current user: public

If you have questions about the server, please let us know.

Query: gi|16082717|ref|NP_395163.1| secreted effector protein (YPCD1.29c) [Yersinia pestis CO92], from Y.pestis

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400
# E-value Template Links and tools%idFirst MSALITHDRSTPVTGSLLPYVETPAPAPLQTQQVAGELKDKNGGVSSQGVQLPAPLAVVASQVTEGQQQEVTKLLESVTRGAAGSQLISNYVSVLTKFTLASPDTFEIELGKLVSNLEEVRKDIKIADIQRLHEQNMKKIEENQEKIKETEENAKQVKKSGIASKIFGWLSAIASVIVGAIMVASGVGAVAGAMMVASGVIGMANMAVKQAAEDGLISQEAMKILGPILTAIEVALTVVSTVMTFGGSALKCLANIGAKLGANTASLVAKGAEFSAKVAQISTGISNTVGSAVTKLGGSFAGLTMSHAIRTGSQATQVAVGVGSGITQTINNKKQADLQHNNADLALNKADMAALQSIIDRLKEELSHLSESHQQVMELIFQMINAKGDMLHNLAGRPHTVLast
1 1.000e-74UniRef50_Q06114 Protein YopB n=30 Tax=Bacteria TaxID=2 RepID=YOPB_YERPS  ali  99  1MSALITHDRSTPVTGSLLPYVETPAPAPLQTQQVAGELKDKNGGVSSQGVQLPAPLAVVASQVTEGQQQEVTKLLESVTRGAAGSQLISNYVSVLTKFTLASPDTFEIELGKLVSNLEEVRKDIKIADIQRLXXXXXXXXXXXXXXXXXXXXXXXXXXXXGIASKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGVIGMANMAVKQAAEDGLISQEAMKILGPILTAIEVALTVVSTVMTFGGSALKCLANIGAKLGANTASLAAKGAEFSAKVAQISTGISNTVGSAVTKLGGSFAGLTMSHAIRTGSQATQVAVGVGSGITQTINNKKQADLQHNNADLALNKADXXXXXXXXXXXXXXXXXXXXXHQQVMELIFQMINAKGDMLHNLAGRPHTV 401
2 5.000e-64UniRef50_Q70WN5 AopB protein n=21 Tax=Aeromonas TaxID=642 RepID=Q70WN5_AERSA  ali  38  4....ISNERQVSPLGNTGDVAGVPVTQPRSETRLDAATVQVTGQASKSGVSLNAPLMVSNSQVSAQQLGEIGKLVTSVNE---NTRLILPHTTGLVTAAFTSPEAFEIELGKLTSDLEKTQTKLKLDDIRQARTLNEKKIGENQAKIKEAEDSAQEAKKAGIFSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNMAVQQAAADGLISKEVMEKLGPALMGIEIAFAVMSAIASFGPLIGRAMTSLASKVGGKVADVAAKIAAKAGEMTAKVGEMAAKFGAKATVEAVKLTGQT-AKIAQVVTQATDIIIDVSSGAAKSAQSAKESESLSAQADLAMSKSEMTELQGVIDKLKEAIAQMIEAFQQTMEMIFQLINAKGDMMNNLARRPAAI 397
3 5.000e-59UniRef50_UPI00051C619D hypothetical protein n=1 Tax=Aeromonas finlandiensis TaxID=1543375 RepID=UPI00051C619D  ali  37  4....ISNERSNLAGNNIAPSIEAPTKTSVATAVAPGNTPAGRGALQSKSVELPSPLPAVNQNVTAEQTNEIAGLVEELWPVALKTVQFQAFNMLILS--FTSPDEFEIELGKVTDKLGEAQKKLKLAEVEQTRQKNIQQMDANQTKMKESAEAAEKAKKSGLFGKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQQAAQDGLISAETMKWLGPVMTALEVAMAVVSAVVTCGGAAAGKLAELGAKVGG-------KVAEVTGKIAAKAGVEAFKAGAKAATEVTKATLTATQKVVKTATGATDLVLNIGQGTASTVDSVFKANLQNKQADVVENRQDLTTLQAVMDKLKEALSQMTESFQHIMEMIFQMITAKGTMLQNIASRPSAI 395
4 1.000e-57UniRef50_Q5XL02 AopB n=40 Tax=Gammaproteobacteria TaxID=1236 RepID=Q5XL02_AERHY  ali  40  4....ISNERSVSSLGNTGEVTGSPVAQPRSETRLDAATAPASGQVRKPGVSLNAPLAVSNGQPASQQLTDVSRLLTQVKQNAS---LLLPHTNALVSAAFTSPEAFEIELGKLTSDLGKTQNRLKLADLDRAXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLASKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQQAAEDGLISKEVMEKLGPVLMAVEIILAVASAVVTFGAGAVKGLAKLGVKMGFKMAGKGA--SEMGLKLIQNSAKVYMKAADISAKVAGNAAS-TTAKMAKIGTQTADIIVDVGNGVTKTVDSANQAKLLLKQADLLENRQEMTALQGVIDKLKEAIAQMIEAFQQTMEMIFQMLNAKGDMMNNLARRPAAI 395
