|
|
current user: public |
|
| Query: gi|40548797|ref|NP_954989.1| hypothetical protein (YPCD1.14n) [Yersinia pestis CO92], from Y.pestis |
| . 10 . 20 . 30 . 40 . 50 . 60 . | |||||||
| # | Score | Template | Links and tools | %id | First | MMQSMSRRGNCLDNSPMERVFRSLKSEWLLVGGYMDVHHAVRDIGEWIQSYYNTPPSAQWWITAL | Last |
| 1 | -7.310 | sp|Q8N6M0|OTU6B_HUMAN OTU domain-containing protein 6B OS=Homo sapiens GN=OTUD6B PE=1 SV=1 | ali follow.. | 12 | 149 | .IKQIPSDGHC--------MYKAIEDQLKEKDCALTVVALRSQTAEYMQ................ | 188 |
| 2 | -6.830 | sp|Q7L8S5|OTU6A_HUMAN OTU domain-containing protein 6A OS=Homo sapiens GN=OTUD6A PE=2 SV=1 | ali follow.. | 14 | 143 | .MKAIPADGHCMYRAIQDQLVFSVSVEMLRCRTASYMKKHVDEFLPFFS................ | 190 |
| 3 | -6.260 | sp|Q5T2D3|OTUD3_HUMAN OTU domain-containing protein 3 OS=Homo sapiens GN=OTUD3 PE=1 SV=1 | ali follow.. | 10 | 67 | .LREVPGDGNCLFRALGDQLEGHHRQETVQREDFEPFVEDDIPFEKHVA................ | 125 |
| 4 | -6.140 | sp|Q8WVE7|T170A_HUMAN Transmembrane protein 170A OS=Homo sapiens GN=TMEM170A PE=2 SV=1 | ali follow.. | 12 | 1 | ....MEREGSGGSGGSAGLLQQILSLKVVPRVGNGTLCPNSTSLCSFPEMWYG............ | 49 |
| 5 | -6.120 | sp|Q14694|UBP10_HUMAN Ubiquitin carboxyl-terminal hydrolase 10 OS=Homo sapiens GN=USP10 PE=1 SV=2 | ali | 20 | 265 | ..RGLINKGNCYINATLQAMYHLMKF....................................... | 295 |
| 6 | -6.050 | sp|Q96JH7|VCIP1_HUMAN Deubiquitinating protein VCIP135 OS=Homo sapiens GN=VCPIP1 PE=1 SV=2 | ali | 12 | 59 | IPVHVDGDGHCLVHAVSRALVGRELFW----------HALRENLKQHFQ................ | 97 |
| 7 | -6.020 | sp|Q6UXM1|LRIG3_HUMAN(removed signalp:1-24) Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Homo sapiens GN=LRIG3 PE=2 SV=1 | ali | 20 | 4 | ...PMYLKGNVYGSDPFETYHTGCSPD...................................... | 27 |
| 8 | -5.910 | sp|Q93008|USP9X_HUMAN Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Homo sapiens GN=USP9X PE=1 SV=3 | ali | 14 | 208 | ...GLKNAGTCYMNSVIQQLYMIIRNGILAIEGTGSDVDDDMSGDEKQDNESNVDPRDDVFGYP. | 271 |
| 9 | -5.730 | sp|O43314|VIP2_HUMAN Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 OS=Homo sapiens GN=PPIP5K2 PE=1 SV=3 | ali | 11 | 257 | LEKDFKTKNGRYDISKIPDIYDCIKYDVQHNGSL............................... | 290 |
| 10 | -5.620 | sp|Q6UXV3|YV010_HUMAN(removed signalp:1-30) Uncharacterized protein UNQ6126/PRO20091 OS=Homo sapiens GN=UNQ6126/PRO20091 PE=2 SV=1 | ali follow.. | 13 | 12 | VHASTSGSG-----ALTDQTFTDLSAAEASSEEVPDFMEVPHSVHHKINCFFYLEKQLCQLPSPL | 71 |
FFAS is supported by the NIH grant R01-GM087218-01
|
|
|
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Ye Y, Godzik A. Multiple flexible structure alignment using partial order graphs. Bioinformatics. 2005 Mar 3; |