current user: public

If you have questions about the server, please let us know.

Query: gi|16082715|ref|NP_395161.1| secreted effector protein (YPCD1.26c) [Yersinia pestis CO92], from Y.pestis

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .
# Score Template Links and tools%idFirst MFINPRNVSNTFLQEPLRHSSNLTEMPVEAENVKSKTEYYNAWSEWERNAPPGNGEQREMAVSRLRDCLDRQAHELELNNLGLSSLPELPPHLESLVASCNSLTELPELPQSLKSLLVDNNNLKALSDLPPLLEYLGVSNNQLEKLPELQNSSFLKIIDVDNNSLKKLPDLPPSLEFIAAGNNQLEELPELQNLPFLTAIYADNNSLKKLPDLPLSLESIVAGNNILEELPELQNLPFLTTIYADNNLLKTLPDLPPSLEALNVRDNYLTDLPELPQSLTFLDVSENIFSGLSELPPNLYYLNASSNEIRSLCDLPPSLEELNVSNNKLIELPALPPRLERLIASFNHLAEVPELPQNLKQLHVEYNPLREFPDIPESVEDLRMNSERVVDPYEFAHETTDKLEDDVFELast
1 -52.300IDP91618 gene: ECs2674; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB36097 [Escherichia coli O157:H7 str. Sakai]  ali follow..  14  2...............FPLNDLSLKTQSVQLNKITSNTESTIKQHELV-SDDAIINEL-------------SSELVSCLGNDKFTPVSELLNMLSEFKLLREQCFRWGNYTLLFENYESYDKTGSITIEKNPIRHKLEFISTNIAELLKLTKITDARLCKGFSDWASSVKEGGSNDLKENVDRALVRMFKCVK--LHSNELDLSYLFLGSVPPLPDWIEMLSLVYNELDSIQ----PESCKELELDFNNLTEFPQVPDGITLISVNNNLISHIDSFPPKAKKIFISHNKLSETPAIPDTAKVFDCGYNKIQEIRYFPKNLKEARIGYNNIEVVPAIPGNLKILFMECNPIKEAFLMPWTLTGICYEISQRKYIVTNPADYDKYSDMVKKHVIDGEELII........... 375
2 -52.000IDP91619 gene: ECs2672; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB36095 [Escherichia coli O157:H7 str. Sakai]  ali follow..  15  2...............FPLNDLSLKTQSVQLNKITSNTESTIKQHELV-SDDAIINEL-------------SSELVSCLGNDKFTPVSELLNMLSEFKLLREQCFRWGNYTLLFENYGAYDKTGSITIEKSPIRHKLEFISTNIAELLDLTKITDARLCKGFSDWASSVKEGASNDLKENVDRALVRMFKCVKL--HSNELNLSSLSLGSVPPLPEWIEMLSLVYNELDSIQ---VPESCKELELDFNNLTEFPQVPDGITLISVNNNLISYIDSFPPKAKKIFICHNKLSEIPALPDTAKVFDCSENNIKEIRWFPKNLKEAYIEYNKIEVIPAIPGNLKLLCMKCNPIKEAFLMPWTLTGIRYEISQRKYIVMNPADYDKYS.......................... 360
3 -37.900IDP05663 hypothetical protein lmo0333 [Listeria monocytogenes EGD-e] lmo0333 [Listeria monocytogenes EGD-e]  ali follow..  22  334LETLGDISGLSELEMIQLSGCSKLKEITSLKNLPNLVNITADSCAIED---GTLNNLPKLQTLVLSDNELPQLKTLTLDGCGITSIGTLLPKLEKLDLKENQITSISEI-TDLPRLSYLDVSVNNLTTIGDLLEWLNVSSNRLSDVSTLTNFPSLNYINISNNVIRTVGKMLPSLKEFYAQNNSISDISMIHDMPNLRKVDASNNLITNIGTFLPKLQSLDVHSNRITSTSVIHDLPSLETFNAQTNLITNIGTMLPDLTYVNLSFNRIPSLAPILPNLETLIVSDNNSYLRSDGVPKLRILDLQNNYLNYTGSDLTNLTELNLRNNVYIDDISGLSRLIYLNLDSNKIEDISALLTNLQELTLENNKIENISALLENLNKLVVSKNKIIDISPMVNRGAIVTASNQTY 786
4 -35.300IDP05081 putative cell surface protein, internalin proteins [Listeria monocytogenes EGD-e] lmo2027 [Listeria monocytogenes EGD-e]  ali follow..  15  4........ILTGLSTTLLLTVLLLTITGGDLKAKAASDLYPLPAPIIDVFP--DEGLAKDMAKNLNKDSVNDVIDQD----DLDALTGL--GFETETITNDSMQLLERAMFNNVNI-----------------VSVMEFGEDLTEFPDISTIPHLNTLFFNTPPEGVTRNLYPEMVTITMSGSNLIGIPDFTGMPDLSQLYMADMMITSDDHTIPKLSTLDLSHNQLTNLPDFQNLTNLAELNLSFNNLTNTMTNLSNLNNLNLDYNHLNELPSNVLNSIFIE---NQSGTVPDQIIKQGETCTIQLPIYFQLAEINMLVNPTVLGSYSADIPVEVVTTTNADTESITLDTS-ELSPGVYNFNVQFNDAYPITQEGCVYDWV........................... 363
