current user: public

If you have questions about the server, please let us know.

Query: gi|16082715|ref|NP_395161.1| secreted effector protein (YPCD1.26c) [Yersinia pestis CO92], from Y.pestis

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .
# Score Template Links and tools%idFirst MFINPRNVSNTFLQEPLRHSSNLTEMPVEAENVKSKTEYYNAWSEWERNAPPGNGEQREMAVSRLRDCLDRQAHELELNNLGLSSLPELPPHLESLVASCNSLTELPELPQSLKSLLVDNNNLKALSDLPPLLEYLGVSNNQLEKLPELQNSSFLKIIDVDNNSLKKLPDLPPSLEFIAAGNNQLEELPELQNLPFLTAIYADNNSLKKLPDLPLSLESIVAGNNILEELPELQNLPFLTTIYADNNLLKTLPDLPPSLEALNVRDNYLTDLPELPQSLTFLDVSENIFSGLSELPPNLYYLNASSNEIRSLCDLPPSLEELNVSNNKLIELPALPPRLERLIASFNHLAEVPELPQNLKQLHVEYNPLREFPDIPESVEDLRMNSERVVDPYEFAHETTDKLEDDVFELast
1 -43.800[T] KOG4641 FOG: Toll/interleukin receptor and related proteins containing LRR and TIR repeats  ali follow..  17  93........NLPNLRILDLGSSKIYFLHPDFQGLFHLFELRLYFCGLSDAVDGYFRNLKALTRLDLSKNQIRSLKSIDFSSNQIFLVCEHEKTLSFFSLAANSLYSRVSVSGNGWTVDITGNFSNAISKSQHHIMGAGFGFHNIKDPDQ--ARSSVRHLDLSHGFVFSLNSRLKDLKVLNLAYNKINKIADFYGLDNLQVLNLSYNLLGELYSSLPKVAYIDLQKNHIAIIQDFKFLEKLQTLDLRDNALTTIHF-IPSIPDIFLSGNKLVTLPKINLTANLIHLSENRLENLDILVPHLQILILNQNRFSSCSSENPSLEQLFLGENMLQLAWETLSHLQVLYLNHNYLNSLPP-LTALRGLSLNSNRLTVLSHLPANLEILDISRNQLLAPNPFVSLSVLDITHNKFI 582
2 -41.300[S] KOG0472 Leucine-rich repeat protein  ali follow..  22  94LQSLTDDLRLPALTVLDIHDNQLTSLPSAIRELENLQKLNVSHNKL-KILPEEITNLRNLKCLYLQHNELTNLEDLDLSNNHLTTVPASFSSLVRLNLSSNELKSLPAEINRMKRLKHLDCNSNLLETIPPSLELLYLRRNKLRFLPEFPSCSLLKELHVGENQIEMLEAELNSILVLDLRDNKLKSVPEIILLRSLERLDLSNNDISSLPYSLGHLKFLALEGNPLRTIRNIHAIITLKILDYSDKQATLIPDEVFDVTSINFSKNQLCEIPKRMVELSDVDLSFNKLSFISLELQKLTFLDLRNNFLNSLPEEMERLQTINLSFNRFKMLPEVLYTLETILISNNQVGSVDPQMENLTTLDLQNNDLLQIPPELGNLRTLLLDGNPFRVPRMKGTAAILEYLRDRIP 601
3 -41.200[Z] KOG0532 Leucine-rich repeat (LRR) protein, contains calponin homology domain  ali follow..  17  2.........................AAAGLVAVAAAAEYSGTVASGGNLPGVHCGPSSGAGPGFGPGSWSRSLGVLSLSGRKLREFPRGAADTTRADLSRNRLSEIPIEACHFVSLENLNLYQNCIRYIPEALTFLNISRNQLSTLPVHLCNLPLKVLIASNNKLVSLPEEIGHLMELDVSCNEIQTIPQIGNLEALRDLNVRRNHLVHLPEELAPLIRLDFSCNKITTIPCYRNLRHLQTITLDNNPLQSPPAQIGKVHIFKYLNIQACKIAPDLPDYDRRPLGFGSCH-------EELYSSRPYGALDSGFNSVDKRWSGNEPTDEFSDLPLRVAEIQRLRRESQYQENRGSLVAYIEQRRISHEGSPVKPVAIREFQKTELHQNRVPAEPS--SLLSLSASHNQLS 462
4 -36.800[S] COG4886 Leucine-rich repeat (LRR) protein  ali follow..  19  451........RCVKLKRLDISNNLRSPRGKPITALRQLEVLNMSRNDIYELDPLIFSGLSSLKELNIANNYLVNLTYLDLSYNNFVTFPLIITQLETLNFSHNLLSQISSKIGSLVKLKHLYLQFNDLSNRLPNLETIDLSYNAITNIASLSECPKLNSINVACNLLSFYEYSNPSATFIDFSFCPLTTIDPAFSYSNLVYFDISHAKLIGLKDTLVNVETVKVNYNHFTSISDISAMQNLKYLSCTNCEMSYVSPNLGHLVHLDLHANNIKIFPEEVSSLKVVNLSSNILEKIKLPVATSKKLTLSGNPVSSLSSVMPTVEELYLVDNRLGND-EYFKCLKVLNLSYNYLTEIPSKFSDLKHLFVSGNELANLSISSTLLETLYANGNRLSSFPKSKSLRFLDISTNNLQ 913
