|
current user: public |
|
Query: gi|16082698|ref|NP_395144.1| hypothetical protein (YPCD1.07) [Yersinia pestis CO92], from Y.pestis |
. 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . | |||||||
# | Score | Template | Links and tools | %id | First | MDKNKGIVFPPFSINIANIFVPDLSGANRFLACSLLEFLTYLSSVLLLMLWKILNIYIYGLMQHSRNQNIIAKRYIVYTVLFILKTANIRANPVTLSP | Last |
1 | -8.000 | 5z10_A mol:protein length:2547 Piezo-type mechanosensitive ion channel component 1 | ali model follow.. | 15 | 1685 | ..........................AHSELLCYFIIILNHMVTASAASLVLPVLVFLWAMLTIPRPSKRFWMTAIVFTEVMVV.............. | 1742 |
2 | -6.430 | 1yp5_A mol:protein length:58 Myosin-5 isoform | ali model follow.. | 10 | 1 | .....................PMFEAAYDFPGSGSPSELPLKKGDVIYITREEPSGWSLGKLLDGSKEGWVPTAYM...................... | 55 |
3 | -6.380 | 1gzm_A mol:protein length:349 RHODOPSIN | ali model follow.. | 20 | 71 | ..............TPLNYILLNLAVADLFMVCNLEGFFATLGGEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVG. | 175 |
4 | -6.090 | 6c6l_O mol:protein length:85 V-type proton ATPase subunit f | ali model follow.. | 7 | 1 | ....................MRPVVSTGKAWCCTVLSAFGVVILSVIAHLFNTNHESFVGSINDPEDGPAVAHTVYLAALVYLV.............. | 64 |
5 | -6.020 | 2j05_A mol:protein length:65 RAS GTPASE-ACTIVATING PROTEIN 1 | ali model follow.. | 6 | 14 | .............................YTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLV...................... | 60 |
6 | -5.880 | 2gqi_A mol:protein length:71 Ras GTPase-activating protein 1 | ali model follow.. | 6 | 16 | .............................YTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLV...................... | 62 |
7 | -5.840 | 2m51_A mol:protein length:62 Ras GTPase-activating protein 1 | ali model follow.. | 6 | 11 | .............................YTKVPDTDEISFLKGDMFIVHNELEDGWMWVTNLRTDEQGLIVEDLV...................... | 57 |
8 | -5.590 | 2z73_A mol:protein length:448 Rhodopsin | ali model follow.. | 14 | 67 | ..............TPANMFIINLAFSDFTFSCKVYGFIGGIFGFMSIMTMAMISIDRYVIGRPMAASKKMSHRRAFIMIIFVWLWSVLWAIGPIFG. | 173 |
9 | -5.460 | 5glh_A mol:protein length:498 Endothelin Receptor Subtype-B | ali model follow.. | 20 | 72 | ..............NGPNILIASLALGDLLHICKLVPFIQKASVGITVLSLCALSIDRYAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAI.. | 176 |
10 | -5.440 | 5nj6_A mol:protein length:437 Proteinase-activated receptor 2,Soluble cytochrome b562,Proteinase-activated receptor 2 | ali model follow.. | 13 | 55 | ..............APAVIYMANLALADLLSVCNVLIGFFYANMYCSILFLTCLSVQRAWEIVNPMGHSRKKANIAIGISLAIWLLILLVTIPLYV.. | 158 |
FFAS is supported by the NIH grant R01-GM087218-01
|
![]() ![]() ![]() ![]() ![]() ![]() |
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Rodrigues AP, Grant BJ, Godzik A, Friedberg I. The 2006 automated function prediction meeting. BMC Bioinformatics. 2007 May 22;8 Suppl 4:S1-4. |