5 2.000e-57UniRef50_A0A2C8EZE6 Protein YopB n=12 Tax=Pseudomonadaceae TaxID=135621 RepID=A0A2C8EZE6_9PSED  ali  38  2IASAIDRNGLTPGAASTAEPDGPKRAEREHDVTVSRVQAQAWSAAPSQGVQLPAPAPGVAHSLQPQTLANIKQLVSTVIHDSSLTQQLLVAVPRLAAARLSSPQAFEIELSRITSELGSAQKANKLEDIKRAREQNLQKMDDNQKKIQESQDAAKEAQKSGLAAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSVQAAAAAGWISKETMEKLGPVLMGIEXXXXXXXXXXXXXXXXXXXXAKLGAKMG-------TKVAELTATIASKVTEFGSKFGT--------VASLSMSHGAKLGVQVADVTLDVANGASQAVNNSYQAHAALRQADVLENRAELSAFQAVIDILREELTRMVEAFTQVMEQIFQMINAKGDLLHNLSSRPAAI 388
6 9.000e-51UniRef50_A0A0F7LGR0 Uncharacterized protein n=13 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A0F7LGR0_9GAMM  ali  39  43............................................VTTRGVALSAPLAVSNTRLDVQQQGKIASLVASVTQGVTLAAGLLKETSRLASLAFSSPEEFEIELGKLTSDIERTQTNLKIQDIQRAXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLFSKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGAVSQGLQQAAQDGLISKETMKWLGPVMTAIEVTMAVAAAAVSFGGSAVGMIAKMGAKMGKIVAEVASKVGSKVVEVAAKAAVEVSKVAVKAAEFSAKFAGTATARSVKVGMQVSDMAVDLANGGAQTANSALQAKSANRQADVQLSRSELTAFQAVMDKLKEELSQMVESFQHVMEMVFQMLNAKDDMINNLASRPHEI 410
7 2.000e-48UniRef50_A0A263P1L4 Uncharacterized protein n=1 Tax=Pseudomonas sp. IB20 TaxID=1702250 RepID=A0A263P1L4_9PSED  ali  41  4....ITFDRVALTTGNVNDPVVRPRNDRGDALTVTRVEADGRPAAPSQGVQLTAPLPASQQRLEASTRADINRLVQSVRQDSVLAQRFIAETTRLGVARLSSXXXXXXXXXXXXXXXXXXXXXLKLEEITRAREQNLQKMDENQKKIKESTEAAKEAQKSGLVGKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQSVQQAAKDGLISKEVMEKLGPALMGIEXXXXXXXXXXXXXXXXXXXXXKLGAKIGG-------KAAELTASVAAKVTELGAKFGSA--------ASQSISHGVKLGVQISDVTLDVANGFAQTANSVLQAKAADKQADXXXXXXXXXXXXXXXXXXXXXLSRMVESFLQIMELIFQMINAKGDSLHNLSSRPAAI 387
8 2.000e-47UniRef50_Q9I324 Translocator protein PopB n=133 Tax=Gammaproteobacteria TaxID=1236 RepID=Q9I324_PSEAE  ali  34  22..................PALGRPVARDVESLRVERLAAPAAASASGTGVALTPPSAASQQRLEVANRAEIASLVQAVGEDVGLAQVVLAGASTLLSAGLMSPQAFEIELAKITGEVENQQKKLKLTEIEQARKQNLQKXXXXXXXXXXXXXXXXXXXXXGLAAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVVSQSVQQAAADGLISKEVMEKLGPALMGIEMAVALLAAVVSFGGSAVGGLARLGAKIGG-------KAAEMTASLASKVADLGGKFGS--------LAGQSLSHSLKLGVQVSDLTLDVANGAAQATHSGFQAKAANRQADVQESRADLTTLQGVXXXXXXXXXXXXXXXXXXXXXIFAMLQAKGETLHNLSSRPAAI 390
9 4.000e-47UniRef50_UPI000BE73CDF hypothetical protein n=1 Tax=Yersinia pestis TaxID=632 RepID=UPI000BE73CDF  ali  98  1.........................................................................................................FEIELGKLVSNLEEVRKDIKIADIHRLQEQNIKKXXXXXXXXXXXXXXXXXXXXXGIASKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSGVIGMANMAVKQAAEDGLISQEAMKILGPILTAIEVALTVVSTVMTFGGSALKCLANIGAKLGANTASLVAKGAEFSAKVAQISTGISNTVGSAVTKLGGSFAGLTMSHAIRTGSQATQVAVGVGSGITQTINNKKQADLQHNNADLALNKADXXXXXXXXXXXXXXXXXXXXXHQQVMELIFQMINAKGDMLHNLAGRPHTV 296