5 -34.800[T] KOG4194 Membrane glycoprotein LIG-1  ali follow..  18  32...........VGNVVDCSSLDLSEIPTTI--PNNTRILLLSDNEIESIDKSRLKGFYFLQTLDISNNIIRNLKILNIRKNRLARIPRELGHLEKLDLRSNLISTVTSELSYLAAVRSVDLSRNLISYLPKNIEKLDLASNSITDIGTFSSFNTLVTLKLARNHITTLNQ-LRKLESLDLTRNMIREVRFFNQLPSLQNVSLARNDVYRLDD-CEGLKHLNLSTNRVQAVTEMFGLTSLEVLDLSYNQIQSFHSHTPKLKWLSLHSNRIQSLPS-LRQLEELILSANSIDSLHK-MSSLHKLDLSSNTLAVCVEDMPFLRSLRFTNNQLRVIPK-FPALEELDLTDNPIATIHP-LELKRLVMNSSSILCDCQILASWIYRLKLDKSSIIAKCSLADLYVVAIDTANL. 496
6 -34.400[T] KOG0531 Protein phosphatase 1, regulatory subunit, and related proteins  ali follow..  13  22.....................................................................HLVIQTSSLPEKNKVEFKLNTSSFPGRLLQHDLERNYSSRQGDHINLVSSSLSSFPILQRSSYSDRLSLERQKLTVCPIINGEDHLRLLNFQHNFITRIQNILQKLISLDLYDNQIEEISGLSTLRCLRVLLLGKNRIKKISNLLKSLDVLDLHGNQITKIENINHLCELRVLNLARNFLSHVDNLLDSLTELNLRHNQITFVRDVLPCLQHLFLSFNNISSFDSVSSSLSDTTFDGNPIAQESWYTVLQNMMQLRQLDMKRITEERMASVLAKKEEEKKRESHKQLKEKKRLTINNVARQDLQQRVANIATNEDRKDSDSPQDPCQIDGST........ 380
7 -28.800[K] KOG0620 Glucose-repressible alcohol dehydrogenase transcriptional effector CCR4 and related proteins  ali follow..  15  1...............MVRVLKSDVMSSGDMTSEYKDKQGGGAGQPL-TKSENNDGKK-------------TLTNGMSRVHRVLTEDEIASGRSTRWT--HGRVKNLSPSLWQLTHL-----------------SALFLNNNGLTRLPEIAQLTNLTMLDISNNKLRSLPTELGSLCHLYLNNNQLRVLPELGKLFRIQTLGLQGNPLSPEISKIYNGAQKILQFLLDHLTTFNNPSSHNRNGIKDQKYRPPEPPHVYDYVEMAALGSGVMVV......................................................................................................................................... 236
8 -28.400[R] KOG0619 FOG: Leucine rich repeat  ali follow..  21  36......................................................................AQNKSVSCHRRRLIAIPEIPIETKILDLSKNRLKSVNPEFISYPLLEEIDLSDNIIANVEPNLRSLRLKGNRLKLVPLFTGLSNLTKLDISENKIVILLD-LHNLKSLEVGDNDLVYISHFSGLLSLEQLTLEKCNLTAVPTELRSLISLHLKHLNINNMPVFKRLFHLKHLEIDYWPLLDMMPAGLNLTSLSVTNTNLSTVPFLLVYLTHLNLSYNPISTIEA-LIRLQELHIVGAQLRTIEP-LRFLRVLNVSQNLLETLEE-PRALEVLSINNNPLACDCRLLQRQPTLQFGGQQPMCAGPDT-SFKDFHSTALSFYFTCKEKKLQHLLVDEGQT. 427
9 -21.900[A] KOG1644 U2-associated snRNP A` protein  ali follow..  18  2.......................................................................................................................................VKLTAELIEQAAQYTNAVRDRELDLRGYKIPVIENLLDQFDAIDFSDNEIRKLDGFPLLRRLKTLLVNNNRICRIGEGLPCLTELILTNNSLVELGDLDPLKSLTYLSILRNPVTNKKHKVPQVRVLD.................................................................................................................................................. 146
10 -21.500[O] KOG3207 Beta-tubulin folding cofactor E  ali follow..  17  56............................................................................................RHPNGGSLMKHEIVPKPTDLLFEIKDRYIEEESVETEIELASNKKIELIGMDQTAAQSNIEKLINIVLDNRSVGFPPSSDILCRELNLYGNLLYKWKTVEYFPRIQELNLRRNRMQCFNEEEDDDESEGDDHVYSDSCKKL----VISECNLSENSIDSILLRFPSTSDVVAFGNDLTRFSAVSSRLTSLDLEDNPFKTLDSIFPNLTQLSVANCGITSLNIKFPKLEYLNIKRNSIVEWKSV-----------NSIRSLK----SLKRLLFDCKKLSTEKGVIAKLSTLIDLNRFDVSEVERRSAEIRFLN..... 375
