Scheduled maintenance will begin on May 30th, 2025. Server will be temporarily unavailable — learn more.
current user: public

If you have questions about the server, please let us know.

Query: gi|40548796|ref|NP_395146.2| hypothetical protein (YPCD1.09c) [Yersinia pestis CO92], from Y.pestis

Results of FFAS03 search in PfamA32U
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80
# Score Template Links and tools%idFirst MAHVTSVTLGEHLTGFVGEMIQSGRYGNISEVLRDALRLMEAREQRVQHVRDMVLAGTNVPVSHRLMDEIFSAAVKDTSVLast
1 -41.700PF03693.14; PARD1_MYCTU/1-80; Bacterial antitoxin of ParD toxin-antitoxin type II system and RHH  ali follow..  36  1MGKNTSFVLDEHYSAFIDGEIAAGRYRSASEVIRSALRLLEDRETQLRALREALEAGERSGSSTPFDDGFLGRKRADAS. 80
2 -16.600PF01402.21; Q8ZX60_PYRAE/47-86; Ribbon-helix-helix protein, copG family  ali follow..  28  2....ISVHVPKKMLEELDELVRRGIFPNRSEAIRAALRDLLYK..................................... 40
3 -16.300PF17723.1; A9AUR9_HERA2/2-120; Ribbon-Helix-Helix transcriptional regulator family  ali follow..  20  3.IEKVSMNLSVVDLGQIDLLVDQGFYSSRTDFFRAAIRTRLAGHD................................... 46
4 -6.950PF15919.5; E1VAV2_HALED/3-129; HicB_like antitoxin of bacterial toxin-antitoxin system  ali follow..  28  90.SHKINVTLPELLIKRIDTAVAK-VYQSRSGFLSRA............................................ 126
5 -6.840PF15389.6; I3JX15_ORENI/2-111; Domain of unknown function (DUF4612 topsan)  ali follow..  30  77.GKILSIHSSESQQEFLDEKIEKGRYCSEEE................................................. 110
6 -6.400PF07704.11; A7IPR8_XANP2/1-84; Rv0623-like transcription factor  ali follow..  11  1....MSLNIKNPATVALADELARRQGVTKTAAIHQALSERLHRMGYGDTAQARLLG........................ 52
7 -6.200PF18679.1; B8HTZ1_CYAP4/1-107; ThcOx helix turn helix domain  ali follow..  12  1MLDLFTLSFSPDLS--LQSKDDRLILEHPQPGLRTALEQLKQGNLTLAQLTELVSE........................ 63
8 -6.010PF17363.2; A0A0F4LLM4_9LACO/37-106; Family of unknown function (DUF5388 topsan)  ali follow..  10  6VTVPINIRVDNHIRNQISALLNLGLGKSQKDFVKNVVNLSESDRARFNKMFDILEE........................ 66
9 -5.590PF09386.10; K6Y9R3_9ALTE/1-76; Antitoxin ParD  ali follow..  2...RLSIDITPEQLQHLKAAAAQGQ--SIKNYVLERALPKGNEQEALKKLETFLGPRVDKAIAGKISTSSVDSIFEE... 74
10 -5.470PF15213.6; F6SM24_HORSE/12-148; CMT1A duplicated region transcript 4 protein  ali follow..  19  2...TENIGLPLNL---LEKHNPWPAYVTASPVVKKLIEKSKARELE.................................. 42

FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 0 9 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Jaroszewski L, Li W, Godzik A. A segment alignment approach to protein comparison. Bioinformatics. 2003 Apr 12;19(6):742-9.