10 2.000e-46UniRef50_A0A1N6NI33 Type III secretion system translocon protein, YopB/IpaB/SipB family n=7 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A1N6NI33_9GAMM  ali  38  4....VTIDRSNMIGGVMAPEIDIGSKETRRATPMAAAEAGRNEGNKGKGVDLPQPKPGINQKVSVEQLQELKTLQQSVTQGSTAAQRLLGSVDKFVKTTFSSPEDFEIELGKLTTDLEKTQKKLKLADIERTRQQNVKKXXXXXXXXXXXXXXXXXXXXXGLVGKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQQAAEDGLISKEVMEKLGPVLVGIEIAMAILSSIVTFGGAALAHVAKGAGKIAARAAQLAAKVGMDTA----------------------QQTLSTTMKAVKLGTQAVDVVLDVSNGVAKTVDSTNQSKLQDKQADXXXXXXXXXXXXXXXXXXXXXXXXXXXXFQNILEMIFNMVTAKGAMLNNLSSRPAAI 385
11 5.000e-43UniRef50_Q6TLM0 AopB n=11 Tax=Aeromonas TaxID=642 RepID=Q6TLM0_AERHY  ali  41  4....ISSERPLSIGGMQPPLVEDSKGSSQATQVAAGDSH-RHVEKHGQGVVLPQPMPGIGQQMSPPKQQELDQLRKTAQLGTANAAKLLGSSTLLNKLAFASPEEFEIELSKMTSELEQTQKKLKLADLERIRAENLKKIDENQTKMKEASEAADKAKKSGLASKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQQAAADGRISPETMKX-------------------------------------XXXXXXXXXXXXXXXXXXXXXXXSAASTAMKAVKFA---------------TQAADLVVDIGTGTAKAVDGGLQADAQIKQANLLENRQVMTELQGVMDKLKEVLSQMTESFQQVMEMIFQMITAKGAMLNSLASRPTAI 347
12 4.000e-39UniRef50_UPI0006834ED6 hypothetical protein n=1 Tax=Yersinia enterocolitica TaxID=630 RepID=UPI0006834ED6  ali  94  1.........................................................MVASQVTEGQQQEITKLLESVTRGTAGSQLISNYVSVLTNFTLASPDTFEIELGKLVSNLEEVRKDIKIADIQRLXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMASKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGMANMAVKQAAEDGLISQEAMQVLGPILTAIEVALTVVSTVMTFGGSALKCLADIGAKLGANTASLAAKGAEFSAKVAQISTGISNTVGSAVTKLGGSFGSLTMSHVIRTGSQATQVAVGVGSGITQTINNKKQADLQHNNA.......................................................... 286
13 2.000e-32UniRef50_A0A2V3FVC8 Uncharacterized protein (Fragment) n=1 Tax=Pseudomonas aeruginosa TaxID=287 RepID=A0A2V3FVC8_PSEAI  ali  35  22..................PALGRPVARDVESLRVERLAAPAAASASGTGVALTPPSAASQQRLEVANRAEIASLVQAVGEDVGLAQVVLAGASTLLSAGLMSPQAFEIELAKITGEVENQQKKLKLTEIEQARKQNLQKMEHNQQKIRESEEAAKEAQKSGLAAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGVVSQSVQQAAADGLISKEVMEKLGPALMGIEXXXXXXXXXXXXXXXXXXXXARLGAKIGG-------KAAEMTASLASKVADLGGKFGS--------LAGQSLSHSLKLGVQVSDLTL................................................................................. 309
14 6.000e-31UniRef50_S2KFH0 Translocator protein n=1 Tax=Pseudomonas plecoglossicida NB2011 TaxID=1330531 RepID=S2KFH0_9PSED  ali  22  24......................TESPNQADAVVTISATPGQLGVMGSVDVAPALPLPALNGSLSAEATKQLEAALGALFERSELIEPIVKDLSQAAGLLVASPDAADLELQALLATIITDKSKIDRERILQARSENIERIQQNQDKMAESLNAAKEAKKSGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNALQQAAQDGLISKKAMEALGPVMMAVEXXXXXXXXXXXXXXXXXXXXXKVASKVATEVGGTVGELAASLSQKATKAANLATK--------AFDVAGKSVSTGVKVATSAPKLVADVGGGASKLAASVMDYKLASTEADTAQARAELDAGEALVRRLVEAYAPSNKALEDALDSMLGMLRDNAETQERVFNRMNNV 401
15 4.000e-30UniRef50_E3BLV8 Uncharacterized protein n=1 Tax=Vibrio caribbeanicus ATCC BAA-2122 TaxID=796620 RepID=E3BLV8_9VIBR  ali  25  18.SNQTTSDKVTGVASSATPAVTFENVKSKSTDV---------PKVGKSGIQLDPPNAAVNDTINEFTITGMQAMQTRLYSTVLKSVDSIIGGSPNIRTKVSDAADFELELAKITDQLKGAQSSIQKQDLSITKERHKKEMDANAEKLIESEAAAKEAQKAGLASKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDATTRILDHAGVDNPIAQKX-------------------------XXXXXXXXXXXXXXXXXXXXGAAKLAEVTAKAPQTILKTVNSLSTKVGNGLTKVAASTSAKAVKISSETTDVLANVGQGVSNLVSGIKRANVTGIEADLKNSSAAMELINAQMDKIKENISKVFESNQHIMDALMRIIQERYDVLNSVAQNNKSI 391
