEQCDCGLP----DYCDNSCCDPR---------TCMLHSNASCA--TGECCDLRTCKPMIGGTVCR-QADGECDLPEYCSGESEYCPGDVFKRDTEVCDGGKAFCYRGTCRS------QNDQCRLLWGPTGKSSEQ-CYVKNEDGSRHGNCGYNRVKNEYVKCDGADVHCGMLHCGAKCGEGK--MCLNQMCMSVEASGSGAACPENCNGNGVCNSEGHCHCDLGFAPPLCNLDGFGGSLDSGPA............................................................................................................................................................ 680
216 0.000e+00UniRef50_A0A1U7QN59 disintegrin and metalloproteinase domain-containing protein 28 n=11 Tax=Theria TaxID=722675 RepID=A0A1U7QN59_MESAU  ali  18  1....MLQWSLLVVSFLLPPVPANTAKELPKAKKYEVVYPIRLHPLRKREAE---EPEKKEAFETELKYQMSVNGKVAVLYLKKNNKLLAPGYSETHYNSSGSPQIMDSCYYQGHIINEKASEASISTCQG-LRGYFSQGNERYFIEPLSSVSMDEHA-------------------HAVFKDDPNEDQANSNCGVDDVLWN--------------QRLHQSVVLPATRLIKLNNGMVQEPKKYIEYYLVLDNGEFKKYNK---------NLAEIRKRVFEMANYVNMLYKKLDT------HVALIGIEIWTDEDKIKI----TPDANTTLNNFSKWRGNDLLKRKHHDIAQLI---SSTDFSGSTVGLAFMSSMCSPYHSVGI--------------------------IQDHSSYHLRVAGTMAHEMGHNLGMIHDYLS---CKCPSEVCVMEQSLRFHM---PTDFSSCSRVNYGKFLEDKLSRCLYNTPLPSAI-----------ISTPVCGNQLVELNEDCDCGTPEE----CTNKCC---------DAKTCKIKAGFQCAL--GECC--DKCQLKKAGFVCRTAKD-ECDLPEMCDGKSSHCPVDRFRVNGFPCQSGHGYCLKGKCPT------LQQQCMEMWGPGTKVADKSCYQHNEGGSKYGYCHVE--NGTHIPCKAKDVMCGKLFCGTKCGNNK--VCINAECVDMEKTYKSTNCSSKCRGHAVCDHELQCQCKEGWAPPDC.......................................................................................................................................................................... 659
217 0.000e+00UniRef50_UPI000A0EE041 disintegrin and metalloproteinase domain-containing protein 10-like n=6 Tax=Hymenoptera TaxID=7399 RepID=UPI000A0EE041  ali  31  1MGLKMLGVLLACVWLAAGSPIPPLNDIGSFIKSYGPALYDTEFLREHHRRKRRDIEQEEMEKLGKSGTSYSTLGTEFKMRLVRDVGLFAPD-VEFEGSKGLPIAFNTLHTYTGTLEDDETALVHGVTSEGLFDGTVSTSREEIYIEPAGRYVNVDVDVSPIYHTIAYRSTDVQNPRQDQEHSCDSERLYRNGSLNFNKTFRRSESPYQPNTSQPIYQHLNDGKSHAKPRVLRKRTSVDPKKTTCMLYLQADHTFFHHYN----------SEEACIEVMTRHVQKVNAIYRYTDFNQDGNISFMIKRVKVHGEDALQDPTYRFTGSYG-------VEEFLELFSEEDYDAFCLSYMFTYRDFEKGTLGLAWTGDL--KNAGGVCEKNGHYR-----GSMKSLNTGIITLLNYGKHVPPAVSHVTLAHEIGHNFGSPHDPD-ECSPGGEDGNFIMFARATSGDKRNNNRFSPCSLLSINPVLNTKARS---------------AKGCFAEPQSALCGNGVVEEGEECDCGWEED----CNDPCCHPQRRHHAMHEIPCHLTEGSICSPSQGPCCTSG-CTLR---TGDKCRDDNGCRDASFCDGCGPQCPQSINKPNKTIC-NEEFVCYMGECTGSICLAYGLESCQCPDDPPTKSCELCCKLPGENEPC--LSSFVWNSPPY------DIPDMFSKPGTPCNDYNGYCDIFQKCREVDPSGPLATLRRLLLSDASLATFQRWI.................................................................................................................................................................................... 769
