|
|
current user: public |
|
| Query: gi|40548797|ref|NP_954989.1| hypothetical protein (YPCD1.14n) [Yersinia pestis CO92], from Y.pestis |
| . 10 . 20 . 30 . 40 . 50 . 60 . | |||||||
| # | Score | Template | Links and tools | %id | First | MMQSMSRRGNCLDNSPMERVFRSLKSEWLLVGGYMDVHHAVRDIGEWIQSYYNTPPSAQWWITAL | Last |
| 1 | -24.900 | PF13333.6; Q5F880_NEIG1/215-270; Integrase core domain | ali follow.. | 27 | 1 | .................ESFFGTLKSECFHTCKYDSVTESEAALHEYIR-YYNNDRIKLKGLSPV | 49 |
| 2 | -22.600 | PF13683.6; Q7DB06_CAUVC/199-265; Integrase core domain | ali follow.. | 18 | 3 | VAWHYIAPGKPTQNGFVESFNGRMRDELLNETLFFGLDHARQKLAAWAED-YNTRRPHSGYQTP. | 67 |
| 3 | -6.820 | PF15606.6; RHSA_ECOLI/1298-1372; Bacterial toxin 34 | ali follow.. | 19 | 10 | ....IASRGNVADTGITDRVNDIINDRFWSDGKKPDRCDVLQELID................... | 51 |
| 4 | -5.780 | PF02320.16; B6QQG9_TALMQ/391-460; Ubiquinol-cytochrome C reductase hinge protein | ali follow.. | 18 | 55 | .........HCATQCAAPKLWKSLR........................................ | 70 |
| 5 | -5.480 | PF04745.12; VTF3S_VAR67/1-288; VITF-3 subunit protein | ali follow.. | 12 | 98 | ALLTIASKGCKLTETMIEAFFPELYNEHSKKFKFNSQVSIIQEKLGYQSGNYHVYDFEPYYST.. | 160 |
| 6 | -5.430 | PF15333.6; F6RBU1_HORSE/6-220; TATA box-binding protein-associated factor 1D | ali follow.. | 11 | 116 | ......RKILTFEQAVARGFFNKLKYEYHLKESLKQMNVGEDLEKDDLDSRRYKYLDDDGSLSPI | 177 |
| 7 | -5.260 | PF03051.15; PEPC_LACLA/3-433; Peptidase C1-like family | ali follow.. | 9 | 57 | .VTNQKQSGRCWMFAAL----NTFRHKFINEFKTEDFEFSQAYTFFW.................. | 98 |
| 8 | -5.130 | PF02890.14; O50716_BORBU/46-185; Borrelia family of unknown function DUF226 topsan | ali follow.. | 10 | 80 | ......KKGSVF--CYLRSLARLIKKEKINKKYFQTFIDMLNRLEKKVYEFYCKELPDGGIIN.. | 134 |
| 9 | -4.990 | PF14043.6; Q81YW0_BACAN/3-75; WVELL protein | ali follow.. | 14 | 26 | ................VELLWEDFQTTYAKSGRYQGEEMTEQVVRSWINNH.............. | 60 |
| 10 | -4.970 | PF17896.1; R1A_IBVB/14-371; Replicase polyprotein 1a N-terminal domain | ali follow.. | 15 | 227 | ........GTCL-NGAVAKFFEELPNGFMGSKIFTTLAFFKEAAVRVVENIPNAPRGTKGF.... | 281 |
FFAS is supported by the NIH grant R01-GM087218-01
|
|
|
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Ye Y, Godzik A. Multiple flexible structure alignment using partial order graphs. Bioinformatics. 2005 Mar 3; |