11 -21.400[T] KOG2087 Glycoprotein hormone receptor  ali follow..  15  28.........................................................................RVFLCQESKVTEIPSLPRNAIELRFVLTKLRVIQK--GAFSGF--------------GDLEKIEISQNDVLEVDVFSNLPKLHEIRIEANNLLYITP-LPNLQYLLISNTGIKHLPDIHSLQKVLLDIQDNINIHTIER-LSFESVILWNKNGIQEIHNFNGTQLDAVNLSDNNNLEELPNDASGPVILDISRTRIHSLPENLKKLRARSTYNLKKLPTLEKLVALMEASLTY---------PSHCCAFANWRRQISELHPIILRQEVDYMTQARGQRSSL....................................................... 314
12 -19.300[O] KOG0529 Protein geranylgeranyltransferase type II, alpha subunit  ali follow..  14  448.......................................................................................................................DSKIGKLILARLLMAEETMISNGVHYKEILQLYNDLMALDSWHNQYYKDEHSVALIKVTSRTESMSRHLFRYRNMNNIICLRLNNLTLSRIAAVLLFVQMLDLSHNELHSAEGLEAMQLLCCLNLSHNRIRSFSALLKQLRVLDVSHNHICGELPVTRYLCSSPLSNSGETGREVPNKYQDAYLVLRD--------LMKLKQLDIRGNDLIFAGEVRQVVPKLVLDGHKLTS.......................................................... 687
13 -19.300[R] KOG4579 Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue  ali follow..  17  2.......................................................................................................................................LKKMGEAVARVARETVESGSDTLDLAECKLVSFPIGIYKVLR--------------NVSGQIHLITLANNELKSLTS------KFMTTFSQLRDVPKLAAMPALRSINLRFNPLNAEVRVIIKFDMLMSPEGARAPLP........................................................................................................................................ 128
14 -16.100[R] KOG1947 Leucine rich repeat proteins, some proteins contain F-box  ali follow..  13  34......KIERYSRQKVFIGNCYAINPERLLRRFPCLKSLTLKGKPHFADFNLVPHEWGGFVLPWIEALARSRLKRMVVTDESLELLSRSFVNFKSLVLTTDGLASIAANCRHLRDLDLQENEIDDHRG--QWLSCFPDTCTTLVTLN-VARSPNLKSLKLNRDALARLMACAPQIVDLGVGSYEAVIKKCTSLRSLSGFLEAAPHCLSAFHPICHNLTSLNLSYAAEIHGSHLIKLKKLQRLWIGDKGLEVVASTCKELQELRVTEEGLVAISAGCPKLHSIQMTNAALVTVAKNCPNFIRFRLLDEGFGAIVKACKSLRRLSLTDQVFLYIGMYANQLEMLSITDKGMLYVLNGCKKMKKLEIRDTALLADVSKYETMRSLWMSSCEVTL.................. 515
15 -16.000[R] KOG3665 ZYG-1-like serine/threonine protein kinases  ali follow..  15  60.........SFILTKVNFENVEMGPQTFGLLTQHNLKSLVLGNQDEIPSLEHYMSRLFRT----------SQIDHLDLSGRSLKTTGQQLPLLRTLNVSGVKLLN---------------PDFFQFCKSFPNLYSLDISNCGVTILTGISRLKNLRHLSLRSLIYES------------------YDIRELFALKLLNVLDLSMHSTHHARRNMQRF------------LDCKQVLPELRFLECSGNLMDELLITHSHLHQLAIVDCDVKAPKSSPIRILSCTTFDSSITALKYYL-NLKRRNEVQICFQELRLHVKRLHERKMQYDVTECVTLSLQSLEKLPCSLIMNFDIVEERLFTSRLSFEADFLAEI..................................... 378
16 -15.600[TA] COG5238 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport  ali follow..  16  2.................................................................................ATLHFVPQHEEEQVYSISGKALDDIKPYLEELAA--------------LKTCTKLDLSGNTIGTAKCIAENTQVRESLVEVNFLLPVLLKCPHLEIVNLSDNAFGLEDYIAHAVNIKHLILSNNGMGP-----FAGERIGKALFHLAQNKKAASKPFLETFICGRNRLENLKSHSEGLKVVKLYQNGIRPGLQYLKNLEILDLQDNTFKALPTWKDSLFELNLNDCLLKT-EVKFPNLHVLKFEYNEMAQ--GNLPELEKLEINGNRLDELQSKFDDLEVDDFEEVDSEDDEDEKLEEIETERLEKELLE.................. 391
