|
current user: public |
|
Query: gi|16082705|ref|NP_395151.1| hypothetical protein (YPCD1.15c) [Yersinia pestis CO92], from Y.pestis |
. 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 . 120 . 130 . 140 . 150 | |||||||
# | Score | Template | Links and tools | %id | First | MVELCRLLKITRSVYSASLNFRVDVKRLQLRELHQQSRGAAGSRTLSLLMRQSGYNVVRWLARRLMRECGLASRQPGKPRYRGEREVSLASPDLLKRQFKPSEPNRVWSGYISYIKVNGGWCYLALVIDLYSRRIVGSAISSSPDAELVCRA | Last |
1 | -25.100 | PF13276.6; Q1WUI0_LACS1/209-271; HTH-like domain | ali follow.. | 21 | 1 | ......................EVELKAVIKGLFDYYETEYGVRRLSSQIRDYYQAPNHKRIQRLMHEMGLKCTKYNR.......................................................................... | 61 |
2 | -11.300 | PF02914.15; TRA_HAEIN/267-485; Bacteriophage Mu transposase | ali follow.. | 11 | 1 | ..................................................................................................VAMLQAMEWINGD-VWVRFPDG--KTWLWQDVRTRKVLAARTDKSENTDTIRLS | 61 |
3 | -9.410 | PF13610.6; Q6LW75_PHOPR/74-213; DDE domain | ali follow.. | 25 | 3 | ...........................................................................................................WQLDETYVKVKGKWHYLYRAIN--QGETLDFYFSHKRNKEAAYQ. | 45 |
4 | -9.380 | PF08461.10; O27611_METTH/14-79; Ribonuclease R winged-helix domain | ali follow.. | 22 | 2 | ............................EILRILAEHDDVLGAKIIASELRKKGYNLGERAVRYHMREKGFTERVGYAGRRITEK................................................................... | 61 |
5 | -8.490 | PF13551.6; C6C8A1_DICP7/11-74; Winged helix-turn helix | ali follow.. | 9 | 15 | VSKACKVMGVSRDTFYRYRELAEQGGVDALIN........................................................................................................................ | 46 |
6 | -8.460 | PF01498.18; A0P9K9_ONCMY/68-139; Transposase | ali follow.. | 15 | 16 | ..........................................LDELQRSTAEVGDSVHRTTISGVLHKSGLYGRVARRKPFLKDIHKK................................................................ | 61 |
7 | -8.040 | PF03400.13; Q32H87_SHIDS/20-150; IS1 transposase | ali follow.. | 19 | 6 | ......................................................................................................EMDEQW----GYVGAKSRQRWLFYAYDRLRKTVVAHVFGERTMATL.... | 47 |
8 | -7.360 | PF01710.16; P74195_SYNY3/1-119; Transposase | ali follow.. | 9 | 21 | ITKASKIFKVGRATIYRWLGREELGATKVETRQRKINRKEL-NPDMLLKERAKKFGVTPASLCYQFKKMKVTKKKNSYFIKREMPKSE................................................................ | 113 |
9 | -7.350 | PF01316.21; ARGR_BACLD/1-70; Arginine repressor, DNA binding domain | ali follow.. | 20 | 2 | .....................NKGQRHIKIREI--TANEIETQDELVDILKKDGYNVTQATVSRDIKELHL................................................................................. | 50 |
10 | -7.280 | PF16677.5; Q2NSD2_SODGM/10-108; DNA-packaging protein gp3 | ali follow.. | 11 | 31 | VAGLACYLGISRVTAQAYARENE-----EFSCTLEAIKTLQENRLINKGLTGDF---NATITKLMLANHGYSDKQE............................................................................ | 98 |
FFAS is supported by the NIH grant R01-GM087218-01
|
![]() ![]() ![]() ![]() ![]() ![]() |
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Jaroszewski L, Rychlewski L, Zhang B, Godzik A. Fold prediction by a hierarchy of sequence, threading, and modeling methods. Protein Sci. 1998 Jun;7(6):1431-40. |