current user: public

If you have questions about the server, please let us know.

Query: gi|16082706|ref|NP_395152.1| hypothetical protein (YPCD1.16c) [Yersinia pestis CO92], from Y.pestis

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .
# Score Template Links and tools%idFirst MIMTQPKQTKRRFSPEFKLEAIEQVVKYQRSTIEVARALELDPSQLRKWIRQYKEEVSGMTPDNPALTPEQREIQSLRAQIKRLEMEKEILKQAAVLMSEFPIKSLRLast
1 -14.800sp|Q9P215|POGK_HUMAN Pogo transposable element with KRAB domain OS=Homo sapiens GN=POGK PE=1 SV=2  ali   11  41...QFSRGMRRSYDAGFKLMVVEYA--ESTNNCQAAKQFGVLEKNVRDWRKVKPQLQNAHAMRRAFRGPKNGRFALVDQRVAEDPITREAMQLKALEIAQE...... 145
2 -13.300sp|Q6B0B8|TIGD3_HUMAN Tigger transposable element-derived protein 3 OS=Homo sapiens GN=TIGD3 PE=1 SV=1  ali follow..  13  3...LSSKKKLHALSLAEKIQVLELLDESKMSQSEVARRFQVSQPQISRICKKLLADWCSGTANRERKRKRESKYSGIDEALKAWDVTGPMLLHKAKELADIMGQDFV 118
3 -12.400sp|Q7Z3K3|POGZ_HUMAN Pogo transposable element with ZNF domain OS=Homo sapiens GN=POGZ PE=1 SV=2  ali   13  64....SGGVGKKEQLSVKKLRVVLFALCCN--TEQAAEHFRNPQRRIRRWLRRFQASQGENLEGKYLSFEAEEKLAELTQREQQLPVNEETLFQKATKIGRSLEGGFK 166
4 -11.000sp|Q8N3X6|LCORL_HUMAN Ligand-dependent nuclear receptor corepressor-like protein OS=Homo sapiens GN=LCORL PE=2 SV=4  ali   14  69......RGRYRQYDHEIMEEAIAMVMSGKMSVSKAQGIYGVPHSTLEYKVKERSGTLKTPPKKKLRLPDTGLY.................................. 135
5 -10.700sp|B2RD01|CENP1_HUMAN CENPB DNA-binding domain-containing protein 1 OS=Homo sapiens GN=CENPBD1 PE=2 SV=1  ali follow..  19  14....SAKRERKAITLDLKLEVLRR-FEAGEKLSQIAKALDLAISTVATIRDS....................................................... 60
6 -10.200sp|Q6NT04|TIGD7_HUMAN Tigger transposable element-derived protein 7 OS=Homo sapiens GN=TIGD7 PE=2 SV=1  ali follow..  1...MNKRGKYTTLNLEEKMKVLSR-IEAGRSLKSVMDEFGISKSTFYDIKKNVLKQDMPLVGAEKRKRTTGAKYGDVDDAVAGVPVRGVELQAAAERFARC...... 113
7 -10.100sp|Q53EQ6|TIGD5_HUMAN Tigger transposable element-derived protein 5 OS=Homo sapiens GN=TIGD5 PE=2 SV=2  ali follow..  15  2.......AFRKAYSIKDKLQAIER-VKGGERQASVCRDFGVPGGTLRGWLKDEPKLRWFLEQLGGEVGTQRKKMRLLALRQHGVPLSGPLIQAQAEAFARQ...... 108
8 -10.100sp|Q17RP2|TIGD6_HUMAN Tigger transposable element-derived protein 6 OS=Homo sapiens GN=TIGD6 PE=2 SV=2  ali follow..  15  4....KGNKKRRQFSLEEKMKVVGA-VDSGKRKGDVAKEFGITPSTLSTFLKKFEEKVREASVGPQRKRMRSALYDDIDKAVKNILVTGSVIRKKALNLANM...... 111
9 -10.100sp|Q4W5G0|TIGD2_HUMAN Tigger transposable element-derived protein 2 OS=Homo sapiens GN=TIGD2 PE=2 SV=1  ali follow..  11  1...MLGKRKRVVLTIKDKLDIIKK-LEEGISFKKLSVVYGIGESTVRDIKKNYANSSDPTSGVSKRKSMKSSTYEELDRVMDGIPVSGTICAKQAKFFFDA...... 112
10 -10.100sp|Q8IY51|TIGD4_HUMAN Tigger transposable element-derived protein 4 OS=Homo sapiens GN=TIGD4 PE=1 SV=2  ali follow..  14  10.TLPVTVKKKKSLSIEEKIDIINA-VESGKKKAEIAAEYGIKKNSLSSIMKKVLEAFESLRFDPKRKRLRTAFYTDLEEALLNVPVNGPMLRLKANDFAQK...... 120
11 -10.100sp|Q96JN0|LCOR_HUMAN Ligand-dependent corepressor OS=Homo sapiens GN=LCOR PE=1 SV=2  ali follow..  13  341....KKRGRYRQYNSEILEEAISVVMSGKMSVSKAQSIYGIPHSTLEYKVKERLGTLKNPPKKKMKLMRSEGPDVSVKIELDP........................ 419
12 -9.980sp|Q9Y4A0|JERKL_HUMAN Jerky protein homolog-like OS=Homo sapiens GN=JRKL PE=2 SV=2  ali follow..  12  1...MSGKRKRVVLTIKDKLDIIKK-LEDGGSSKQLAVIYGIGETTVRDIRKNKEKSTSLLAKRKSMKPSMYEELDRAQQRAKGNPISGPICAKRAEFFFYA...... 112
13 -9.790sp|Q96MW7|TIGD1_HUMAN Tigger transposable element-derived protein 1 OS=Homo sapiens GN=TIGD1 PE=2 SV=1  ali follow..  12  6...SSERKSRTSLTLNQKLEMIKL-SEEGMSKAEIGRRLGLLRQTVSQVVNAVKSATPMNTRMIRKRNSLIADMEKVDQTSRNIPLSQSLIQNKALTLFNS...... 115
14 -9.520sp|P07199|CENPB_HUMAN Major centromere autoantigen B OS=Homo sapiens GN=CENPB PE=1 SV=2  ali follow..  18  1.....MGPKRRQLTFREKSRIIQEVEENPDRKGEIARRFNIPPSTLSTILKNERKYGVASTCRKTNKLSPYDKLEGLQIRAAGLPVKGIILKEKALRIAEE...... 110

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 5 8 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I. and Godzik A Connecting the Protein Structure Universe by Using Sparse Recurring Fragments. Structure (Camb.) (2005) Aug;13(8):1213-24