16 3.000e-29UniRef50_A0A0F7Y6D3 Uncharacterized protein n=19 Tax=cellular organisms TaxID=131567 RepID=A0A0F7Y6D3_9PSED  ali  23  13................IPPASEMETPLTGAAIRLPGDTGMASPSRPERSVELDPPLI----QGSLATGRDLEGLLDASIDPGRLMQPVLATVPDVGALILGSDAELDIRLTELLSRLGTRQTELNLQQVRQMTEQNRQQMALNAQKMAEVTQRHQDAGTASVFAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNQAAEDGHISKEVMKYLGPALMVVEVALAVASVVLTCGGSLAVVAAKLAGKV--------------SGKAAQVALSLGQKIQSVASSGSSSVASAGTQAKLQMTLTGASMATATLSGAGEAASSVMQGLALRSEAQLAEMRLVLEQGHGYLEQL....................................... 349
17 4.000e-28UniRef50_D2TXP8 Yop effector LopB n=1 Tax=Arsenophonus nasoniae TaxID=638 RepID=D2TXP8_9GAMM  ali  30  6.........TKPDTSSVQSLVNSSPITPIAKKSTANIALEKSPALSATKPSLQPNLPEPNANLAAKSTNSDTLLAKNVLQQEVVPAIDVKSSLKLLSLALTSPASFEVELSKVTSELQTNQQKLKLEDIQRIKQQNALKMDENQTKIQESEDAVKQSQKSGLAAKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNQIVQEAAAAGLISPETMKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAQVGAKIGGKAAEVTAKLPGMLSS-------------------GVTATTQSVANNVKTGLEVGNLVADVGETASQLASSITHSIASDKIADAKMLESVMTMSQSIXXXXXXXXXXXXXXXXXXXXXLTQMIHEKGEVLRELAVRPKTI 382
18 2.000e-24UniRef50_A0A2K1CFL4 Uncharacterized protein n=1 Tax=Vibrio agarivorans TaxID=153622 RepID=A0A2K1CFL4_9VIBR  ali  22  50............................................LSNDRVQLNKPNAEMVNKAIAFTSQEMERAQKIANTQDNNVKLFTSHILDSVDSLLSGKSNFELAFTLLLNKIGNLQRDLTVDKLNATKSTYEDDMVENQKKIKEAEKAALEAKQVGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXELTQKVINLPVVKDAFVSTFGEDAFNGLNTALTVVGVTCAVASVLITGGGSAAKLMTNLGSKLG----------VDMLTTAGSKLTNLITSLESVGAK-----SIAVTSHATNYVASGSSLALDTSKGITDITHYAKQIQMNYMEADXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMMRTMNSNVESLNKLNQN.... 400
19 2.000e-19UniRef50_F9T791 Translocator protein PopB n=3 Tax=Vibrio TaxID=662 RepID=F9T791_9VIBR  ali  28  7.......DRSQGTGYTQGP---DETKLEKNQQKTTGQTNVAAGNVQKNGAELPSPQVQVTEKSTPLTLAEIATLQQAVSALSGTMRATDQETTAIAVKIISSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQEMAENLEKIKESQEAAQEAKKSGLASKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQVVQKAMEAAGVDVKAF---GYAMMAIQGALAIASAGVAIGN---------------------------IVNALKGAVDVAAKTLSTAVKVT------------RTVAETVDTAANLGSSAADIANGVNQSKVANIQADLADIRAEMTLDQSVIDKLKEEIENILQGFQELMEIIMQMIQAKGETMQTVLNRPATV 371
20 2.000e-15UniRef50_A0A2X3I3G0 Translocator protein PopB n=1 Tax=Pseudomonas aeruginosa TaxID=287 RepID=A0A2X3I3G0_PSEAI  ali  38  21.........................................................................................................................................................................................................GVVSQSVQQAAADGLISKEVMEKLGPALMGIEXXXXXXXXXXXXXXXXXXXXARLGAKIGG-------KAAEMTASLASKVADLGGKFGS--------LAGQSLSHSLKLGVQVSDLTLDVANGAAQATHSGFQAKAANRQADVQESRADLTTLQGV........................................... 162