218 0.000e+00UniRef50_X1WJB8 Uncharacterized protein n=1 Tax=Acyrthosiphon pisum TaxID=7029 RepID=X1WJB8_ACYPI  ali  15  21....VLVIIFLTLAHIQCVCCGITDQIDNQFNNYAFIEPKLFNARHKREIQSTKINPNGLEHAHGVTLIFVDKQQEYIIDLSLNRGLIPVNYFEKHQKDGARVNELEFCNYNGKIRDFPNSWAAISTCDG-IRGMFFDGISYHYIE-------NVEHESGDKYHILYKHEDLRTNHTCGFPSA------------------------------PEFTTNEIKRNKRNTRSLRGPYNENDKSRFIELVFVVDQEEYKYFNSE---------LSKVYKHAKSIANIINSLY------IPLNIFITLVGVVVWTEYN----EITLESNGDTTLTNFLTYRREHLVKDHPNDNAQ---LLTRVQFENGVVGKALKGPICTYEFSGG--------------------------VNRDHSKVQGLVATTIAHEIGHNLGMEHDQDD---CDCPGGRCIMAASSGTTS---PTHWSSCSLEYLALAFEHGMDYCLRNKP-------------VRLFGSSECGNSFVEDGEDCDCGTK----DMCTNPCCNPE---------TCKFRNNSVCA--TGQCCDLNTCRYKFAGVECR-SATHECDLPEYCDGHSEYCPDNVFKFDGSTCEKNQAFCFNGSCRTH------ADQCHLLWGPTGESSADQCYKMNLRGSPQGNCGYNRLNQSYVKCTLENVNCGMLQCGAYCGENK--MCVKQKCVAVEDFRAQNNCENDCNGNGVCNSKGNCHCKIGYAQPYCDQPGPGGSKDSGPASSPNTFKGXXXXXXXXXXXXXXXXXXXXXXXXCSKNHRSPTDWNKANRKKLSNDSEVGNKPNGTVSPSSTLLIDNQKPQTLHADLVGNYKGFSIKPLVLNEQPVVSRTPIRPAPSAPAVVAVLNERGGRLQISQPVPSKPAPPIPTAARPAS.... 877
219 0.000e+00UniRef50_UPI000B985A78 uncharacterized protein LOC111052645 n=1 Tax=Nilaparvata lugens TaxID=108931 RepID=UPI000B985A78  ali  16  1MASVEKWKVIWCVCFVFLTLKTESIEIEGQGPAPEFYRHVVVKPRIFHGREKRSIQSTRKHHLHDVTLAYNLNGKEHLIDLRLNRELIPKNYFERHHKNGSTPKNVELCHYIGKVRGAKNSWAALSTCSG-LSGMVYTGESLHYIEKAKGNNSNEDDDDDKIH---------GKDHFVYDHNDLKVNHTCGYSGTAFHHINPDINLENT-----------KLRYKRSTDVIHGPYNANKTSRYVELVLVVDQRDYKGHGENLKTVYTHCKKIANXXXXXXXXXXXXXX-------------------XXXXXXXTEHDEFHIDTNGDTTLTNFLQYRRTTLIKEHPNDNAQ---LLTRVQFEGGVVGKALKGPICTYEFSGG--------------------------VNMDHSPVVGLVATTVAHEMGHNFGMEHDGSS---CECPEEKCIMASSSSS---SSPTHWSSCSYEYLLFAFGHGMDYCLRNKPTS-------------LFDSPVCGNGFVEPGEQCDCGLP----GHCTNPCCNM---------TSCMLYSNASCA--TGECCDFSTCRPKTAGSVCR-SADHECDLPEYCIGHSEYCPANVYKMDGETCNKGKAYCYQGSCRSHS------DQCKLLWGPSGMSSDTQCYKMNSKGNRYGNCGYNRLNQSYLKCEGDNVHCGMLHCGAKCG--VGMMCVNQKCMNVSSLRAASDCPKGCSGNGVCNSLGHCHCKVGFAPPHCDYPGTGGSLDSGPATDPH........................................................................................................................................................ 724