17 -14.600[AYT] KOG1909 Ran GTPase-activating protein  ali follow..  18  29......................................................................NSYTKIRFSNRSFGSLSSIKDQLTEVDLSDFVAGR-----PEAEALEVMNMFSSALEG--SKLRYLNLSDNALGEASLINSQHDLEELYLMNDGVRELLPSTDKIRVLQFHNNMTGDAEIVRECPSLEDFRCSSTRIGS--EHCSHLKKLDLRDNMFGVAKTLSVLTHLTEIYMSYLNLEALLKSAPSLEVLELAGNDITACIASKQSLAKLNLSENELKD--EGHDQLVEVDLSTNMLAQTVVKKNTFKLLNINGNFISE--------EGIDEVNDMFKDCLDKLVPLDDNDPEGEDFEDGNELESKLGSLKIKQGE..................... 416
18 -14.200[R] KOG4341 F-box protein containing LRR  ali follow..  14  2.............................................................................ETAERISAAASAASSRRAKRLAHPVIQAKQNQMYLITTL--------SPAQVDNSLINRVLPKEVLLKVFSFLDTKALCRSAQVCRSWSILALDGSNWQRVDLKTAVVENLGFLKELSLKGCENVHDSALRTFTSRCPNLEHLSLYRNLGRYCHKLNYLNLENCSSITDRAMKYIGDGCPNLSYLNISDRGVQIILSNCKSLDTLILTENVFGSVEAHMGAIKKLNLTDITVQNIANGATALEYLCMSDRSLVSLGQHSHNLKVLELGDNGFIPLARGCRQLERLDMSDHTINSLANNCTALRELSLSHCELITDESIQNL........... 378
19 -11.600[S] KOG4308 LRR-containing protein  ali follow..  15  676.......................................................................CANYLKLTYCNAC--SADCSALSFVLHHFPKRLAL-----DLDNNNLNDYGVRELQPCFSRLTVLRLSVNQITDSEELTKYKIVTYLGLYNNQITD-----VGARYV---------TKILDECKGLTHLKLGKNKITS--KNSKSISEVGMWGNQVGDAEALRNHPSLTTLSLASNGIST---------------KSLARALQQNTSLEILWLTQNELN------------DEVAESLAEMLKVNQTLKHLWLIQNQITA-------------GTAQLADALQSNTGITEICLNGNLIKP...................................... 938
20 -10.800[R] KOG1665 AFH1-interacting protein FIP2, contains BTB/POZ domain and pentapeptide repeats  ali follow..  13......................................................................RKDDAAPAAGDFVAASGFAPNRWVKLNVGGQIYATTIDTLVG-SMLARMFLQNGSMKPSERDEQGAYLIDRSPRYFEPIINYLRHGQFVCDSNISVLGVLEEARFFGIFSLVTHLEERLGQQE-TPLGDRPLTRNDVIKAIIQTSVITELRFQG------------VNLSGADLRKLDFRNINFKYANMSHCNLSHTNLNYCCLERADLQYANLECAQLVSVRGLCANMEGANLRGCNFEDPTGVRTNLEGVNLKGACLESSNMAGVNLRVANLKNANMKNCNLRAAVLAGADLEKCNLSGSDLQEANLRGANLKDAELTLMVTPLHMS.......... 331
21 -9.480[O] KOG2120 SCF ubiquitin ligase, Skp2 component  ali follow..  11  137........................................................WQTLDLTGKNLHPDVTGRLLSQGVIAFRCPRSFMDQPLAEHFSPFRVQHM-----DLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDVNTLAKNSNLVRLNLSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAETITQLNLSGSDLSTLVRRCPNLVHLDLSDSV-DCFQEFFQLNYLQHLSLSR----------------DIIPETLLELGEI-PTLKTLQVFG---GTLQLLKEALPHLQINCSHFTTI-----ARPTINKKNQEIWGIKCRLTLQKPSCL................................................................. 424

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Pawlowski K, Pio F, Chu Z, Reed JC, Godzik A. PAAD - a new protein domain associated with apoptosis, cancer and autoimmune diseases. Trends Biochem Sci. 2001 Feb;26(2):85-7.