21 2.000e-15UniRef50_A0A1S6HYL3 Uncharacterized protein n=1 Tax=Shewanella psychrophila TaxID=225848 RepID=A0A1S6HYL3_9GAMM  ali  36  175..........................................................................................................................................QMKDNQTKIKESEEAAQEAKKSGLFGKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQAVQSALKDAGINVEAFQK---VMMALEIISAVVSTVASFGGAAVGKAAQLAGKVSTKIASGLTKVADKLDDLAKLGTAI-NKFGTAATK-------------VRTISTITETGANVAQGTASTVNTAFQANAVGKQAETEDSRAEVLAMRAVXXXXXXXXXXXXXXXXXXXXXIMQMINANGDSMKEILSRPAAV 425
22 1.000e-14UniRef50_U3AD67 Uncharacterized protein n=1 Tax=Vibrio azureus NBRC 104587 TaxID=1219077 RepID=U3AD67_9VIBR  ali  22  228.....................................................................................................................................................................................................ELTQKVINIPEVKSSIENVIGEDAFKAIDTTLTVGAIAFAVSSLLITGGGSAANLMTKLGTKLPGSVGNLLTNAGSKATTLIASAENIGARTAT------------TTGHITRFSAEGADLALDISKGISSTVYTARQAQSAEVQADXXXXXXXXXXXXXXXXXXXXXMTKATEVHRELMITMMQTMQSNFTSLKTLNARPQVI 419
23 6.000e-12UniRef50_A0A2V3FYT0 Uncharacterized protein (Fragment) n=10 Tax=Pseudomonas aeruginosa TaxID=287 RepID=A0A2V3FYT0_PSEAI  ali  37  4.........................................................................................................................................................................................................................................................................................................GSLAGQSLSHSLKLGVQVSDLTLDVANGAAQATHSGFQAKAANRQADVQESRADLTTLQGVXXXXXXXXXXXXXXXXXXXXXIFAMLQAKGETLHNLSSRPAAI 107
24 3.000e-09UniRef50_A0A1B8HFS9 Uncharacterized protein n=6 Tax=Morganella TaxID=108061 RepID=A0A1B8HFS9_9GAMM  ali  31  42........................................................................................................NFETELALLLTQIKSDMKEMKVSQIRQAREENTQKXXXXXXXXXXXXXXXXXXXXXRTANKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTSASSQIINEMAEAGMIDDDVMKYLGPAMTGLQVAVGIATCVVTFGGGAVSAVAQEGVHAG---QMLAQTGLSISGSVLDAGAVISGTTASVLANMGNK...................................................................................................... 233
25 1.000e-07UniRef50_K5U5S2 Protein yopB n=169 Tax=Vibrionaceae TaxID=641 RepID=K5U5S2_VIBHA  ali  33  218..............................................................................................................................................................................................................................................................................AAKSAGKIAQKVTDIATKAAANMAKIAGSKAATTTAKAIRFGAETVDLAVNVGKGTTDAVHASNNAKVTNIQSDITDLRAKMTLSQAVXXXXXXXXXXXXXXXXXXXXXIMQMIQAKGETMQAVMSRPATV 350

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 9 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.