220 0.000e+00UniRef50_A0A1W5B426 disintegrin and metalloproteinase domain-containing protein 15 n=14 Tax=Euteleostomi TaxID=117571 RepID=A0A1W5B426_9TELE  ali  19  44................................................GRRRSPRQALQNGHPDKLHCELHIRGHTYLLDLEKNRDLLPKSPSVFYYLPNGVRVSADHCYYQGLVRGFPDSRVALSTCTG-LRGVVVFNSTWSFELQPKEDKQEKEENTVKEEDDV-----------HLLYPTYQLDTQAGDCGVSSEVVPPLYSP---------------------TSMHRSKRDILLETKYIELVLVVDHKEYLTYQNNRT----------VIYRMMDVANQVDWFYRPL------NVRVALVGLEIWNDKDK----IQVDKNPTDTLNRFLEWRTRELLPRLRHDNAQLIM---GGSFDGTTVGMASQSSMCSKDRSGG--------------------------VNVDHLVSVLGVASTVAHELGHNLGMNHDTEERNCQCQNEGGCIMKPST---GFMPGQLFSSCSAQDLSVSLLHGAGMCLFNVPQPEKLLG-----------GPRCGNLYVEKGEECDCGLADE----CNDPCCNYS---------TCKLVPGAQCS-SDGICC--ENCKLRGAGWMCR-EALGECDLPEYCTGTSPYCPPNVFLQSGEPCKDGTSYCFGGICASLD------SQCQTLWGSNSTQAPEVCFSSVNKQGNKFGNCGQLPNGTFIPCPASDVYCGKIQCGTPCGPGK--VCMAQRCRDVSVLGV-EDCNRKCSSHGVCNSNKNCHCEVGWAPPECKYAGHGGSVDSGPA............................................................................................................................................................ 695
221 0.000e+00UniRef50_UPI00084A4711 uncharacterized protein LOC108674963 n=1 Tax=Hyalella azteca TaxID=294128 RepID=UPI00084A4711  ali  17  273................................HEEFQEHVVFTPDVVHARTRRQIQDSTQEHHHDITLGFAINGENILMDLQLNRQLLPQGYFEKQLYRNGSHSIRRPCHYQGSIRGRPGSRAAVSTCHG-LSGMVFDGEETHYIE----RVPESKPSLSSPHFLLSHKHLVPRNLTCGYNGHRHP---------SLELFKDDNFARMLRYKRSTGNRLEDGPASDGGGRIRGPYNSNVLSRYVELVLVADHLEYKNHGED---------VQKIHKRFKDIANIANALYQPL------NIFIALVGVEVWAEED----QVAISQDGDLTLTNFLNYRKVRLIPDHPNDNAQ---LLTGQVFDSGVVGKALKGPICTYQYSGG--------------------------VNMDHSASVGLVATTVAHEMGHNFGMEHDTEEDCKC--PDSRCIMAPSS---GSRSPSHWSSCSHEYLALSFERSMDYCLRNKPR-------------TLFDSPVCGNSFVEPGEQCDCGLPQ----HCDNPCCDPH---------TCQLYSNATCA--TGQCCDLQTCHPKEAGTECR-SAHRECDLPEYCRGDSEYCPDDVFQEDGHECQAGKAFCHSGMCRSHE------QQCQLLWGPTGQNSHDDCYSLNTQGNNNGNCGYNWANDTYFKCSTGNRKCGMMHCGAKCGYQK--MCVNQVCMSVAS---LRREGCSCNGNGACNNLGHCHCALGFSPPDCLEPGFGGSIDSGPASNPH........................................................................................................................................................ 966
222 0.000e+00UniRef50_A0A0P5Z0R2 Putative Disintegrin and metalloproteinase n=4 Tax=Daphnia TaxID=6668 RepID=A0A0P5Z0R2_9CRUS  ali  31  27LFIIFLNSIWLLVLRPVSASVTSGIALNEFIRHFEPLFYDHHNVRLQHSRSKRESQS-------QLQLQFHAHNRLFKIRLRRSASVFADDVVLE--STAGSIAFDMDKVYQGELEDDDHSTVSAVTSSGLLDATVSTASETYYVEPASRYFDASRNLS--FPAVIYKASDVLHPDPHHHGSGCASHQLYLKQFEHFHCANKQENHDGPRNSSDDQTLYSGWNRRHNEKKKKKRRSTIDHRKTCMLYLQADHLFYGKMG----------SEEACIETMTRHVQRVNSIYKNDGDGQGDDINFMIKRIKVHTEQALNEASYRFPGNYG-------VEKFLELFSEEDYNAFCLAYMFTYRDFEGGTLGLAWTGDL--KNAGGVCEKNGHYR-----GSLKSLNTGIVTLLNYGKHVPPAVSHVTLAHEIGHNFGSPHDPENNCTPGGEDGNYIMFARATSGDKRNNNKFSPCSLKSINGVLSAKARN---------------EQGCFKEPQSAICGNGVVEAGEECDCGWEED----CQEKCCFPMRSIAQHGEKPCTLRPATTCSPSQGPCCT-ESCQLR---YGVKCRDDNGCRDSAFCDGSGPKCPPSNNKANKTVC-NEEFVCFMGECTGSICIAYGLQSCQCLQGPPTKACELCCKLPGDDQPCLSSFEWN....................................................................................................................................................................................................................................................... 681