5 -35.300IDP91625 gene: ECs2073; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB35496 [Escherichia coli O157:H7 str. Sakai]  ali follow..  15  2..............KFPSIFNKIKPQ--SIQQHPEKNQLNWMLELNK---------------WKEERILTGEIHRPECRNEAAKRINAFLSKQNDIDLSGLNLSTQPPGLQNFTSINLDNNQLTHFD---DRLVKLSLNSNTLESINHQGRNVSITHISMNNNCLRNIDDRLSSITYFSAAHNKLEFVQ-LESCEWLQYLNLSHNQLTDIVGNKEELLLLDLSHNKLASLH-NALFPNLNTLLINNNLLSEIKMFYSKVQTLNAANNQLEKINTYLSSIKSLRLDNNKITRIDSDIRSLFPIIKKSESLNFLNSGENNCPTIQLMLFNLFSPALKLNAILSPGAFEDHSDGLDDNELFHYTINKAYTPYNIHTYKTEEVVNQRNIKIKNMTLDEINNTYCNNDYYNEAI 398
6 -35.200IDP05666 gene: inlA; internalin A [Listeria monocytogenes EGD-e] lmo0433 [Listeria monocytogenes EGD-e]  ali follow..  19  2............................RKKRYVWLKSILVAILVFGSGVWINTSNGTNAQAATITQDTLAEKMKTVLGKTNVTDTVSQLDQVTTLQADRLGIKSIDGV-EYLNNLTQINFSNNQLTDITPKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLLTNLNRLELSSNTISDISALSGLTSLQQLSFG-NQVTDLKPLLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPLLTNLDELSLNGNQLKDIGTLLTNLTDLDLANNQISNLAPLLTKLTELKLGANQISNISPLLTALTNLELNENQLEDISPILKNLTYLTLYFNNISDISPVLTKLQRLFFYNNKVSDVSSLLTNINWLSAGHNQISDLTNLTRITQLGLNDQAWT 418
7 -34.800IDP00005 internalin, putative BA_0552 [Bacillus anthracis str. Ames]  ali follow..  16  216IESLKGLEYMENLERITIQGSDVRNIAP-ISQLKRLKVVDLSFNKIEN---EPLVNLEKLDILELQNNRIAKVRTINLSGNKISDIKPLVSSLRKLYVSNNKITDFTGILNKLGTLGVGSNGLVNIEPISSGIVELNLEKNDIKDITSLSKLTGLQSLNLEENYVSDVSSLLINLYELKLATNEIRDIRPIQELGKRIKIDAQRQKVFLDEAYVKALKITDGKKEGITDFSGLEFMTNVEELTLQNVNMKNAEFILRNLKSVDLSYNQIEDIKPLLEDLEKLNVSDNGIKNVPELMQKLKTLDLSNNKLDNAAHQLENLDALLVNNNEINNLDEIVSKLNKLEMMSNKVRDISPLLKNLQWLNLSDNKIQDISTLMLDLLSLKLAGNEIRDVRPVAQWITVDIKNQKIV 763
8 -29.800IDP05561 peptidoglycan binding protein [Listeria monocytogenes EGD-e] lmo2026 [Listeria monocytogenes EGD-e]  ali follow..  12  2.........KKKFVYLLLLVLFMTVLPFQMLEAQAASTSWIEQE-----------------------DGNEPFIAETEKILSKNRQDITLADLETIQIHVFGADSIPNKISDYKNL-----------------TALEANYGTITEVPSVGSLKELVTLNVDENNLQEFPMVIPKLEVLYISRGNITEIPTITTLSHLKVLDVSNQKLVTIPDSILTTNWKAMHDGKLGQIASDIPANYLDNFNSGGNMLEFYDNPTIDYLQKQDQLTYTGGLNTDFKQLTPDKTNLGLKSNIPLFSYDDGTSANILTNGVATDVGDGYISTLSTNSNPFAKVRVPIAPLKGADVTVQYLDSNGDTLATPDILTIDGYTLTQTPTNAQG............................... 374
