|
current user: public |
|
Query: gi|40548796|ref|NP_395146.2| hypothetical protein (YPCD1.09c) [Yersinia pestis CO92], from Y.pestis |
. 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 | |||||||
# | Score | Template | Links and tools | %id | First | MAHVTSVTLGEHLTGFVGEMIQSGRYGNISEVLRDALRLMEAREQRVQHVRDMVLAGTNVPVSHRLMDEIFSAAVKDTSV | Last |
1 | -41.700 | PF03693.14; PARD1_MYCTU/1-80; Bacterial antitoxin of ParD toxin-antitoxin type II system and RHH | ali follow.. | 36 | 1 | MGKNTSFVLDEHYSAFIDGEIAAGRYRSASEVIRSALRLLEDRETQLRALREALEAGERSGSSTPFDDGFLGRKRADAS. | 80 |
2 | -16.600 | PF01402.21; Q8ZX60_PYRAE/47-86; Ribbon-helix-helix protein, copG family | ali follow.. | 28 | 2 | ....ISVHVPKKMLEELDELVRRGIFPNRSEAIRAALRDLLYK..................................... | 40 |
3 | -16.300 | PF17723.1; A9AUR9_HERA2/2-120; Ribbon-Helix-Helix transcriptional regulator family | ali follow.. | 20 | 3 | .IEKVSMNLSVVDLGQIDLLVDQGFYSSRTDFFRAAIRTRLAGHD................................... | 46 |
4 | -6.950 | PF15919.5; E1VAV2_HALED/3-129; HicB_like antitoxin of bacterial toxin-antitoxin system | ali follow.. | 28 | 90 | .SHKINVTLPELLIKRIDTAVAK-VYQSRSGFLSRA............................................ | 126 |
5 | -6.840 | PF15389.6; I3JX15_ORENI/2-111; Domain of unknown function (DUF4612 topsan) | ali follow.. | 30 | 77 | .GKILSIHSSESQQEFLDEKIEKGRYCSEEE................................................. | 110 |
6 | -6.400 | PF07704.11; A7IPR8_XANP2/1-84; Rv0623-like transcription factor | ali follow.. | 11 | 1 | ....MSLNIKNPATVALADELARRQGVTKTAAIHQALSERLHRMGYGDTAQARLLG........................ | 52 |
7 | -6.200 | PF18679.1; B8HTZ1_CYAP4/1-107; ThcOx helix turn helix domain | ali follow.. | 12 | 1 | MLDLFTLSFSPDLS--LQSKDDRLILEHPQPGLRTALEQLKQGNLTLAQLTELVSE........................ | 63 |
8 | -6.010 | PF17363.2; A0A0F4LLM4_9LACO/37-106; Family of unknown function (DUF5388 topsan) | ali follow.. | 10 | 6 | VTVPINIRVDNHIRNQISALLNLGLGKSQKDFVKNVVNLSESDRARFNKMFDILEE........................ | 66 |
9 | -5.590 | PF09386.10; K6Y9R3_9ALTE/1-76; Antitoxin ParD | ali follow.. | 4 | 2 | ...RLSIDITPEQLQHLKAAAAQGQ--SIKNYVLERALPKGNEQEALKKLETFLGPRVDKAIAGKISTSSVDSIFEE... | 74 |
10 | -5.470 | PF15213.6; F6SM24_HORSE/12-148; CMT1A duplicated region transcript 4 protein | ali follow.. | 19 | 2 | ...TENIGLPLNL---LEKHNPWPAYVTASPVVKKLIEKSKARELE.................................. | 42 |
FFAS is supported by the NIH grant R01-GM087218-01
|
![]() ![]() ![]() ![]() ![]() ![]() |
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Ye Y, Jaroszewski L, Li W, Godzik A. A segment alignment approach to protein comparison. Bioinformatics. 2003 Apr 12;19(6):742-9. |