223 0.000e+00UniRef50_A0A146KWX7 Disintegrin and metalloproteinase domain-containing protein 10 (Fragment) n=5 Tax=Neoptera TaxID=33340 RepID=A0A146KWX7_LYGHE  ali  38  8..........IVFFILLVPYIESANRLNEYISHYEEASYSRLDVAQAHHRAKRSATDTTKNP--HVQISFRAHGKSFRLRLKRDTETFSHRLQVVD-SANSPVAHSLSHIYQGHLIGEPGSYVYGSLIDGLFEGKIHSNNKEAYYVE-KAYKYFPNNKNSSFHSLIYKDSDVEDAYRHLRSGGHVGGCPKKANADGGGGRSYINDQRYMNVNETPYAKYSQEANSIHSRSKRGAKARDKNKNTCSLFIQTDPLIWRHITEQVGH-DPEKTREEILSLIAHHVTAVNYIYRDTKFDGRINIKFEVQRIKIDDDEPCKPHYTGDS--NPFCMENIDVSNFLNLHSLGNHEDFCLAYVFTYRDFTGGTLGLAWVASA-SGASGGICERFKTYTETVGGSTRRSLNTGIITFVNYNSRVPPKVSQLTLAHEIGHNFGSPHDFPVECRPGGLSGNYIMFASATSGDRPNNSKFSSCSIGNISMVLDA--------------IEDEKKWNCFEASAGAFCGNKIVEDGEECDCGYDGDE---CNDKCCYPRDKARNSSAKGCSRRANTQCSPSQGPCCMSDECRFVPSFQNVRCKPESECSWSS.................................................................................................................................................................................................................................................................................................................................... 615
224 0.000e+00UniRef50_UPI0008F9BE8B disintegrin and metalloproteinase domain-containing protein 12 n=1 Tax=Bemisia tabaci TaxID=7038 RepID=UPI0008F9BE8B  ali  15  1MAKFSSVFVFFSCLISFCADNCVASKLGGYPSHFSREYY--IKPRVLHAREKRHIHTSRNEHINDISVEYQFWDRNHILDLQLNKELIPENYFERHQRNGSIPGEVELCHYHGVVRDIPESWVALSTCDG-LRGVIFDGKNMLFVE------KDKNTTSLSDKHIVFAHSDLISNHTCGYADNPYSHIIQANKLNNKI-----------------------RSKRDTGRSIRGPYNIDSNSRFIELVLVVDNKE---------YITLDKSIAKTNQHCKDIANIINSLFMPL------NIFVALTGVVIWTEND----EITLSTKGDTTLQNFLIYRREHLTKEHPNDNAQ---LLTKIQFEGGVVGKALKGPICTYEFSGG--------------------------VNMDHSNVVGLVANTVAHEMGHNLGMEHDTDD---CECPSDRCI---MSPSSSSMTPTDWSSCSKDYLAVAFGHGMDYCLRNKPE-------------KLFDGAVCGNGFVEPGEECDCGLKER----CDNPCC---------DYATCKLHSNATCA--TGLCCNLKTCQVHSAGKMCR-ESNHECDLPEFCDGQSEYCPDNVFKMNGLNCDRGEAYCFDGTCRTRS------DQCRSLWGPSGNQSDPKCFDMNMRGTKHGNCGYNLQNKTFVACSQENIECGMLHCGAKCGSGKTKMCVHQRCVPVALAATPDICREGCNGQGVCNNKGHCHCNDGFAPPFCDYPGLGGSVDSGPASDPNAWHALRXXXXXXXXXXXXXXXXXXXXXXXXRNRQCWAKKPHIVSSANSVEKKPRLSPDRSRANHEPNFGQSLLNQNNLQSASNNPIVASLQNNPLQVKKCESSVTLVPTRPAPQPYKTSPPTNPIRAAPKVPMPITSVPLKSEPPALPPAN. 891