9 -29.300IDP00034 internalin, putative BA_1346 [Bacillus anthracis str. Ames]  ali follow..  16  1...............................................................................................MFLNTNEILDYSA----LKYM--------------PNLKSLTVANAKIKDPSFFANLKQLNHLALRGNEFSDVTPLMDHLDSLDLSNNKITNVAPLIEMKNVKSLYLSGNQIEDVTALMEQLDYLNLANNKITNVAPLSALKNVTYLTLAGNQIEDIKPLYSPLTDLVLTRNKVKDLSGIMKQLEELWIGKNEIKDVTPLMTQLKQLHLPNNELKDITPLLVNLQKLDLEANYISDLTPALKKLVFLSFVANEIRDVRPVLSKTAYINVQNQKVFLEETEKEVKVPIYEKDGKISTKIRLKGEGGTY....... 306
10 -28.900IDP05548 hypothetical protein lmo0409 [Listeria monocytogenes EGD-e] lmo0409 [Listeria monocytogenes EGD-e]  ali follow..  16  1...............MKSKNNYFKQITT-IMTVVSLLIMVLGIQGNNDVKAAPQVAPPASINQIFPDADLAEGIRAELQKSSVTDVVTKLESISQLSVYAKKIASIEG----LEYL--------------TNLKFLNLNGNQITDLSPLSNLTKLTEIYIGDNKISDISPLLTNVTDLYLVDNDISDLRPLANLTQMYSLRLGGNSNISDLNPVRRLNNLEVTGSILKDLTPLADVTSLTRLTLSDNQIEDLSPLLTKLDNIAAYSNKITDITPVLTRLQYLDLGSNEITDLSPVLQKLTSLHLANNQITNISMLLTNLTSLGLQNNKISDISVLLTHVTYLQLGYNQIVDVKIILTNLTSLQLTQNHITDISPLLTKIQYSDFSNQMITNLERNFSKTLS........ 388
11 -28.200IDP05553 hypothetical protein lmo1136 [Listeria monocytogenes EGD-e] lmo1136 [Listeria monocytogenes EGD-e]  ali follow..  15  4........TIKITTSLLLSFACVFSIGTKPHTVEAEIVYSLTNPKPVNEIFT---------------PKLAQVVADWLKLPAATSSVTQLNTIKALHFDSKGVQSLEG----VEYL--------------KNLTQVFGYGNQVSDLGPLSNLTKLEVIQMPRNQISDLTPILTALMSLDFEFNNLQTIEPIKNLTNMLELNVSANPISDINAVMTQLEFLTLRDCEVSDLSPVENLSNMLMFWAGRNNISDITPLMSKLLGLSLFGNQIKDVSVILTSLEDFDIKANQVSDISSLSTTLETLTLSFNQIIDISPLLTNLTRLELENQTRALDAVEI-ILPAPVIDENGSRVQPSKVSHAGVYANGEITWEGLQSNLNYEYALPVTIGSLTTTYSGKITQPLL....... 386
12 -28.000IDP02440 hypothetical protein lmo0331 [Listeria monocytogenes EGD-e] lmo0331 [Listeria monocytogenes EGD-e]  ali follow..  19  2.....KLSKILTIIVLSATVTSSLPI--------------------------PMVKAESTTANEMKTE--NQLLKTDLKETPKEKTPNNLKNQLVQAGTKTYNDYFP--DDNLAKEVAETMNKNADESVTAKVTKLDARSQGIEDSTGIEYLTGLEVLNLEDNQLKSIDSKNLNLKELTCSNNPLANL-DVSKNLALEELTCENNELTQLDSQNTALEYLYCPRNQLTKL-DVSKNSALRYLACDVNQLTNLDSKNPALTNLGCTKNQLTDLDSQNPNLGTLVCSDNQLTNLDSQNQALENLACDNNELKNIDNQALSLKELSCENNQLTNLDTQNLALEILYCDDNQLTDLDRKNVNLLILFCNNNQLTNL-AVGETIAKVRCNNNQLKDVSSLPDYFTDDND..... 380
13 -28.000IDP01745 hypothetical protein lmo2821 [Listeria monocytogenes EGD-e] lmo2821 [Listeria monocytogenes EGD-e]  ali follow..  17  1............MKTTKIVIASLVSL--TMVSNPLLTFAATNDVIDNT-------EITTDKETSSTQPTIKNTLKAGQTQSFNDWFPDNFASEVAAAFEMQATDTISEQLATLTSLDCHNSSITDMTGIETGLTKLICTSNNITTL-DLSQNTNLTYLACDSNKLTNLDTPLTKLTYLNCDTNKLTKL-DVSQNPLLTYLNCARNTLTEIDSHNTQLTELDCHLNKKITKLDVTPQTQLTTLDCSFNKITELDSQNKLLNRLNCDTNNITKLDNQNIQLTFLDCSSNKLTEIDTPLTQLTYFDCSVNPLTEL-STLSKLTTLHCIQTDLLEIDTHNTQLIYFQAEGCRKIKELDVTHNLYLLDCQAAGITELDSQNPKLVYLYLNNTELTEL................. 384
