current user: public
If you have questions about the server, please let us know.

Query: gi|40548797|ref|NP_954989.1| hypothetical protein (YPCD1.14n) [Yersinia pestis CO92], from Y.pestis

Results of FFAS03 search in VFDB
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .
# Score Template Links and tools%idFirst MMQSMSRRGNCLDNSPMERVFRSLKSEWLLVGGYMDVHHAVRDIGEWIQSYYNTPPSAQWWITALLast
1 -26.300[L] COG2801 Transposase and inactivated derivatives  ali follow..  21  228MKHVRGAPYHPQTQGKIERWHQTLKNRILL-ENYFLPGDLEAQIGAFIE-HYNHARYHEENVTP. 291
2 -8.100[L] COG3316 Transposase and inactivated derivatives  ali follow..  14  131.............NNVIEGDHGRLKRILGPKGAFKNRISAYRTLKGM-EAMHSLRKGSGNDV... 178
3 -7.000[TO] KOG2606 OTU (ovarian tumor)-like cysteine protease  ali follow..  12  149.IKQIPSDGHC--------MYKAIEDQLKEKDCALTVVALRSQTAEYMQ................ 188
4 -6.080[L] COG3335 Transposase and inactivated derivatives  ali follow..  22  296...............QVERFFAIITDKAIRRGSFTSVKELVQKIDHFVAHYNQNCKPFAWTATA. 344
5 -5.840[TO] KOG3288 OTU-like cysteine protease  ali follow..  9  151LKKVVPADNSC--------LFTSIRFVLNGKVDNEGSEMMRHIIAQEVA................ 191
6 -5.600[L] COG4584 Transposase and inactivated derivatives  ali follow..  14  218FAPRVCKPYRAKTKGKVERFWVPLASKLKQIGLAADKDLCNQQVGLWLRDVANVRVHGTTKRVP. 289
7 -5.040[E] COG3579 Aminopeptidase C  ali follow..  7  60.VSNQKASGRCWMFAAL----NTFRHKLITEFKLENFELSQAHTFFW.................. 101
8 -4.660[C] KOG4763 Ubiquinol-cytochrome c reductase hinge protein  ali follow..  25  117.........HATDHCVAHKLFNNLK........................................ 132
9 -4.530[O] COG5207 Isopeptidase T  ali follow..  11  346...GLINLGNCYLNSVIQSLVNGFLGSKFPLDVVYPDNNLKCQWIKLLNAMKCEPELYPNGIKP. 415
10 -4.500[O] COG5539 Predicted cysteine protease (OTU family)  ali follow..  10  110SVHPVLDDNSCLFHAIAYGIFKQ-----------DSVRDLREMVSKEVL................ 147
FFAS is supported by the NIH grant R01-GM087218-01
1 4 8 3 1 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster
Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Multiple flexible structure alignment using partial order graphs. Bioinformatics. 2005 Mar 3;