current user: public

If you have questions about the server, please let us know.

Query: gi|16082705|ref|NP_395151.1| hypothetical protein (YPCD1.15c) [Yersinia pestis CO92], from Y.pestis

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150
# Score Template Links and tools%idFirst MVELCRLLKITRSVYSASLNFRVDVKRLQLRELHQQSRGAAGSRTLSLLMRQSGYNVVRWLARRLMRECGLASRQPGKPRYRGEREVSLASPDLLKRQFKPSEPNRVWSGYISYIKVNGGWCYLALVIDLYSRRIVGSAISSSPDAELVCRALast
1 -7.780sp|Q6R2W3|SCND3_HUMAN SCAN domain-containing protein 3 OS=Homo sapiens GN=SCAND3 PE=2 SV=1  ali   11  153.....................HSEDLFDILHNTHLSI-GHGGRTRMEKELQAKYKNITKEVIMLYLTLCKPCQQKNSKLKKVL-------------TSKSIKEVSSRCQVDLIQLNPDGEYRFILHYQDLCTKLTFLRSLKSKRPTEVA... 268
2 -7.740sp|Q96AP4|ZUFSP_HUMAN Zinc finger with UFM1-specific peptidase domain protein OS=Homo sapiens GN=ZUFSP PE=1 SV=1  ali follow..  392........................KIQSMIEDAWKEGFDPQGASQLNNRLQGTKAWIGACEVYILLTSLRVKCHIVDFHKSTGPLGTHPRLFEWILNYYSSEGEGSPKV-----VCTSKPPIYLQ---QGHSRTVIGIEEKKNRTLCLLI.. 510
3 -7.620sp|Q9WJR5|POK3_HUMAN HERV-K_19q12 provirus ancestral Pol protein OS=Homo sapiens GN=ERVK6 PE=2 SV=2  ali   11  98FNLLQQTVRKRNFPFYITHIRAHTNLPGPLTK---ANEQADLLVSSALIKAQELHALTHVNVAGLKNKFDVTWKQAKD-QHCTQCQVLHLPTQEAGVNPRGLCPNALWQMDVTHVSSFGRLSYIHVTVDTYSHFIWATCQTGESTSHVK... 244
4 -7.470sp|Q9UQG0|POK20_HUMAN HERV-K_3q27.3 provirus ancestral Pol protein OS=Homo sapiens PE=2 SV=2  ali   16  134.....................LVSSALIKAQELHALTH--VNAAGLKNK-----FDVTWKQAKDIVQHCTQCQVLHLPTQEAGVNPRG-------------LCPNALWQMDVTHVPSFGRLSYVHVTVDTYSHFIWATCQTGESTSHVK... 241
5 -7.430sp|P10266|POK10_HUMAN HERV-K_5q33.3 provirus ancestral Pol protein OS=Homo sapiens PE=3 SV=2  ali   12  95FNLLQQTVRKRNFPFYITYIRAHTNLPGPLTK---ANEQADLLVSSALIKAQELHALTHVNAAGLKNKFDVTWKQAKD-QHCTQCQVLHLPTQEAGVNPRGLCPNALWQMDVTHVPSFGRLSYVHVTVDTYSHFIWATCQTGESTSHVK... 241
6 -7.410sp|Q9BXR3|POK2_HUMAN HERV-K_7p22.1 provirus ancestral Pol protein OS=Homo sapiens GN=ERVK6 PE=2 SV=2  ali   19  196.......................................................................................................PNALWQMDVTHVPSFGRLSYVHVTVDTYSHFIWATCQTGESTSHVK... 241
7 -7.360sp|P63135|POK12_HUMAN HERV-K_1q22 provirus ancestral Pol protein OS=Homo sapiens PE=3 SV=1  ali   16  134.....................LVSSALIKAQELHALTH--VNAAGLKNKFD-----VTWKQAKDIVQHCTQCQILHLPTQEAGVNPRG-------------LCPNALWQMDVTHVPSFGRLSYVHVTVDTYSHFIWATCQTGESTSHVK... 241
8 -7.330sp|P63133|POK6_HUMAN HERV-K_8p23.1 provirus ancestral Pol protein OS=Homo sapiens PE=3 SV=1  ali   16  134.....................LVSSALIKAQELHALTH--VNAAGLKNK-----FDVTWKQAKDIVQHCTQCQVLHLPTQEAGVNPRG-------------LCPNALWQMDVTHVPSFGRLSYVHVTVDTYSHFIWATCQTGESTSHVK... 241
9 -7.290sp|P63132|POK5_HUMAN HERV-K_19p13.11 provirus ancestral Pol protein OS=Homo sapiens PE=3 SV=1  ali   16  134.....................LVSSALIKAQELHALTH--VNAAGLKNKFD-----VTWKQAKDIVQHCTQCQVLHLPTQEAGVNPRG-------------LCPNALWQMDVTHVPSFGRLSYVHVTVDTYSHFIWATCQTGESTSHVK... 241
10 -6.820sp|Q9BYC9|RM20_HUMAN 39S ribosomal protein L20, mitochondrial OS=Homo sapiens GN=MRPL20 PE=1 SV=1  ali follow..  15  10.................................................LRNRVTDRYFRIQEVLKHARHFRGRKNRCYRLAVRTVIRAFVKCTKARYLKKKNMRTLWINRITAASQEHGLKYPALIGNLVKCQV---ELNRKVLADLAI.. 107

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 8 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Jaroszewski L, Godzik A. Clustering of highly homologous sequences to reduce the size of large protein databases. Bioinformatics. 2001 Mar;17(3):282-3.