14 -27.400IDP95476 internalin [Listeria monocytogenes EGD-e] NP_465993 [Listeria monocytogenes EGD-e]  ali follow..  15  20.SFTGLDLKAKAASDLYPLPAPIIDV--PDDGLAKDMAKNLNKDSVNDVIDQD----------DLDALTGLGFETSTITNDSMQLLERAVTDVSIMEFGAKLTEPDITTIPHLKTLFFADPPGRLTRNLSPEMDTITMSGNNLIGIPDFTGMPALKQLYMSEMLITSDENNIPLLITLDLSSNQLTTIPDFQNIPNLTFLDLNANLLTNTPDFLPKLTDLNLRHNNLTGMVNYTNLPSLESLNLDYNFLTELPSNVLDTIYVQSQNGELPDQTINQGDTCTIDLPIYEYIGISVIQLPTTVNEEGNTITVDTSALSPGEYKLDVSYNHNYATGG........................................................................... 377
15 -27.400IDP05076 hypothetical protein lmo0801 [Listeria monocytogenes EGD-e] lmo0801 [Listeria monocytogenes EGD-e]  ali follow..  13  7........VILFLTLLLNGFVPNAHA-KTESPSADNNLQVAPPAAIKDLFPDP----------AMANEVLKSLNLKKLNKKSTSDTVTQ-TELNSLQAINKGIKSIE----GVEYL--------------QNITELDVEKNQITDIAPVANLKKLTTLLINTNQITDISPVLANLTTFYCGNNPISDISAVQNLTKLSIFNCYTANVEDISPVLVNLKTLSLGSNNIHDISDIEKLTALEYLSFSNNPVENPEVILTNLNTLWLYNAQIRNIDFTLPKLKSVYLYNNQISNISEVWANIEYLELNNNQITDITPVLTTLKTLKLNDQIITNREKNISIENKVMDNFGNIVTPNNINGTYNSPTLSWNLNETKDNLTTKITILNINATYVIQPLTKDSTRPIITADGKVS 406
16 -26.900IDP05423 gene: inlH; internalin H [Listeria monocytogenes EGD-e] lmo0263 [Listeria monocytogenes EGD-e]  ali follow..  12  1.....................................................................................MKKRWNSVFKLVLMVTAILGLSLYVTTSQGV--------------EVRAESITQPTAINVIFPDPALANAIKIAAGKSNVTDTVTQLDGITTLSAFGTGVTTIEGVQYLNNLIGLELKDNQITDLTPLLTKITELELSGNPLKNVSAIAGLQSIKTLDLTSTQITDVTPLLSNLQVLYLDLNQITNISPLLTNLQYLSIGNAQVSDLTPLLSKLTTLKADDNKISDISPLLPNLIEVHLKNNQISDVSPLTSNLFIVTLTNQTITNQPVFNNLVVPNVVKGPSGAPIAPANGTYASPNLTWNLTSFINNVSYTFNQSVTFKNTT 330
17 -26.800IDP02569 gene: inlE; internalin E [Listeria monocytogenes EGD-e] lmo0264 [Listeria monocytogenes EGD-e]  ali follow..  14  7.....................................................................ALRILVTLAVVLAITFWVGMKEVQAAVIEHPTPINEIFTD-PVLTDNVKTLLGKADVTDEVTSVTHLSAKSAGITTIEGLQYLTNLSELELIDNQVTDLNPLLTKITELRLSGNPLKDVSALAGLKNLKTMDLIYTDITDVTPLLSNLQVLNLDINQITDITPLAGLSNLQFLSFGSTQVSDLTPLLSKLTTLNAMNSKVSDVSPLLSNLTEVYLEENQISDVSPLLPNLSIVTLTNQTITNQPVFNKPIVPNVVTGLSGELIAPDPNLTWDLNSFINSVSYTFNQTFKNTTAPFSGTVTQPLTEVVVFDVDGEQTSAMVGVNELINEPTAPA....... 371
18 -26.600IDP95186 gene: lmo2445; lmo2445 [Listeria monocytogenes EGD-e] CAD00523 [Listeria monocytogenes EGD-e]  ali follow..  16  8.........KAQADTVPLPAPIIEAFPVEIAEAIAGELDKDSVNDTITQADLDTMTAI-------------PLPSLGLTGEDLSVLNEVFTNAIELAIWSNNIGELPDLSEALPAL-----------------ENIEANGANITVFP-DANYPNLTNVDLSQNNFGFNIPKMEGLVSINMENAGLSGYIIWMNMPNLDSLILNENHLISIP-------------------EDIFLSQQLGTHSFANQTATYPPTTIKQGENLKVIYQALDFIAPSNHDLIIIKDNGRTLYEPPYPTYDGSYMGLQPGEHLLEISLGYNSGEYTGWYDFPVTITE........................................................................... 300
19 -26.200IDP91566 gene: ECs1568; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB34991 [Escherichia coli O157:H7 str. Sakai]  ali follow..  15  2................................................................................................................................LPTSQLRPTGTFSYSAETSQIEEARASGRLYIKDCDIEYLPQLPNEITSVTIEN----------------------NNLTTLTGLPVNTQNLSVINCEKLQITDMP--STVKNLHIELTDSPFIHFISEGIECLTVCHCYISGVPE---SVRYLEIKGSATDSIKNVPNGLSSLSINSNQARIDNLISPSLKTLSLTGSNIILPEKLPESVTSVTIHAEQKTTWNIGVEGMPD................................................ 224
20 -24.600IDP91680 INLB_LISMO [Listeria monocytogenes]  ali follow..  15  1............................................................................................MKEKHNPRRKYCLISGL-AIIFSLWIIIGNGAKVQAE------TITVPTPIKQIFSDDAFAETIKDNLKKKSVTDAVTQLNSIDQIIANNSDIKSVQGIQYLPNVTKLFLNGNKLTDIKPLLKNLGWLFLDENKVKDLSSLKDLKKLKSLSLEHNGISDINGLLPQLESLYLGNNKITDITVLLTKLDTLSLEDNQISDIVPLLTKLQNLYLSKNHISDLRALLKNLDVLELFSQECLNKPSNLVVPNTVKNTDGSLVTPEIIDGDYEKPNVKWHLPEFTNEVIFYQPVTIGKAKARFHGRVTQPLKEVY....... 323
21 -24.600IDP05656 hypothetical protein lmo0171 [Listeria monocytogenes EGD-e] lmo0171 [Listeria monocytogenes EGD-e]  ali follow..  18  4IPVVVSLALCFSLVSPSLYASADTITAVQITKEATTDTTEPTTIDQPSRMDNSQTAPQKMTASSSEEAATTNSTEEENTPKN---------NLKSTSENSKTYAEL----VNLAKIIAKNISGTEDIN--QTITNLVATNQNITSLTGIEHLTALENINVNNNELTTIDSLIPTLKSISANNNKITGFSLVKTLPELHTLEVLGNAITELDENQPNLVTLSADELELKKL-TLKNLSQLNGLGRIASSISI-----GDLESVTLMN---------LPEIISVDISGNYLDSDDIHLENL-----------------PAVKNLDISSNELTRLPKIFPLLTTINVRSNKIDRLESSVPKLATLNADKQAVTLS..................................... 351
22 -24.400IDP91701 gene: SLIT3; slit homolog 3 protein precursor [Homo sapiens] NP_003053 [Homo sapiens]  ali follow..  17  43.........................................................................ASVDCHGLGLRAVPRIPRNAERLDLDRNNITRITK--MDFAGL--------------KNLRVLHLEDNQVSVIERFQDLKQLERLRLNKNKLQVLPELTPKLTRLDLSENQIQGIPRFRGITDVKNLQLDNNHISCIERALRDLEILTLNNNNISRILVFNHMPKIRTLRLHSNHLYMAPVHLRGFNVADVQKKEYVCPAPHSEP-NIVDCRGKGLMEIPNLPEGIVEIRLEQNSIKAIPAGAKKLKRIDISKNQISDIAPDLKSLTSLVLYGNKITEIAKGLVSLQLLLLNANKINCLRVNLQNLNLLSLYDNKLQTISKLQSIQTLHLAQNPFV 440
23 -24.200IDP05699 hypothetical protein lmo2396 [Listeria monocytogenes EGD-e] lmo2396 [Listeria monocytogenes EGD-e]  ali follow..  14  2...................................................................................................YKLVKIILAL-FLITTVFLPFSNVKAAPTDVVNIPDPVLN-SGLKNIIGNPFLDEITEANMATITVADLSNM-SGAPGYPV--GLIKDLTGLDKAVNMTKLYFSNSQIKNLDKILPNLKKIVAVTTGLNNISALGEMPALEEVELGGDYITDFTPLKENLTSFSYNSYAWSNPAYHQINNDEF----KNFTKLK----SLVKLDLTWNNITDLSPLNDHITNLNLNYNQFTNVAPIMKNLKVLYLNNNNLTSIDALLRGLTIAYADNNNITDLSNLFFEAMVAQGDYEGLQINNQTITLPTIN....... 305
24 -23.200IDP02719 gene: inlG; internalin G [Listeria monocytogenes EGD-e] lmo0262 [Listeria monocytogenes EGD-e]  ali follow..  16  1.........................................................................................................................................MKQRKTSVLHVLLVVTAILGISLWVNASHGM----KAQAESIAQPAPINEIFTDPALADEVKTELGKTSVTDEVTDLNQITKLEADDKGINSIEGIQYLTNLNMLGVSSNQITNITANLTNLDSLYLGDNKISDVTPLLTQLTFVQLSINQIKDVTANLTKLNYLDLRENQISDASPLMTDLTVLHLEKQQITAAPVVYQLVAPDILKNAYGEVVP........................................................ 224
25 -22.700IDP05755 peptidoglycan binding protein [Listeria monocytogenes EGD-e] lmo0732 [Listeria monocytogenes EGD-e]  ali follow..  12  1MKKAFLCLSAIVLSLNFVWINPITGASKIETTKETNQQVNLKNNVTDIVTSEDLGGQTWL------------INEVNRQLAPKTDVNLTFEDITTISLNNRSLTEVPPEIKNLVSL-----------------QRLYLFSNKLSEIPELGELTKLTELRLDYNELSKIPDGLGNISEIALQNNRLVQIPLYENRTGKNEVNVSGNQVTHIKANNSFISNLTNDMNLTPFLKNSPTFINLQVVYMFNSELFD--NDGRVLYDGTLTSDISIPLTNFKSGVHVINVMLDNAPNNPQNQTTFLI------DILPVPAHDLTVNYVDEAGAEIHPQTVSGNVGDDYDVTTPEFE-----------LAIDKYELDTEQMPTNGLGTLSSEAQTVTYVYKPVTVKYEDQNGVEIT 415
26 -21.900IDP01994 hypothetical protein lmo1290 [Listeria monocytogenes EGD-e] lmo1290 [Listeria monocytogenes EGD-e]  ali follow..  11  1MSVKSNIVKIGVCFAVLAVPVSQTTLPVFAAEQPGLK--------------------ASQDNVNIPDSTFKAYLNGLLGQASTANITEAMDSLTYITLANINVTDL----TGIEYA--------------HNIKDLTINNIHATNYNQISGLSNLERLRIMGADVTSDKSGLTNLTLLDLSHSAHDDLTKINTLPKVTSIDLSYNAITDIMPLMPELKSLNIQFDGVHDYRGIEDFPKLNTLLAYSQTIGGKKNSDIKSSKLTYNAENQTLYVPFSLMTERTVNYDGYVPDFVSTASSDTYFTMNEQQVNRLTITSDGLTVSDVSKTDFDNLEKMNARIDLSYQSYNTPEQFQNGGSYTISMPIYDHYFTVDLNITADSEKTYIENQLVTEATFLSDIH.......... 380
27 -21.800IDP05426 hypothetical protein lmo0610 [Listeria monocytogenes EGD-e] lmo0610 [Listeria monocytogenes EGD-e]  ali follow..  15  4.....................................................................MGVKIGLCILLIMPFTISANVSAEENISIKAAQDVVN----PALKSYLNGLLGQPSTSDITDTITDVTISNASLTDLTGLDYAHNLTILHLTNTGVTDYSLVIPSLTNLNISGSNLTTIPDLNGLTNVTNLNLSSGKLDNSANKLPNLTFLNLDNNSITDFMPLKSLPNLASLFIQFCGVNDFRGIFPKLTNLAAFGQNVGSAILITIKSSALNYNEANQTIFVPFMTERSMNFDGYLFPFTTNSTYFTLNGVQISGSRLS............................................................................... 288
28 -21.200IDP01918 hypothetical protein lmo0514 [Listeria monocytogenes EGD-e] lmo0514 [Listeria monocytogenes EGD-e]  ali follow..  13  18.........................................................................................IYPSTAAHAEETNIVNIPD--ANLKTYLNGLLKQASDAPITNTIQTVTLSGSTYTDLTGLEEAGNLVTLSLNNTNIQTLEPIQTSLTYLTVGGDNVKDFVDLNGLVNLQSLSINGSEVTHNVNKLPKLTYLYAQNSKITDISALASLPALTTLFLQFDGIDDFRPLFESFKNGNLKALAAFG---------------QNTGRTNPRLKSGKLDYNETNQTLYLPFSPKPLTSFDGTVAPFSKSTSA.......................................................................... 265
29 -20.800IDP01916 hypothetical protein lmo0327 [Listeria monocytogenes EGD-e] lmo0327 [Listeria monocytogenes EGD-e]  ali follow..  17  2......................................................................................................LKKIFIALIALVVIINTVSFTSVSASTPTWLEQMNNNEPFIKEIET--------ETGKTRANITQT-----DLEAIALRVTGASDIPNIDMLTHLTLLKAVQGTISSVPN-------------------SVGNLKELKILNLNTNHLSNFPTIVYKLEELQLNDGTIEEIPATISHLKFLTVNNNRLVKVPTIIFSTNWSNSSTGELDLFTTGNQIVTDIP...................................................................................... 200
30 -19.900IDP02661 hypothetical protein lmo1289 [Listeria monocytogenes EGD-e] lmo1289 [Listeria monocytogenes EGD-e]  ali follow..  11  1.......MMSIKSNIMKIGVCSVMVLPLSQTSLPSFAAEEIALKESQDVVNIPDPQLKKELNLYLNQAENADITEAQMA------------TFRNITLNSG-IKDL----TGIEYL--------------KNITTLSIN-NINASYEPIQTLSSLEKLVINGENVNA--SVLSNLTFLDLSRTNIDDFSKISNIPNLNKLDISNNKITKISELLPSLQELRVSDCQITNFKGIEKFPNLTAFYGDGQLFGIDSDGFKNIKSSELTFDANAKTLFVPFSIVTV-----------NTILNYDGLSLPYNTNPDYTSIGDQSYVVTNDKISINQQGITLSDFTQADFD................................................................ 310
31 -19.600IDP05549 hypothetical protein lmo0549 [Listeria monocytogenes EGD-e] lmo0549 [Listeria monocytogenes EGD-e]  ali follow..  14  10...................................................................................................................................LFVLILAFIVPVYSKAVETGKEVPKSPELLDDKSSTLKNVLKASPLTIPANSTIADLFPDEGMAKTIANQLGRTENN-------NFQTPTKTDWKVDDVVTEVELNRMWYLTSV-ATIGSIEGILPNLYDVRLQFDKFLKAPNGYSQLYRLNINNGNISDISPLAPTLNDIDLGGNNISDLSLFFPNLEEISLERNNISDVSPLSTKIKIFNLDENHITDLSSLMPNLQRLYVRYQTLDMEP.................................... 275
32 -12.900IDP92552 gene: NOD2; nucleotide-binding oligomerization domain-containing protein 2 [Homo sapiens] NP_071445 [Homo sapiens]  ali follow..  14  763.......................................................................NVGHLKLTFCSVG--PTECAALAFVLQHLRRPVAL-----QLDYNSVGDIGVEQLLPCLGVCKALYLRDNNISDIECALHCEQLQKLALFNNKLTD--ACRQNFLALRLGNNYITAAEGLRGNTSLQFLGFWGNRVGD-----EGAQAL---------AEALGDHQSLRWLSLVGNNIGS---------------QALALMLAKNVMLEELCLEENHLQ------------DEGVCSLAEGLKKNSSLKILKLSNNCITY------------LGAEALLQALERNDTILEVWLRGNTFSL-----EEVDKLGCRDTRLL................... 1039
33 -12.400CPX_91662_05666 Complex of CADH1_HUMAN with INLA_LISMO [Undefined organism]  ali follow..  20  959...........................................................................................DQVTTLQADRLGIKSIDGVEYLNNLTQINFSNNTPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLLTNLNRLELSSNTISDISALSGLTSLQQLSF-GNQVTDLKPLLTTLERLDISSNKVSDISVLAKLTNLESLIATNNQISDITPLLTNLDELSLNGNQLKDIGTLASNLTDLDLANNQISNLAPLLTKLTELKLGANQISNISPLLTALTNLELNENQLEDISPILKNLTYLTLYFNNISDISSSLTKLQRLFFYNNKVSDVSSLLTNINWLSAGHNQISDLTPLANLTRIT....... 1291
34 -12.300IDP04710 hypothetical protein [Yersinia pestis CO92] YPO0510 [Yersinia pestis CO92]  ali follow..  10  20......................................................................RHFTQRQLQQLTLSEVYFIQCTFTDISFAEIAVRNIHFESCHFTHLRLDGGRVENCSFRFCKFNDVSAQGVSILN-------TSCIEVQWQGCYLTGCLIERWLLTSCQLDDAQLQDI-------QLNYWTVQDTPMTHLTMSDSKMQDSSWHGCTIQQSV-----SELIRQVMGSCVLKECQYQAIQSDTVVWSQCQLEQVDFRHQPLENSNFHKSTLTQCGFSDANLAAALFSEATLEGCDFNMAQLAAAQFVDATLRDCNFDTADLQNASLLRANLTRCHLTQVNLTKADLRSCMLSESSLQASKLSKTRIHGAQIPTLDTPLQMPDPLLSQIDN. 341
35 -11.200IDP01014 gene: pipB2; secreted effector protein STM2780 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  11  35........................................................................EYIINFFTCGGIRRRNETQYQELIETMAETLKSTMPDRGAPLPENIILDDMDG-CRVEFNLPGENNEAGQVIV--RVSKGDHSETREIPLASFEKICRALLFRCEFSLPQDSVIL-------TAQGGMNLKGAVLTGANLTSENLCDADLSGANLEG-------AVLFMADCEGANFKGANLSGTSLGDSNFKNACLEDSIMCGATLDHANLTGANLQHASLLGCSMIECNCSGANMDHTNLSGATLIRADMSGATLQGATIMAAIMEGAVLTRANLRKASFISTNLDGADLAEANLNNTCFKDCTLTDLRTEDATMST.................. 336
36 -11.100IDP91553 gene: ECs5048; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB38471 [Escherichia coli O157:H7 str. Sakai]  ali follow..  18.........................................................DNHSVTSLSHTKKTDNYSKHHKNTLIDNKALSLFKMDDHEKVIDLIQKMKRIYDSLPSGKITKETDRKIHKY-ASYANNKCDDRITRRV-YLNKDKEVSIKVVYFINNVTVHNNTIEIPQTVNGGYDFSHL-------SLKGIVIKDEDLSNSNFAGCRLQNAIFQDCNMYK-------TNFNFAIMEKILFDNCILDDSYFAQIKMTDGTLNSCSAMHVQFYNATMNRANIKNTFLDYSNFYMAYMAEVNLYKVIAPYINLFRADLSFSKLDLINFKHADLSRVNLNKAILQNINLIDSKLFFTRLTNTFLEMVICTDSNMANVNFNNANLNNC---SVLTKAWMFNTRLY 360
37 -10.300IDP04356 hypothetical protein [Yersinia pestis CO92] YPO0509 [Yersinia pestis CO92]  ali follow..  141.ELMPEGMPLNVIRDLADHPDSLRYSASAMSEAESERFYQDVQDAIDRQEQQKSEEQETLGDLNVPAAGKEGTQWLESKEDTATNVTFLGTDFSGMTLDNKQFRYCMFTGCHFDKATFKDCTFEHCQFTQSDFENSRWNNVHLSG-------CLFKQAEWQKAAFTHCKWEKSTFEYGVFKHAQFTD-------NALDNCLINHSDFSLGTFDHCTLNGCFFSE------------THCDQTQFNQVIITSCIFEKCDGPKACFTESTIEKTSFISSSWVGGRLSHCYLNSLTTGLNNLSESHFEQCSLNKMGFLKVNLQSSTFINCSMLESCCDKADFSQATLIACDMTAVRLKDANLVHSHWQNTSLQQSMFYNADLRDATFQRCNLAG.................. 507
38 -9.410IDP91554 gene: ECs5021; hypothetical protein [Escherichia coli O157:H7 str. Sakai] BAB38444 [Escherichia coli O157:H7 str. Sakai]  ali follow..  3........................................................................................................................................................GHISKFDGNNSLIKHGVVQGNNIVDFDLLRNFNGGPG--ENFIYISNIFLNIKQRNEKNHSINMFREVSISGDIVSVK---EKIECACDFMMAKDAQGYIDLSELDLTSCHFKGDVISKVSFISSNLQHVTFECKEIGDCNFTTAIVDNVIFKCRRLHNVIFIKASGDYVDFSKNILDTVDFSQSQLTHSNFCECQIRNSNFDHCYLYASHFTRAEFLTDKEI-SNLTAVMFDHVRIST.................. 246

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.